2 * Jalview - A Sequence Alignment Editor and Viewer (Version 2.9)
3 * Copyright (C) 2015 The Jalview Authors
5 * This file is part of Jalview.
7 * Jalview is free software: you can redistribute it and/or
8 * modify it under the terms of the GNU General Public License
9 * as published by the Free Software Foundation, either version 3
10 * of the License, or (at your option) any later version.
12 * Jalview is distributed in the hope that it will be useful, but
13 * WITHOUT ANY WARRANTY; without even the implied warranty
14 * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
15 * PURPOSE. See the GNU General Public License for more details.
17 * You should have received a copy of the GNU General Public License
18 * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
19 * The Jalview Authors are detailed in the 'AUTHORS' file.
23 import static org.testng.AssertJUnit.assertNotNull;
25 import jalview.api.AlignExportSettingI;
26 import jalview.datamodel.Alignment;
27 import jalview.datamodel.AlignmentAnnotation;
28 import jalview.datamodel.AlignmentI;
29 import jalview.datamodel.Annotation;
30 import jalview.datamodel.ColumnSelection;
31 import jalview.datamodel.Sequence;
32 import jalview.datamodel.SequenceFeature;
33 import jalview.datamodel.SequenceGroup;
34 import jalview.datamodel.SequenceI;
35 import jalview.gui.AlignFrame;
36 import jalview.json.binding.biojson.v1.ColourSchemeMapper;
37 import jalview.schemes.ColourSchemeI;
39 import java.io.IOException;
40 import java.util.ArrayList;
41 import java.util.HashMap;
42 import java.util.List;
44 import org.testng.Assert;
45 import org.testng.AssertJUnit;
46 import org.testng.annotations.AfterTest;
47 import org.testng.annotations.BeforeMethod;
48 import org.testng.annotations.BeforeTest;
49 import org.testng.annotations.Test;
51 public class JSONFileTest
54 private int TEST_SEQ_HEIGHT = 0;
56 private int TEST_GRP_HEIGHT = 0;
58 private int TEST_ANOT_HEIGHT = 0;
60 private int TEST_CS_HEIGHT = 0;
62 private String TEST_JSON_FILE = "examples/example.json";
64 private Alignment alignment;
66 private HashMap<String, SequenceI> expectedSeqs = new HashMap<String, SequenceI>();
68 private HashMap<String, AlignmentAnnotation> expectedAnnots = new HashMap<String, AlignmentAnnotation>();
70 private HashMap<String, SequenceGroup> expectedGrps = new HashMap<String, SequenceGroup>();
72 private ColumnSelection expectedColSel = new ColumnSelection();
74 private SequenceI[] expectedHiddenSeqs = new SequenceI[1];
76 private AlignmentI testAlignment;
78 private int passedCount;
80 private JSONFile testJsonFile;
84 @BeforeTest(alwaysRun = true)
85 public void setup() throws Exception
87 // create and add sequences
88 Sequence[] seqs = new Sequence[5];
89 seqs[0] = new Sequence("FER_CAPAN",
90 "SVSATMISTSFMPRKPAVTSL-KPIPNVGE--ALF", 3, 34);
91 seqs[1] = new Sequence("FER1_SOLLC",
92 "SISGTMISTSFLPRKPAVTSL-KAISNVGE--ALF", 3, 34);
93 seqs[2] = new Sequence("Q93XJ9_SOLTU",
94 "SISGTMISTSFLPRKPVVTSL-KAISNVGE--ALF", 3, 34);
95 seqs[3] = new Sequence("FER1_PEA",
96 "ALYGTAVSTSFLRTQPMPMSV-TTTKAFSN--GFL", 6, 37);
97 seqs[4] = new Sequence("Q7XA98_TRIPR",
98 "ALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGF", 6, 39);
100 SequenceI hiddenSeq = new Sequence("FER_TOCH",
101 "FILGTMISKSFLFRKPAVTSL-KAISNVGE--ALF", 3, 34);
102 expectedHiddenSeqs[0] = hiddenSeq;
104 // create and add sequence features
105 SequenceFeature seqFeature2 = new SequenceFeature("feature_x",
106 "desciption", "status", 6, 15, "Jalview");
107 SequenceFeature seqFeature3 = new SequenceFeature("feature_x",
108 "desciption", "status", 9, 18, "Jalview");
109 SequenceFeature seqFeature4 = new SequenceFeature("feature_x",
110 "desciption", "status", 9, 18, "Jalview");
