// FORESTER -- software libraries and applications
// for evolutionary biology research and applications.
//
-// Copyright (C) 2008-2009 Christian M. Zmasek
-// Copyright (C) 2008-2009 Burnham Institute for Medical Research
+// Copyright (C) 2014 Christian M. Zmasek
+// Copyright (C) 2014 Sanford-Burnham Medical Research Institute
// All rights reserved
//
// This library is free software; you can redistribute it and/or
// License along with this library; if not, write to the Free Software
// Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA
//
-// Contact: phylosoft @ gmail . com
// WWW: https://sites.google.com/site/cmzmasek/home/software/forester
package org.forester.test;
import java.io.File;
import java.io.FileInputStream;
import java.io.IOException;
+import java.io.StringWriter;
+import java.io.Writer;
import java.net.URL;
import java.util.ArrayList;
import java.util.Date;
import java.util.SortedSet;
import org.forester.application.support_transfer;
+import org.forester.archaeopteryx.AptxUtil;
import org.forester.archaeopteryx.TreePanelUtil;
import org.forester.archaeopteryx.webservices.WebserviceUtil;
+import org.forester.clade_analysis.CladeAnalysisTest;
import org.forester.development.DevelopmentTools;
import org.forester.evoinference.TestPhylogenyReconstruction;
import org.forester.evoinference.matrix.character.CharacterStateMatrix;
import org.forester.io.writers.PhylogenyWriter;
import org.forester.io.writers.SequenceWriter;
import org.forester.msa.BasicMsa;
+import org.forester.msa.DeleteableMsa;
import org.forester.msa.Mafft;
import org.forester.msa.Msa;
+import org.forester.msa.Msa.MSA_FORMAT;
import org.forester.msa.MsaInferrer;
import org.forester.msa.MsaMethods;
import org.forester.pccx.TestPccx;
import org.forester.phylogeny.data.PhylogenyData;
import org.forester.phylogeny.data.PhylogenyDataUtil;
import org.forester.phylogeny.data.Polygon;
-import org.forester.phylogeny.data.PropertiesMap;
+import org.forester.phylogeny.data.PropertiesList;
import org.forester.phylogeny.data.Property;
import org.forester.phylogeny.data.Property.AppliesTo;
import org.forester.phylogeny.data.ProteinDomain;
import org.forester.sdi.SDIR;
import org.forester.sdi.TestGSDI;
import org.forester.sequence.BasicSequence;
-import org.forester.sequence.Sequence;
+import org.forester.sequence.MolecularSequence;
import org.forester.species.BasicSpecies;
import org.forester.species.Species;
import org.forester.surfacing.TestSurfacing;
import org.forester.ws.seqdb.SequenceDatabaseEntry;
import org.forester.ws.seqdb.SequenceDbWsTools;
import org.forester.ws.seqdb.UniProtTaxonomy;
-import org.forester.ws.wabi.TxSearch;
-import org.forester.ws.wabi.TxSearch.RANKS;
-import org.forester.ws.wabi.TxSearch.TAX_NAME_CLASS;
-import org.forester.ws.wabi.TxSearch.TAX_RANK;
@SuppressWarnings( "unused")
public final class Test {
private final static String PATH_TO_RESOURCES = System.getProperty( "user.dir" )
- + ForesterUtil.getFileSeparator() + "resources"
- + ForesterUtil.getFileSeparator();
+ + ForesterUtil.getFileSeparator() + "resources" + ForesterUtil.getFileSeparator();
