2 * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
3 * Copyright (C) $$Year-Rel$$ The Jalview Authors
5 * This file is part of Jalview.
7 * Jalview is free software: you can redistribute it and/or
8 * modify it under the terms of the GNU General Public License
9 * as published by the Free Software Foundation, either version 3
10 * of the License, or (at your option) any later version.
12 * Jalview is distributed in the hope that it will be useful, but
13 * WITHOUT ANY WARRANTY; without even the implied warranty
14 * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
15 * PURPOSE. See the GNU General Public License for more details.
17 * You should have received a copy of the GNU General Public License
18 * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
19 * The Jalview Authors are detailed in the 'AUTHORS' file.
21 package jalview.ws.sifts;
23 import static org.testng.Assert.assertEquals;
24 import static org.testng.Assert.assertTrue;
26 import jalview.api.DBRefEntryI;
27 import jalview.bin.Cache;
28 import jalview.datamodel.DBRefEntry;
29 import jalview.datamodel.DBRefSource;
30 import jalview.datamodel.Sequence;
31 import jalview.datamodel.SequenceI;
32 import jalview.gui.JvOptionPane;
33 import jalview.io.DataSourceType;
34 import jalview.structure.StructureMapping;
35 import jalview.structure.StructureMappingClient.StructureMappingException;
36 import jalview.xml.binding.sifts.Entry.Entity;
39 import java.io.IOException;
40 import java.util.ArrayList;
41 import java.util.HashMap;
42 import java.util.Iterator;
45 import junit.extensions.PA;
47 import org.testng.Assert;
48 import org.testng.FileAssert;
49 import org.testng.annotations.AfterTest;
50 import org.testng.annotations.BeforeClass;
51 import org.testng.annotations.BeforeTest;
52 import org.testng.annotations.Test;
55 import MCview.PDBfile;
57 public class SiftsClientTest
60 @BeforeClass(alwaysRun = true)
61 public void setUpJvOptionPane()
63 JvOptionPane.setInteractiveMode(false);
64 JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
67 public static final String DEFAULT_SIFTS_DOWNLOAD_DIR = System
68 .getProperty("user.home")
70 + ".sifts_downloads" + File.separatorChar;
72 private String testPDBId = "1a70";
74 private SiftsClient siftsClient = null;
76 SequenceI testSeq = new Sequence(
78 "MAAT..TTTMMG..MATTFVPKPQAPPMMAALPSNTGR..SLFGLKT.GSR..GGRMTMA"
79 + "AYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDD"
80 + "QSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEELTA.", 1, 147);
82 int u = StructureMapping.UNASSIGNED;
84 HashMap<Integer, int[]> expectedMapping = new HashMap<Integer, int[]>();
86 @BeforeTest(alwaysRun = true)
87 public void populateExpectedMapping() throws SiftsException
89 expectedMapping.put(51, new int[] { 1, 2 });
90 expectedMapping.put(52, new int[] { 2, 7 });
91 expectedMapping.put(53, new int[] { 3, 12 });
92 expectedMapping.put(54, new int[] { 4, 24 });
93 expectedMapping.put(55, new int[] { 5, 33 });
94 expectedMapping.put(56, new int[] { 6, 40 });
95 expectedMapping.put(57, new int[] { 7, 47 });
96 expectedMapping.put(58, new int[] { 8, 55 });
97 expectedMapping.put(59, new int[] { 9, 62 });
98 expectedMapping.put(60, new int[] { 10, 69 });
99 expectedMapping.put(61, new int[] { 11, 76 });
100 expectedMapping.put(62, new int[] { 12, 83 });
101 expectedMapping.put(63, new int[] { 13, 87 });
102 expectedMapping.put(64, new int[] { 14, 95 });
103 expectedMapping.put(65, new int[] { 15, 102 });
104 expectedMapping.put(66, new int[] { 16, 111 });
105 expectedMapping.put(67, new int[] { 17, 122 });
106 expectedMapping.put(68, new int[] { 18, 131 });
107 expectedMapping.put(69, new int[] { 19, 137 });
108 expectedMapping.put(70, new int[] { 20, 144 });