111 seqs[2].addSequenceFeature(seqFeature2);
112 seqs[3].addSequenceFeature(seqFeature3);
113 seqs[4].addSequenceFeature(seqFeature4);
115 for (Sequence seq : seqs)
117 seq.setDatasetSequence(seq);
118 expectedSeqs.put(seq.getName(), seq);
121 // create and add sequence groups
122 ArrayList<SequenceI> grpSeqs = new ArrayList<SequenceI>();
123 grpSeqs.add(seqs[1]);
124 grpSeqs.add(seqs[2]);
125 grpSeqs.add(seqs[3]);
126 grpSeqs.add(seqs[4]);
127 SequenceGroup seqGrp = new SequenceGroup(grpSeqs, "JGroup:1883305585",
128 null, true, true, false, 21, 29);
129 ColourSchemeI scheme = ColourSchemeMapper.getJalviewColourScheme(
132 seqGrp.setShowNonconserved(false);
133 seqGrp.setDescription(null);
135 expectedGrps.put(seqGrp.getName(), seqGrp);
137 // create and add annotation
138 Annotation[] annot = new Annotation[35];
139 annot[0] = new Annotation("", "", '\u0000', 0);
140 annot[1] = new Annotation("", "", '\u0000', 0);
141 annot[2] = new Annotation("α", "", 'H', 0);
142 annot[3] = new Annotation("α", "", 'H', 0);
143 annot[4] = new Annotation("α", "", 'H', 0);
144 annot[5] = new Annotation("", "", '\u0000', 0);
145 annot[6] = new Annotation("", "", '\u0000', 0);
146 annot[7] = new Annotation("", "", '\u0000', 0);
147 annot[8] = new Annotation("β", "", 'E', 0);
148 annot[9] = new Annotation("β", "", 'E', 0);
149 annot[10] = new Annotation("β", "", 'E', 0);
150 annot[11] = new Annotation("β", "", 'E', 0);
151 annot[12] = new Annotation("β", "", 'E', 0);
152 annot[13] = new Annotation("β", "", 'E', 0);
153 annot[14] = new Annotation("β", "", 'E', 0);
154 annot[15] = new Annotation("β", "", 'E', 0);
155 annot[16] = new Annotation("", "", '\u0000', 0);
156 annot[17] = new Annotation("", "", '\u0000', 0);
157 annot[18] = new Annotation("", "", '\u0000', 0);
158 annot[19] = new Annotation("", "", '\u0000', 0);
159 annot[20] = new Annotation("", "", '\u0000', 0);
160 annot[21] = new Annotation("", "", '\u0000', 0);
161 annot[22] = new Annotation("", "", '\u0000', 0);
162 annot[23] = new Annotation("", "", '\u0000', 0);
163 annot[24] = new Annotation("", "", '\u0000', 0);
164 annot[25] = new Annotation("", "", '\u0000', 0);
165 annot[26] = new Annotation("α", "", 'H', 0);
166 annot[27] = new Annotation("α", "", 'H', 0);
167 annot[28] = new Annotation("α", "", 'H', 0);
168 annot[29] = new Annotation("α", "", 'H', 0);
169 annot[30] = new Annotation("α", "", 'H', 0);
170 annot[31] = new Annotation("", "", '\u0000', 0);
171 annot[32] = new Annotation("", "", '\u0000', 0);
172 annot[33] = new Annotation("", "", '\u0000', 0);
173 annot[34] = new Annotation("", "", '\u0000', 0);
175 AlignmentAnnotation alignAnnot = new AlignmentAnnotation(
176 "Secondary Structure", "New description", annot);
177 expectedAnnots.put(alignAnnot.label, alignAnnot);
179 expectedColSel.hideColumns(32, 33);
180 expectedColSel.hideColumns(34, 34);
182 TEST_SEQ_HEIGHT = expectedSeqs.size();
183 TEST_GRP_HEIGHT = expectedGrps.size();
184 TEST_ANOT_HEIGHT = expectedAnnots.size();
185 TEST_CS_HEIGHT = expectedColSel.getHiddenColumns().size();
187 AlignExportSettingI exportSettings = new AlignExportSettingI()
190 public boolean isExportHiddenSequences()
196 public boolean isExportHiddenColumns()
202 public boolean isExportGroups()
208 public boolean isExportFeatures()
214 public boolean isExportAnnotations()
220 public boolean isCancelled()
226 AppletFormatAdapter formatAdapter = new AppletFormatAdapter();
229 alignment = (Alignment) formatAdapter.readFile(TEST_JSON_FILE,
230 AppletFormatAdapter.FILE, JSONFile.FILE_DESC);
231 jf = (JSONFile) formatAdapter.getAlignFile();
233 AlignFrame af = new AlignFrame(alignment, jf.getHiddenSequences(),
234 jf.getColumnSelection(), AlignFrame.DEFAULT_WIDTH,
235 AlignFrame.DEFAULT_HEIGHT);