private final static String PATH_TO_TEST_DATA = System.getProperty( "user.dir" )
- + ForesterUtil.getFileSeparator() + "test_data"
- + ForesterUtil.getFileSeparator();
+ + ForesterUtil.getFileSeparator() + "test_data" + ForesterUtil.getFileSeparator();
private final static boolean PERFORM_DB_TESTS = false;
- private static final boolean PERFORM_WEB_TREE_ACCESS = true;
+ private static final boolean PERFORM_WEB_TREE_ACCESS = false;
private static final String PHYLOXML_LOCAL_XSD = PATH_TO_RESOURCES + "phyloxml_schema/"
- + ForesterConstants.PHYLO_XML_VERSION + "/"
- + ForesterConstants.PHYLO_XML_XSD;
+ + ForesterConstants.PHYLO_XML_VERSION + "/" + ForesterConstants.PHYLO_XML_XSD;
private static final String PHYLOXML_REMOTE_XSD = ForesterConstants.PHYLO_XML_LOCATION + "/"
- + ForesterConstants.PHYLO_XML_VERSION + "/"
- + ForesterConstants.PHYLO_XML_XSD;
+ + ForesterConstants.PHYLO_XML_VERSION + "/" + ForesterConstants.PHYLO_XML_XSD;
private final static boolean USE_LOCAL_PHYLOXML_SCHEMA = true;
private final static double ZERO_DIFF = 1.0E-9;
- public static boolean isEqual( final double a, final double b ) {
+ private static boolean isEqual( final double a, final double b ) {
return ( ( Math.abs( a - b ) ) < Test.ZERO_DIFF );
}
succeeded++;
}
System.out.println( "OK." );
+ System.out.print( "Common prefix: " );
+ if ( !testCommonPrefix() ) {
+ System.out.println( "failed." );
+ failed++;
+ }
+ else {
+ succeeded++;
+ }
+ System.out.println( "OK." );
+ System.out.print( "Common prefix sep: " );
+ if ( !testCommonPrefixSep() ) {
+ System.out.println( "failed." );
+ failed++;
+ }
+ else {
+ succeeded++;
+ }
+ System.out.println( "OK." );
+ System.out.print( "Contains prefix: " );
+ if ( !testContainsPrefix() ) {
+ System.out.println( "failed." );
+ failed++;
+ }
+ else {
+ succeeded++;
+ }
+ System.out.println( "OK." );
System.out.print( "Sequence writer: " );
if ( testSequenceWriter() ) {
System.out.println( "OK." );
succeeded++;
}
System.out.println( "OK." );
+ System.out.print( "Taxonomy data extraction: " );
+ if ( Test.testExtractTaxonomyDataFromNodeName() ) {
+ System.out.println( "OK." );
+ succeeded++;
+ }
+ else {
+ System.out.println( "failed." );
+ failed++;
+ }
System.out.print( "Taxonomy code extraction: " );
if ( Test.testExtractTaxonomyCodeFromNodeName() ) {
System.out.println( "OK." );
System.out.println( "failed." );
failed++;
}
+ System.out.print( "Node construction and parsing of NHX (node level): " );
+ if ( Test.testNHXNodeParsing2() ) {
+ System.out.println( "OK." );
+ succeeded++;
+ }
+ else {
+ System.out.println( "failed." );
+ failed++;
+ }
System.out.print( "NHX parsing iterating: " );
if ( Test.testNHParsingIter() ) {
System.out.println( "OK." );
System.out.println( "failed." );
failed++;
}
+ System.out.print( "NH parsing - special chars: " );
+ if ( Test.testNHParsingSpecialChars() ) {
+ System.out.println( "OK." );
+ succeeded++;
+ }
+ else {
+ System.out.println( "failed." );
+ failed++;
+ }
System.out.print( "Conversion to NHX (node level): " );
if ( Test.testNHXconversion() ) {
System.out.println( "OK." );
System.out.println( "failed." );
