- * non rigorous testing
- */
- /**
- *
- * @param seq
- * Sequence
- * @param ex_cs_gapped
- * String
- * @return String
- */
- public static String testCigar_string(Sequence seq, String ex_cs_gapped)
- {
- SeqCigar c_sgapped = new SeqCigar(seq);
- String cs_gapped = c_sgapped.getCigarstring();
- if (!cs_gapped.equals(ex_cs_gapped))
- {
- System.err.println("Failed getCigarstring: incorect string '"
- + cs_gapped + "' != " + ex_cs_gapped);
- }
- return cs_gapped;
- }
-
- public static boolean testSeqRecovery(SeqCigar gen_sgapped,
- SequenceI s_gapped)
- {
- // this is non-rigorous - start and end recovery is not tested.
- SequenceI gen_sgapped_s = gen_sgapped.getSeq('-');
- if (!gen_sgapped_s.getSequence().equals(s_gapped.getSequence()))
- {
- System.err.println("Couldn't reconstruct sequence.\n"
- + gen_sgapped_s.getSequenceAsString() + "\n"
- + s_gapped.getSequenceAsString());
- return false;
- }
- return true;
- }
-
- public static void main(String argv[]) throws Exception
- {
- String o_seq;
- Sequence s = new Sequence("MySeq",
- o_seq = "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt", 39, 80);
- String orig_gapped;
- Sequence s_gapped = new Sequence(
- "MySeq",
- orig_gapped = "----asdf------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhttt",
- 39, 80);
- String ex_cs_gapped = "4I4M6I6M3I11M4I12M4I9M";
- s_gapped.setDatasetSequence(s);
- String sub_gapped_s;
- Sequence s_subsequence_gapped = new Sequence(
- "MySeq",
- sub_gapped_s = "------ktryas---dtqwrtsasll----dddptyipqqwa----slchvh",
- 43, 77);
-
- s_subsequence_gapped.setDatasetSequence(s);
- SeqCigar c_null = new SeqCigar(s);
- String cs_null = c_null.getCigarstring();
- if (!cs_null.equals("42M"))
- {
- System.err
- .println("Failed to recover ungapped sequence cigar operations:"
- + ((cs_null == "") ? "empty string" : cs_null));
- }
- testCigar_string(s_gapped, ex_cs_gapped);
- SeqCigar gen_sgapped = SeqCigar.parseCigar(s, ex_cs_gapped);
- if (!gen_sgapped.getCigarstring().equals(ex_cs_gapped))
- {
- System.err.println("Failed parseCigar(" + ex_cs_gapped
- + ")->getCigarString()->'" + gen_sgapped.getCigarstring()
- + "'");
- }
- testSeqRecovery(gen_sgapped, s_gapped);
- // Test dataset resolution
- SeqCigar sub_gapped = new SeqCigar(s_subsequence_gapped);
- if (!testSeqRecovery(sub_gapped, s_subsequence_gapped))
- {
- System.err
- .println("Failed recovery for subsequence of dataset sequence");
- }
- // width functions
- if (sub_gapped.getWidth() != sub_gapped_s.length())
- {
- System.err.println("Failed getWidth()");
- }
-
- sub_gapped.getFullWidth();
- if (sub_gapped.hasDeletedRegions())
- {
- System.err.println("hasDeletedRegions is incorrect.");
- }
- // Test start-end region SeqCigar
- SeqCigar sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48);
- if (sub_se_gp.getWidth() != 41)
- {
- System.err
- .println("SeqCigar(seq, start, end) not properly clipped alignsequence.");
- }
- System.out.println("Original sequence align:\n" + sub_gapped_s
- + "\nReconstructed window from 8 to 48\n" + "XXXXXXXX"
- + sub_se_gp.getSequenceString('-') + "..." + "\nCigar String:"
- + sub_se_gp.getCigarstring() + "\n");
- SequenceI ssgp = sub_se_gp.getSeq('-');
- System.out.println("\t " + ssgp.getSequenceAsString());
- for (int r = 0; r < 10; r++)
- {
- sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48);
- int sl = sub_se_gp.getWidth();
- int st = sl - 1 - r;
- for (int rs = 0; rs < 10; rs++)
- {
- int e = st + rs;
- sub_se_gp.deleteRange(st, e);
- String ssgapedseq = sub_se_gp.getSeq('-').getSequenceAsString();
- System.out.println(st + "," + e + "\t:" + ssgapedseq);
- st -= 3;
- }
- }
- {
- SeqCigar[] set = new SeqCigar[]
- { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48),
- new SeqCigar(s_gapped) };
- Alignment al = new Alignment(set);
- for (int i = 0; i < al.getHeight(); i++)
- {
- System.out.println("" + al.getSequenceAt(i).getName() + "\t"
- + al.getSequenceAt(i).getStart() + "\t"
- + al.getSequenceAt(i).getEnd() + "\t"
- + al.getSequenceAt(i).getSequenceAsString());
- }
- }
- {
- System.out.println("Gapped.");
- SeqCigar[] set = new SeqCigar[]
- { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48),
- new SeqCigar(s_gapped) };
- set[0].deleteRange(20, 25);
- Alignment al = new Alignment(set);
- for (int i = 0; i < al.getHeight(); i++)
- {
- System.out.println("" + al.getSequenceAt(i).getName() + "\t"
- + al.getSequenceAt(i).getStart() + "\t"
- + al.getSequenceAt(i).getEnd() + "\t"
- + al.getSequenceAt(i).getSequenceAsString());
- }
- }
- // if (!ssgapedseq.equals("ryas---dtqqwa----slchvh"))
- // System.err.println("Subseqgaped\n------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhryas---dtqwrtsasll--qwa----slchvh\n"+ssgapedseq+"\n"+sub_se_gp.getCigarstring());
- }
-
- /**