109 expectedMapping.put(71, new int[] { 21, 152 });
110 expectedMapping.put(72, new int[] { 22, 160 });
111 expectedMapping.put(73, new int[] { 23, 167 });
112 expectedMapping.put(74, new int[] { 24, 179 });
113 expectedMapping.put(75, new int[] { 25, 187 });
114 expectedMapping.put(76, new int[] { 26, 195 });
115 expectedMapping.put(77, new int[] { 27, 203 });
116 expectedMapping.put(78, new int[] { 28, 208 });
117 expectedMapping.put(79, new int[] { 29, 213 });
118 expectedMapping.put(80, new int[] { 30, 222 });
119 expectedMapping.put(81, new int[] { 31, 231 });
120 expectedMapping.put(82, new int[] { 32, 240 });
121 expectedMapping.put(83, new int[] { 33, 244 });
122 expectedMapping.put(84, new int[] { 34, 252 });
123 expectedMapping.put(85, new int[] { 35, 260 });
124 expectedMapping.put(86, new int[] { 36, 268 });
125 expectedMapping.put(87, new int[] { 37, 275 });
126 expectedMapping.put(88, new int[] { 38, 287 });
127 expectedMapping.put(89, new int[] { 39, 293 });
128 expectedMapping.put(90, new int[] { 40, 299 });
129 expectedMapping.put(91, new int[] { 41, 310 });
130 expectedMapping.put(92, new int[] { 42, 315 });
131 expectedMapping.put(93, new int[] { 43, 319 });
132 expectedMapping.put(94, new int[] { 44, 325 });
133 expectedMapping.put(95, new int[] { 45, 331 });
134 expectedMapping.put(96, new int[] { 46, 337 });
135 expectedMapping.put(97, new int[] { 47, 343 });
136 expectedMapping.put(98, new int[] { 48, 349 });
137 expectedMapping.put(99, new int[] { 49, 354 });
138 expectedMapping.put(100, new int[] { 50, 358 });
139 expectedMapping.put(101, new int[] { 51, 367 });
140 expectedMapping.put(102, new int[] { 52, 375 });
141 expectedMapping.put(103, new int[] { 53, 384 });
142 expectedMapping.put(104, new int[] { 54, 391 });
143 expectedMapping.put(105, new int[] { 55, 395 });
144 expectedMapping.put(106, new int[] { 56, 401 });
145 expectedMapping.put(107, new int[] { 57, 409 });
146 expectedMapping.put(108, new int[] { 58, 417 });
147 expectedMapping.put(109, new int[] { 59, 426 });
148 expectedMapping.put(110, new int[] { 60, 434 });
149 expectedMapping.put(111, new int[] { 61, 442 });
150 expectedMapping.put(112, new int[] { 62, 451 });
151 expectedMapping.put(113, new int[] { 63, 457 });
152 expectedMapping.put(114, new int[] { 64, 468 });
153 expectedMapping.put(115, new int[] { 65, 476 });
154 expectedMapping.put(116, new int[] { 66, 484 });
155 expectedMapping.put(117, new int[] { 67, 492 });
156 expectedMapping.put(118, new int[] { 68, 500 });
157 expectedMapping.put(119, new int[] { 69, 509 });
158 expectedMapping.put(120, new int[] { 70, 517 });
159 expectedMapping.put(121, new int[] { 71, 525 });
160 expectedMapping.put(122, new int[] { 72, 534 });
161 expectedMapping.put(123, new int[] { 73, 538 });
162 expectedMapping.put(124, new int[] { 74, 552 });
163 expectedMapping.put(125, new int[] { 75, 559 });
164 expectedMapping.put(126, new int[] { 76, 567 });
165 expectedMapping.put(127, new int[] { 77, 574 });
166 expectedMapping.put(128, new int[] { 78, 580 });
167 expectedMapping.put(129, new int[] { 79, 585 });
168 expectedMapping.put(130, new int[] { 80, 590 });
169 expectedMapping.put(131, new int[] { 81, 602 });
170 expectedMapping.put(132, new int[] { 82, 609 });
171 expectedMapping.put(133, new int[] { 83, 616 });
172 expectedMapping.put(134, new int[] { 84, 622 });
173 expectedMapping.put(135, new int[] { 85, 630 });
174 expectedMapping.put(136, new int[] { 86, 637 });
175 expectedMapping.put(137, new int[] { 87, 644 });
176 expectedMapping.put(138, new int[] { 88, 652 });
177 expectedMapping.put(139, new int[] { 89, 661 });
178 expectedMapping.put(140, new int[] { 90, 668 });
179 expectedMapping.put(141, new int[] { 91, 678 });