failed++;
}
+ System.out.print( "phyloXML parsing (validating against schema): " );
+ if ( testPhyloXMLparsingValidating() ) {
+ System.out.println( "OK." );
+ succeeded++;
+ }
+ else {
+ System.out.println( "failed." );
+ failed++;
+ }
System.out.print( "Roundtrip phyloXML parsing (validating against schema): " );
if ( Test.testBasicPhyloXMLparsingRoundtrip() ) {
System.out.println( "OK." );
System.out.println( "failed." );
failed++;
}
+ System.out.print( "UTF-8 parsing from file: " );
+ if ( Test.testUTF8ParsingFromFile() ) {
+ System.out.println( "OK." );
+ succeeded++;
+ }
+ else {
+ System.out.println( "failed." );
+ failed++;
+ }
System.out.print( "Copying of node data: " );
if ( Test.testCopyOfNodeData() ) {
System.out.println( "OK." );
System.out.println( "failed." );
failed++;
}
+ System.out.print( "Phylogeny methods:" );
+ if ( Test.testPhylogenyMethods() ) {
+ System.out.println( "OK." );
+ succeeded++;
+ }
+ else {
+ System.out.println( "failed." );
+ failed++;
+ }
System.out.print( "Postorder Iterator: " );
if ( Test.testPostOrderIterator() ) {
System.out.println( "OK." );
System.out.println( "failed." );
failed++;
}
+ System.out.print( "Clade analyis: " );
+ if ( CladeAnalysisTest.test() ) {
+ System.out.println( "OK." );
+ succeeded++;
+ }
+ else {
+ System.out.println( "failed." );
+ failed++;
+ }
System.out.print( "Phylogeny reconstruction:" );
System.out.println();
if ( TestPhylogenyReconstruction.test( new File( PATH_TO_TEST_DATA ) ) ) {
System.out.println( "failed." );
failed++;
}
+ System.out.print( "Deleteable MSA: " );
+ if ( Test.testDeleteableMsa() ) {
+ System.out.println( "OK." );
+ succeeded++;
+ }
+ else {
+ System.out.println( "failed." );
+ failed++;
+ }
+ System.out.print( "MSA entropy: " );
+ if ( Test.testMsaEntropy() ) {
+ System.out.println( "OK." );
+ succeeded++;
+ }
+ else {
+ System.out.println( "failed." );
+ failed++;
+ }
if ( PERFORM_DB_TESTS ) {
System.out.print( "Uniprot Entry Retrieval: " );
if ( Test.testUniprotEntryRetrieval() ) {
}
}
if ( PERFORM_WEB_TREE_ACCESS ) {
- System.out.print( "NHX parsing from URL: " );
- if ( Test.testNHXparsingFromURL() ) {
+ System.out.print( "TreeBase acccess: " );
+ if ( Test.testTreeBaseReading() ) {
System.out.println( "OK." );
succeeded++;
}
System.out.println( "failed." );
failed++;
}
- System.out.print( "phyloXML parsing from URL: " );
- if ( Test.testPhyloXMLparsingFromURL() ) {
+ System.out.print( "ToL access: " );
+ if ( Test.testToLReading() ) {
System.out.println( "OK." );
succeeded++;
}
System.out.println( "failed." );
failed++;
}
- System.out.print( "TreeBase acccess: " );
- if ( Test.testTreeBaseReading() ) {
+ System.out.print( "NHX parsing from URL: " );
+ if ( Test.testNHXparsingFromURL() ) {
System.out.println( "OK." );
succeeded++;
}
System.out.println( "failed." );
failed++;
}
- //
- System.out.print( "ToL access: " );
- if ( Test.testToLReading() ) {
+ System.out.print( "NHX parsing from URL 2: " );
+ if ( Test.testNHXparsingFromURL2() ) {
+ System.out.println( "OK." );
+ succeeded++;
+ }
+ else {
+ System.out.println( "failed." );
+ failed++;
+ }