236 af.getViewport().setShowSequenceFeatures(jf.isShowSeqFeatures());
237 String colourSchemeName = jf.getGlobalColourScheme();
238 ColourSchemeI cs = ColourSchemeMapper.getJalviewColourScheme(
239 colourSchemeName, alignment);
241 af.getViewport().setFeaturesDisplayed(jf.getDisplayedFeatures());
243 formatAdapter = new AppletFormatAdapter(af.alignPanel, exportSettings);
244 String jsonOutput = formatAdapter.formatSequences(JSONFile.FILE_DESC,
245 af.alignPanel.getAlignment(), false);
247 formatAdapter = new AppletFormatAdapter();
248 testAlignment = formatAdapter.readFile(jsonOutput,
249 AppletFormatAdapter.PASTE, JSONFile.FILE_DESC);
250 testJsonFile = (JSONFile) formatAdapter.getAlignFile();
251 // System.out.println(jsonOutput);
252 } catch (IOException e)
259 @BeforeMethod(alwaysRun = true)
260 public void methodSetup()
266 public void tearDown() throws Exception
271 expectedAnnots = null;
273 testAlignment = null;
277 @Test(groups = { "Functional" })
278 public void roundTripTest()
280 assertNotNull("JSON roundtrip test failed!", testJsonFile);
283 @Test(groups = { "Functional" })
284 public void testSeqParsed()
286 assertNotNull("Couldn't read supplied alignment data.", testAlignment);
287 Assert.assertNotNull(testAlignment.getSequences());
288 for (SequenceI seq : testAlignment.getSequences())
290 SequenceI expectedSeq = expectedSeqs.get(seq.getName());
291 AssertJUnit.assertTrue(
292 "Failed Sequence Test for >>> " + seq.getName(),
293 isSeqMatched(expectedSeq, seq));
296 AssertJUnit.assertEquals("Some Sequences did not pass the test",
297 TEST_SEQ_HEIGHT, passedCount);
300 @Test(groups = { "Functional" })
301 public void hiddenColsTest()
303 ColumnSelection cs = testJsonFile.getColumnSelection();
304 Assert.assertNotNull(cs);
305 Assert.assertNotNull(cs.getHiddenColumns());
306 List<int[]> hiddenCols = cs.getHiddenColumns();
307 Assert.assertEquals(hiddenCols.size(), TEST_CS_HEIGHT);
308 Assert.assertEquals(hiddenCols, expectedColSel.getHiddenColumns(),
309 "Mismatched hidden columns!");
312 @Test(groups = { "Functional" })
313 public void hiddenSeqsTest()
315 Assert.assertNotNull(testJsonFile.getHiddenSequences(),
316 "Hidden sequence Expected but found Null");
317 Assert.assertEquals(jf.getHiddenSequences().length, 1, "Hidden sequece");
320 @Test(groups = { "Functional" })
321 public void colorSchemeTest()
323 Assert.assertNotNull(testJsonFile.getGlobalColourScheme(),
324 "Colourscheme is null, parsing failed!");
325 Assert.assertEquals(testJsonFile.getGlobalColourScheme(), "Zappo",
326 "Zappo colour scheme expected!");
327 // Assert.assertTrue(
328 // testJsonFile.getGlobalColourScheme() instanceof ZappoColourScheme,
329 // "Zappo colour scheme expected!");
332 @Test(groups = { "Functional" })
333 public void isShowSeqFeaturesSet()
335 Assert.assertTrue(testJsonFile.isShowSeqFeatures(),
336 "Sequence feature isDisplayed setting expected to be true");
339 @Test(groups = { "Functional" })
340 public void testGrpParsed()
342 Assert.assertNotNull(testAlignment.getGroups());
343 for (SequenceGroup seqGrp : testAlignment.getGroups())
345 SequenceGroup expectedGrp = expectedGrps.get(seqGrp.getName());
346 AssertJUnit.assertTrue(
347 "Failed SequenceGroup Test for >>> " + seqGrp.getName(),
348 isGroupMatched(expectedGrp, seqGrp));
351 AssertJUnit.assertEquals("Some SequenceGroups did not pass the test",
352 TEST_GRP_HEIGHT, passedCount);
355 @Test(groups = { "Functional" })
356 public void testAnnotationParsed()
358 Assert.assertNotNull(testAlignment.getAlignmentAnnotation());
359 for (AlignmentAnnotation annot : testAlignment.getAlignmentAnnotation())
361 AlignmentAnnotation expectedAnnot = expectedAnnots.get(annot.label);
362 AssertJUnit.assertTrue("Failed AlignmentAnnotation Test for >>> "