180 expectedMapping.put(142, new int[] { 92, 687 });
181 expectedMapping.put(143, new int[] { 93, 696 });
182 expectedMapping.put(144, new int[] { 94, 705 });
183 expectedMapping.put(145, new int[] { 95, 714 });
184 expectedMapping.put(146, new int[] { 96, 722 });
185 expectedMapping.put(147, new int[] { 97, 729 });
188 @BeforeTest(alwaysRun = true)
189 public void setUpSiftsClient() throws SiftsException, IOException
191 // read test props before manipulating config
192 Cache.loadProperties("test/jalview/io/testProps.jvprops");
193 // SIFTs entries are updated weekly - so use saved SIFTs file to enforce
194 // test reproducibility
196 SiftsSettings.setSiftDownloadDirectory(jalview.bin.Cache.getDefault(
197 "sifts_download_dir", DEFAULT_SIFTS_DOWNLOAD_DIR));
198 SiftsSettings.setMapWithSifts(true);
199 SiftsSettings.setCacheThresholdInDays("2");
200 SiftsSettings.setFailSafePIDThreshold("70");
202 pdbFile = new PDBfile(false, false, false, "test/jalview/io/"
203 + testPDBId + ".pdb", DataSourceType.FILE);
204 siftsClient = new SiftsClient(pdbFile);
207 @AfterTest(alwaysRun = true)
208 public void cleanUpSiftsClient()
213 @Test(groups = { "Network" })
214 public void getSIFTsFileTest() throws SiftsException, IOException
217 siftsFile = SiftsClient.downloadSiftsFile(testPDBId);
218 FileAssert.assertFile(siftsFile);
219 long t1 = siftsFile.lastModified();
221 // re-read file should be returned from cache
222 siftsFile = SiftsClient.downloadSiftsFile(testPDBId);
223 FileAssert.assertFile(siftsFile);
224 long t2 = siftsFile.lastModified();
225 assertEquals(t1, t2);
228 * force fetch by having 0 expiry of cache
229 * also wait one second, because file timestamp does not
230 * give millisecond resolution :-(
237 } catch (InterruptedException e)
241 SiftsSettings.setCacheThresholdInDays("0");
242 siftsFile = SiftsClient.getSiftsFile(testPDBId);
243 FileAssert.assertFile(siftsFile);
244 long t3 = siftsFile.lastModified();
245 assertTrue(t3 > t2, "file timestamp unchanged at " + t3);
247 SiftsSettings.setCacheThresholdInDays("2");
250 @Test(groups = { "Network" })
251 public void downloadSiftsFileTest() throws SiftsException, IOException
253 // Assert that file isn't yet downloaded - if already downloaded, assert it
255 Assert.assertTrue(SiftsClient.deleteSiftsFileByPDBId(testPDBId));
257 siftsFile = SiftsClient.downloadSiftsFile(testPDBId);
258 FileAssert.assertFile(siftsFile);
259 SiftsClient.downloadSiftsFile(testPDBId);
262 @Test(groups = { "Network" })
263 public void getAllMappingAccessionTest()
265 Assert.assertNotNull(siftsClient);
266 Assert.assertNotNull(siftsClient.getAllMappingAccession());
267 Assert.assertTrue(siftsClient.getAllMappingAccession().size() > 1);
270 @Test(groups = { "Network" })
271 public void getGreedyMappingTest()
273 Assert.assertNotNull(siftsClient);
274 Assert.assertNotNull(testSeq);
275 Assert.assertNotNull(expectedMapping);
277 // TODO delete when auto-fetching of DBRefEntry is implemented
278 DBRefEntry dbRef = new DBRefEntry("uniprot", "", "P00221");
279 testSeq.addDBRef(dbRef);
280 // testSeq.setSourceDBRef(dbRef);
284 HashMap<Integer, int[]> actualMapping = siftsClient.getGreedyMapping(
286 Assert.assertEquals(testSeq.getStart(), 1);
287 Assert.assertEquals(testSeq.getEnd(), 147);
288 // Can't do Assert.assertEquals(actualMapping, expectedMapping);
289 // because this fails in our version of TestNG
290 Assert.assertEquals(actualMapping.size(), expectedMapping.size());
291 Iterator<Map.Entry<Integer, int[]>> it = expectedMapping.entrySet()
295 Map.Entry<Integer, int[]> pair = it.next();
296 Assert.assertTrue(actualMapping.containsKey(pair.getKey()));
297 Assert.assertEquals(actualMapping.get(pair.getKey()),
300 } catch (Exception e)