+ System.out.print( "phyloXML parsing from URL: " );
+ if ( Test.testPhyloXMLparsingFromURL() ) {
System.out.println( "OK." );
succeeded++;
}
System.out.println( "failed." );
failed++;
}
- //
System.out.print( "TreeFam access: " );
if ( Test.testTreeFamReading() ) {
System.out.println( "OK." );
System.out.println( "failed." );
failed++;
}
- //
- //
System.out.print( "Pfam tree access: " );
if ( Test.testPfamTreeReading() ) {
System.out.println( "OK." );
}
}
- public static boolean testEngulfingOverlapRemoval() {
+ private static boolean testEngulfingOverlapRemoval() {
try {
final Domain d0 = new BasicDomain( "d0", 0, 8, ( short ) 1, ( short ) 1, 0.1, 1 );
final Domain d1 = new BasicDomain( "d1", 0, 1, ( short ) 1, ( short ) 1, 0.1, 1 );
return true;
}
- public static final boolean testNHXparsingFromURL() {
+ private static final boolean testNHXparsingFromURL2() {
+ try {
+ final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh";
+ final Phylogeny phys[] = AptxUtil
+ .readPhylogeniesFromUrl( new URL( s ), false, false, false, TAXONOMY_EXTRACTION.NO, false );
+ if ( ( phys == null ) || ( phys.length != 5 ) ) {
+ return false;
+ }
+ if ( !phys[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
+ System.out.println( phys[ 0 ].toNewHampshire() );
+ return false;
+ }
+ if ( !phys[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
+ System.out.println( phys[ 1 ].toNewHampshire() );
+ return false;
+ }
+ final Phylogeny phys2[] = AptxUtil
+ .readPhylogeniesFromUrl( new URL( s ), false, false, false, TAXONOMY_EXTRACTION.NO, false );
+ if ( ( phys2 == null ) || ( phys2.length != 5 ) ) {
+ return false;
+ }
+ if ( !phys2[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
+ System.out.println( phys2[ 0 ].toNewHampshire() );
+ return false;
+ }
+ if ( !phys2[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
+ System.out.println( phys2[ 1 ].toNewHampshire() );
+ return false;
+ }
+ final Phylogeny phys3[] = AptxUtil.readPhylogeniesFromUrl( new URL( "http://swisstree.vital-it.ch:80/"
+ + "SwissTree/ST001/consensus_tree.nhx" ),
+ false,
+ false,
+ false,
+ TAXONOMY_EXTRACTION.NO,
+ false );
+ if ( ( phys3 == null ) || ( phys3.length != 1 ) ) {
+ return false;
+ }
+ if ( !phys3[ 0 ].toNewHampshire()
+ .equals( "((((POP23a_CIOIN_ENSCING00000016202,POP23b_CIOIN_ENSCING00000016169),POP23_CIOSA_ENSCSAVG00000000248),((POP23a_BRAFL_C3ZMF1,POP23b_BRAFL_121417),(((POP3_ORYLA_ENSORLG00000019669,POP3_GASAC_ENSGACG00000014023,POP3_DANRE_Q6JWW1),(POP3_XENTR_B1H1F6,(POP3_CHICK_Q9DG25,(POP3_ORNAN_ENSOANG00000004179,POP3_MONDO_ENSMODG00000018033,((POP3_MOUSE_Q9ES81,POP3_RAT_Q3BCU3),POP3_RABIT_ENSOCUG00000025973,POP3_MACMU_ENSMMUG00000014473,POP3_HUMAN_Q9HBV1))))),(((POP2_GASAC_ENSGACG00000001420,POP2_ORYLA_ENSORLG00000008627,POP2_TAKRU_ENSTRUG00000015933),POP2_DANRE_ENSDARG00000069922),POP2_XENTR_ENSXETG00000018064,(((POP2_TAEGU_ENSTGUG00000013383,POP2_CHICK_Q6T9Z5),POP2_ANOCA_ENSACAG00000003557),((POP2_MACEU_ENSMEUG00000015825,POP2_MONDO_ENSMODG00000018205),((POP2_RABIT_ENSOCUG00000009515,(POP2_RAT_Q6P722,POP2_MOUSE_Q9ES82)),(POP2_MACMU_ENSMMUG00000000905,POP2_HUMAN_Q9HBU9