363 + annot.label, isAnnotationMatched(expectedAnnot, annot));
366 AssertJUnit.assertEquals("Some Sequences did not pass the test",
367 TEST_ANOT_HEIGHT, passedCount);
370 public boolean isAnnotationMatched(AlignmentAnnotation eAnnot,
371 AlignmentAnnotation annot)
373 if (!eAnnot.label.equals(annot.label)
374 || !eAnnot.description.equals(annot.description)
375 || eAnnot.annotations.length != annot.annotations.length)
380 for (int x = 0; x < annot.annotations.length; x++)
382 Annotation y = annot.annotations[x];
383 Annotation z = annot.annotations[x];
385 if (!y.displayCharacter.equals(z.displayCharacter)
386 || y.value != z.value
387 || y.secondaryStructure != z.secondaryStructure)
395 public boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq)
397 System.out.println("Testing >>> " + actualSeq.getName());
399 if (expectedSeq.getName().equals(actualSeq.getName())
400 && expectedSeq.getSequenceAsString().equals(
401 actualSeq.getSequenceAsString())
402 && expectedSeq.getStart() == actualSeq.getStart()
403 && expectedSeq.getEnd() == actualSeq.getEnd()
404 && featuresMatched(expectedSeq, actualSeq))
411 public boolean isGroupMatched(SequenceGroup expectedGrp,
412 SequenceGroup actualGrp)
415 System.out.println("Testing >>> " + actualGrp.getName());
416 System.out.println(expectedGrp.getName() + " | " + actualGrp.getName());
417 System.out.println(expectedGrp.getColourText() + " | "
418 + actualGrp.getColourText());
419 System.out.println(expectedGrp.getDisplayBoxes() + " | "
420 + actualGrp.getDisplayBoxes());
421 System.out.println(expectedGrp.getIgnoreGapsConsensus() + " | "
422 + actualGrp.getIgnoreGapsConsensus());
423 System.out.println(expectedGrp.getSequences().size() + " | "
424 + actualGrp.getSequences().size());
425 System.out.println(expectedGrp.getStartRes() + " | "
426 + actualGrp.getStartRes());
427 System.out.println(expectedGrp.getEndRes() + " | "
428 + actualGrp.getEndRes());
429 System.out.println(expectedGrp.cs + " | " + actualGrp.cs);
431 if (expectedGrp.getName().equals(actualGrp.getName())
432 && expectedGrp.getColourText() == actualGrp.getColourText()
433 && expectedGrp.getDisplayBoxes() == actualGrp.getDisplayBoxes()
434 && expectedGrp.getIgnoreGapsConsensus() == actualGrp
435 .getIgnoreGapsConsensus()
436 && (expectedGrp.cs.getClass().equals(actualGrp.cs.getClass()))
437 && expectedGrp.getSequences().size() == actualGrp
438 .getSequences().size()
439 && expectedGrp.getStartRes() == actualGrp.getStartRes()
440 && expectedGrp.getEndRes() == actualGrp.getEndRes())
447 private boolean featuresMatched(SequenceI seq1, SequenceI seq2)
449 boolean matched = false;
452 if (seq1 == null && seq2 == null)
457 SequenceFeature[] inFeature = seq1.getSequenceFeatures();
458 SequenceFeature[] outFeature = seq2.getSequenceFeatures();
460 if (inFeature == null && outFeature == null)
464 else if ((inFeature == null && outFeature != null)
465 || (inFeature != null && outFeature == null))
470 int testSize = inFeature.length;
471 int matchedCount = 0;
472 for (SequenceFeature in : inFeature)
474 for (SequenceFeature out : outFeature)
476 System.out.println(out.getType() + " | " + in.getType());
477 System.out.println(out.getBegin() + " | " + in.getBegin());
478 System.out.println(out.getEnd() + " | " + in.getEnd());
480 if (inFeature.length == outFeature.length
481 && in.getBegin() == out.getBegin()
482 && in.getEnd() == out.getEnd()
483 && in.getScore() == out.getScore()
484 && in.getFeatureGroup().equals(out.getFeatureGroup())
485 && in.getType().equals(out.getType()))
492 System.out.println("matched count >>>>>> " + matchedCount);
493 if (testSize == matchedCount)
497 } catch (Exception e)
501 // System.out.println(">>>>>>>>>>>>>> features matched : " + matched);