303 Assert.fail("Exception thrown while generating mapping...");
307 @Test(groups = { "Network" })
308 private void getAtomIndexTest()
310 ArrayList<Atom> atoms = new ArrayList<Atom>();
311 Atom atom = new Atom(u, u, u);
315 int actualAtomIndex = siftsClient.getAtomIndex(1, atoms);
316 Assert.assertEquals(actualAtomIndex, -1);
317 actualAtomIndex = siftsClient.getAtomIndex(43, atoms);
318 Assert.assertEquals(actualAtomIndex, 7);
322 groups = { "Network" },
323 expectedExceptions = IllegalArgumentException.class)
324 private void getAtomIndexNullTest()
326 siftsClient.getAtomIndex(1, null);
329 @Test(groups = { "Network" })
330 private void padWithGapsTest()
336 groups = { "Network" },
337 expectedExceptions = StructureMappingException.class)
338 private void populateAtomPositionsNullTest1()
339 throws IllegalArgumentException, StructureMappingException,
342 siftsClient.populateAtomPositions(null, null);
346 groups = { "Network" },
347 expectedExceptions = StructureMappingException.class)
348 private void populateAtomPositionsNullTest2()
349 throws IllegalArgumentException, StructureMappingException,
352 siftsClient.populateAtomPositions("A", null);
355 @Test(groups = { "Network" })
356 public void getValidSourceDBRefTest() throws SiftsException
358 DBRefEntryI actualValidSrcDBRef = siftsClient
359 .getValidSourceDBRef(testSeq);
360 DBRefEntryI expectedDBRef = new DBRefEntry();
361 expectedDBRef.setSource(DBRefSource.UNIPROT);
362 expectedDBRef.setAccessionId("P00221");
363 expectedDBRef.setVersion("");
364 Assert.assertEquals(actualValidSrcDBRef, expectedDBRef);
368 groups = { "Network" },
369 expectedExceptions = SiftsException.class)
370 public void getValidSourceDBRefExceptionTest() throws SiftsException
372 SequenceI invalidTestSeq = new Sequence("testSeq", "ABCDEFGH");
373 siftsClient.getValidSourceDBRef(invalidTestSeq);
377 groups = { "Network" },
378 expectedExceptions = SiftsException.class)
379 public void getValidSourceDBRefExceptionXTest() throws SiftsException
381 SequenceI invalidTestSeq = new Sequence("testSeq", "ABCDEFGH");
382 DBRefEntry invalidDBRef = new DBRefEntry();
383 invalidDBRef.setAccessionId("BLAR");
384 invalidTestSeq.addDBRef(invalidDBRef);
385 siftsClient.getValidSourceDBRef(invalidTestSeq);
388 @Test(groups = { "Network" })
389 public void isValidDBRefEntryTest()
391 DBRefEntryI validDBRef = new DBRefEntry();
392 validDBRef.setSource(DBRefSource.UNIPROT);
393 validDBRef.setAccessionId("P00221");
394 validDBRef.setVersion("");
395 Assert.assertTrue(siftsClient.isValidDBRefEntry(validDBRef));
398 @Test(groups = { "Network" })
399 public void getSiftsStructureMappingTest()
400 throws StructureMappingException, Exception
402 Assert.assertTrue(SiftsSettings.isMapWithSifts());
403 StructureMapping strucMapping = siftsClient.getSiftsStructureMapping(
404 testSeq, testPDBId, "A");
405 String expectedMappingOutput = "\nSequence ⟷ Structure mapping details\n"
406 + "Method: SIFTS\n\n"
407 + "P00221 : 51 - 147 Maps to \n"
408 + "1A70|A : 1 - 97\n\n"
409 + "P00221 AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLD\n"
410 + " |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||\n"
411 + "1A70|A AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLD\n\n"
413 + "P00221 DDQIDEGWVLTCAAYPVSDVTIETHKEEELTA\n"
414 + " |||||||||||||||||||||||||| |||||\n"
415 + "1A70|A DDQIDEGWVLTCAAYPVSDVTIETHKKEELTA\n\n" +
417 "Length of alignment = 97\n" + "Percentage ID = 98.97\n";
419 Assert.assertEquals(strucMapping.getMappingDetailsOutput(),
420 expectedMappingOutput);
422 // Can't do Assert.assertEquals(strucMapping.getMapping(), expectedMapping);
423 // because this fails in our version of TestNG
424 Map<Integer, int[]> mapping = (Map<Integer, int[]>) PA.getValue(