)))))))),((POP1_CIOSA_ENSCSAVG00000000247,POP1_CIOIN_ENSCING00000000496),((POP1_DANRE_Q5PQZ7,(POP1_ORYLA_ENSORLG00000019663,POP1_GASAC_ENSGACG00000014015,POP1_TAKRU_ENSORLG00000019663)),(POP1_XENTR_B1H1G2,(POP1_ANOCA_ENSACAG00000003910,(POP1_TAEGU_ENSTGUG00000012218,POP1_CHICK_Q9DG23)),POP1_ORNAN_ENSOANG00000004180,POP1_MONDO_ENSMODG00000018034,(POP1_RABIT_ENSOCUG00000016944,(POP1_RAT_Q3BCU4,POP1_MOUSE_Q9ES83),(POP1_HUMAN_Q8NE79,POP1_MACMU_ENSMMUG00000014471))))));" ) ) {
+ System.out.println( phys3[ 0 ].toNewHampshire() );
+ return false;
+ }
+ final Phylogeny phys4[] = AptxUtil.readPhylogeniesFromUrl( new URL( "http://swisstree.vital-it.ch:80/"
+ + "SwissTree/ST001/consensus_tree.nhx" ),
+ false,
+ false,
+ false,
+ TAXONOMY_EXTRACTION.NO,
+ false );
+ if ( ( phys4 == null ) || ( phys4.length != 1 ) ) {
+ return false;
+ }
+ if ( !phys4[ 0 ].toNewHampshire()
+ .equals( "((((POP23a_CIOIN_ENSCING00000016202,POP23b_CIOIN_ENSCING00000016169),POP23_CIOSA_ENSCSAVG00000000248),((POP23a_BRAFL_C3ZMF1,POP23b_BRAFL_121417),(((POP3_ORYLA_ENSORLG00000019669,POP3_GASAC_ENSGACG00000014023,POP3_DANRE_Q6JWW1),(POP3_XENTR_B1H1F6,(POP3_CHICK_Q9DG25,(POP3_ORNAN_ENSOANG00000004179,POP3_MONDO_ENSMODG00000018033,((POP3_MOUSE_Q9ES81,POP3_RAT_Q3BCU3),POP3_RABIT_ENSOCUG00000025973,POP3_MACMU_ENSMMUG00000014473,POP3_HUMAN_Q9HBV1))))),(((POP2_GASAC_ENSGACG00000001420,POP2_ORYLA_ENSORLG00000008627,POP2_TAKRU_ENSTRUG00000015933),POP2_DANRE_ENSDARG00000069922),POP2_XENTR_ENSXETG00000018064,(((POP2_TAEGU_ENSTGUG00000013383,POP2_CHICK_Q6T9Z5),POP2_ANOCA_ENSACAG00000003557),((POP2_MACEU_ENSMEUG00000015825,POP2_MONDO_ENSMODG00000018205),((POP2_RABIT_ENSOCUG00000009515,(POP2_RAT_Q6P722,POP2_MOUSE_Q9ES82)),(POP2_MACMU_ENSMMUG00000000905,POP2_HUMAN_Q9HBU9)))))))),((POP1_CIOSA_ENSCSAVG00000000247,POP1_CIOIN_ENSCING00000000496),((POP1_DANRE_Q5PQZ7,(POP1_ORYLA_ENSORLG00000019663,POP1_GASAC_ENSGACG00000014015,POP1_TAKRU_ENSORLG00000019663)),(POP1_XENTR_B1H1G2,(POP1_ANOCA_ENSACAG00000003910,(POP1_TAEGU_ENSTGUG00000012218,POP1_CHICK_Q9DG23)),POP1_ORNAN_ENSOANG00000004180,POP1_MONDO_ENSMODG00000018034,(POP1_RABIT_ENSOCUG00000016944,(POP1_RAT_Q3BCU4,POP1_MOUSE_Q9ES83),(POP1_HUMAN_Q8NE79,POP1_MACMU_ENSMMUG00000014471))))));" ) ) {
+ System.out.println( phys4[ 0 ].toNewHampshire() );
+ return false;
+ }
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace();
+ return false;
+ }
+ return true;
+ }
+
+ private static final boolean testNHXparsingFromURL() {
try {
final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh";
final URL u = new URL( s );
System.out.println( phys[ 1 ].toNewHampshire() );
return false;
}
- final Phylogeny[] phys2 = factory.create( u.openStream(), new NHXParser() );
+ final URL u2 = new URL( s );
+ final Phylogeny[] phys2 = factory.create( u2.openStream(), new NHXParser() );
if ( ( phys2 == null ) || ( phys2.length != 5 ) ) {
return false;
}
}
final PhylogenyFactory factory2 = ParserBasedPhylogenyFactory.getInstance();
final NHXParser p = new NHXParser();
- final URL u2 = new URL( s );
- p.setSource( u2 );
+ final URL u3 = new URL( s );
+ p.setSource( u3 );
if ( !p.hasNext() ) {
return false;
}
}
}
catch ( final Exception e ) {
+ System.out.println( e.toString() );
e.printStackTrace();
+ return false;
}
return true;
}
- public static boolean testOverlapRemoval() {
+ private static boolean testOverlapRemoval() {
try {
final Domain d0 = new BasicDomain( "d0", ( short ) 2, ( short ) 5, ( short ) 1, ( short ) 1, 0.1, 1 );
final Domain d1 = new BasicDomain( "d1", ( short ) 7, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, 1 );
( short ) 1,
0.0000001,
1 );
- final Domain e = new BasicDomain( "e", ( short ) 5000, ( short ) 5500, ( short ) 1, ( short ) 1, 0.0001, 1 );
+ final Domain e = new BasicDomain( "e",
+ ( short ) 5000,
+ ( short ) 5500,
+ ( short ) 1,
+ ( short ) 1,
+ 0.0001,
+ 1 );
final Protein cde = new BasicProtein( "cde", "varanus", 0 );
cde.addProteinDomain( c );
cde.addProteinDomain( d );
return true;
}
- public static final boolean testPfamTreeReading() {
+ private static final boolean testPfamTreeReading() {
try {
final URL u = new URL( WebserviceUtil.PFAM_SERVER + "/family/PF" + "01849" + "/tree/download" );
final NHXParser parser = new NHXParser();
parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
parser.setReplaceUnderscores( false );
parser.setGuessRootedness( true );
- final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
- final Phylogeny[] phys = factory.create( u.openStream(), parser );
+ final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, parser );
if ( ( phys == null ) || ( phys.length != 1 ) ) {
return false;
}
}
catch ( final Exception e ) {
e.printStackTrace();
+ return false;
}
return true;
}
- public static final boolean testPhyloXMLparsingFromURL() {
+ private static final boolean testPhyloXMLparsingFromURL() {
try {
final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/archaeopteryx_a/apaf_bcl2.xml";
final URL u = new URL( s );
- final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
- final Phylogeny[] phys = factory.create( u.openStream(), PhyloXmlParser.createPhyloXmlParser() );
+ final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, PhyloXmlParser.createPhyloXmlParser() );
if ( ( phys == null ) || ( phys.length != 2 ) ) {
return false;
}
+ final Phylogeny[] phys2 = ForesterUtil.readPhylogeniesFromUrl( u, PhyloXmlParser.createPhyloXmlParser() );
+ if ( ( phys2 == null ) || ( phys2.length != 2 ) ) {
+ return false;
+ }
}
catch ( final Exception e ) {
e.printStackTrace();
+ return false;
}
return true;
}
- public static final boolean testToLReading() {
+ private static final boolean testToLReading() {
try {
final URL u = new URL( WebserviceUtil.TOL_URL_BASE + "15079" );
- final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
- final Phylogeny[] phys = factory.create( u.openStream(), new TolParser() );
+ final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, new TolParser() );
if ( ( phys == null ) || ( phys.length != 1 ) ) {
return false;
}
if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "15079" ) ) {
return false;
}
- if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Protacanthopterygii" ) ) {
+ if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getScientificName()