425 strucMapping, "mapping");
428 expectedMapping.size());
429 Iterator<Map.Entry<Integer, int[]>> it = expectedMapping.entrySet()
433 Map.Entry<Integer, int[]> pair = it.next();
434 Assert.assertTrue(mapping
435 .containsKey(pair.getKey()));
436 Assert.assertEquals(mapping.get(pair.getKey()),
441 @Test(groups = { "Network" })
442 public void getEntityCountTest()
444 int actualEntityCount = siftsClient.getEntityCount();
445 System.out.println("actual entity count : " + actualEntityCount);
446 Assert.assertEquals(actualEntityCount, 1);
449 @Test(groups = { "Network" })
450 public void getDbAccessionIdTest()
452 String actualDbAccId = siftsClient.getDbAccessionId();
453 System.out.println("Actual Db Accession Id: " + actualDbAccId);
454 Assert.assertEquals(actualDbAccId, "1a70");
457 @Test(groups = { "Network" })
458 public void getDbCoordSysTest()
460 String actualDbCoordSys = siftsClient.getDbCoordSys();
461 System.out.println("Actual DbCoordSys: " + actualDbCoordSys);
462 Assert.assertEquals(actualDbCoordSys, "PDBe");
465 @Test(groups = { "Network" })
466 public void getDbSourceTest()
468 String actualDbSource = siftsClient.getDbSource();
469 System.out.println("Actual DbSource: " + actualDbSource);
470 Assert.assertEquals(actualDbSource, "PDBe");
473 @Test(groups = { "Network" })
474 public void getDbVersionTest()
476 String actualDbVersion = siftsClient.getDbVersion();
477 System.out.println("Actual DbVersion: " + actualDbVersion);
478 Assert.assertEquals(actualDbVersion, "2.0");
481 @Test(groups = { "Network" })
482 public void getEntityByMostOptimalMatchedIdTest1() throws IOException,
485 SiftsClient siftsClientX = null;
487 pdbFile = new PDBfile(false, false, false, "test/jalview/io/2nq2"
488 + ".pdb", DataSourceType.FILE);
489 siftsClientX = new SiftsClient(pdbFile);
490 Entity entityA = siftsClientX.getEntityByMostOptimalMatchedId("A");
491 Assert.assertEquals(entityA.getEntityId(), "A");
492 Entity entityB = siftsClientX.getEntityByMostOptimalMatchedId("B");
493 Assert.assertEquals(entityB.getEntityId(), "C");
494 Entity entityC = siftsClientX.getEntityByMostOptimalMatchedId("C");
495 Assert.assertEquals(entityC.getEntityId(), "B");
496 Entity entityD = siftsClientX.getEntityByMostOptimalMatchedId("D");
497 Assert.assertEquals(entityD.getEntityId(), "D");
501 @Test(groups = { "Network" })
502 public void getEntityByMostOptimalMatchedIdTest2() throws IOException,
505 // This test is for a SIFTS file in which entity A should map to chain P for
506 // the given PDB Id. All the other chains shouldn't be mapped as there are
507 // no SIFTS entity records for them.
508 SiftsClient siftsClientX = null;
510 pdbFile = new PDBfile(false, false, false, "test/jalview/io/3ucu.cif",
511 DataSourceType.FILE);
512 siftsClientX = new SiftsClient(pdbFile);
513 Entity entityA = siftsClientX.getEntityByMostOptimalMatchedId("P");
514 Entity entityP = siftsClientX.getEntityByMostOptimalMatchedId("A");
515 Entity entityR = siftsClientX.getEntityByMostOptimalMatchedId("R");
516 Assert.assertEquals(entityA.getEntityId(), "A");
517 Assert.assertNotEquals(entityR, "A");
518 Assert.assertNotEquals(entityP, "A");
519 Assert.assertNotEquals(entityR, "R");
520 Assert.assertNotEquals(entityP, "P");
521 Assert.assertNull(entityR);
522 Assert.assertNull(entityP);
526 @Test(groups = { "Network" })
527 public void getLeadingIntegerFromString()
530 SiftsClient.getLeadingIntegerValue("1234abcd", -1), 1234);
532 SiftsClient.getLeadingIntegerValue("1234", -1),
535 SiftsClient.getLeadingIntegerValue("abcd", -1), -1);
537 SiftsClient.getLeadingIntegerValue("abcd1234", -1), -1);
539 SiftsClient.getLeadingIntegerValue("None", -1), -1);
541 SiftsClient.getLeadingIntegerValue("Null", -1), -1);