+ .equals( "Protacanthopterygii" ) ) {
return false;
}
if ( phys[ 0 ].getNumberOfExternalNodes() < 5 ) {
return false;
}
+ //
+ final URL u2 = new URL( WebserviceUtil.TOL_URL_BASE + "17706" );
+ final Phylogeny[] phys2 = ForesterUtil.readPhylogeniesFromUrl( u2, new TolParser() );
+ if ( ( phys2 == null ) || ( phys2.length != 1 ) ) {
+ return false;
+ }
+ if ( !phys2[ 0 ].getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "17706" ) ) {
+ return false;
+ }
+ if ( phys2[ 0 ].getNumberOfExternalNodes() < 5 ) {
+ return false;
+ }
}
catch ( final Exception e ) {
e.printStackTrace();
+ return false;
}
return true;
}
- public static final boolean testTreeBaseReading() {
+ private static final boolean testTreeBaseReading() {
try {
- final URL u = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "825?format=nexus" );
+ final URL u = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "72557?format=nexus" );
final NexusPhylogeniesParser parser = new NexusPhylogeniesParser();
parser.setReplaceUnderscores( true );
- final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
- final Phylogeny[] phys = factory.create( u.openStream(), parser );
+ final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, parser );
if ( ( phys == null ) || ( phys.length != 1 ) ) {
return false;
}
+ final URL u_1 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "2406?format=nexus" );
+ final NexusPhylogeniesParser parser_1 = new NexusPhylogeniesParser();
+ final Phylogeny[] phys_1 = ForesterUtil.readPhylogeniesFromUrl( u_1, parser_1 );
+ if ( ( phys_1 == null ) || ( phys_1.length != 1 ) ) {
+ return false;
+ }
+ final URL u_2 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "422?format=nexus" );
+ final NexusPhylogeniesParser parser_2 = new NexusPhylogeniesParser();
+ final Phylogeny[] phys_2 = ForesterUtil.readPhylogeniesFromUrl( u_2, parser_2 );
+ if ( ( phys_2 == null ) || ( phys_2.length != 1 ) ) {
+ return false;
+ }
+ final URL u_3 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "2654?format=nexus" );
+ final NexusPhylogeniesParser parser_3 = new NexusPhylogeniesParser();
+ final Phylogeny[] phys_3 = ForesterUtil.readPhylogeniesFromUrl( u_3, parser_3 );
+ if ( ( phys_3 == null ) || ( phys_3.length != 1 ) ) {
+ return false;
+ }
+ final URL u_4 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "825?format=nexus" );
+ final NexusPhylogeniesParser parser_4 = new NexusPhylogeniesParser();
+ final Phylogeny[] phys_4 = ForesterUtil.readPhylogeniesFromUrl( u_4, parser_4 );
+ if ( ( phys_4 == null ) || ( phys_4.length != 1 ) ) {
+ return false;
+ }
final URL u2 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "15613?format=nexus" );
final NexusPhylogeniesParser parser2 = new NexusPhylogeniesParser();
parser2.setReplaceUnderscores( true );
- final PhylogenyFactory factory2 = ParserBasedPhylogenyFactory.getInstance();
- final Phylogeny[] phys2 = factory2.create( u2.openStream(), parser2 );
+ final Phylogeny[] phys2 = ForesterUtil.readPhylogeniesFromUrl( u2, parser2 );
if ( ( phys2 == null ) || ( phys2.length != 9 ) ) {
return false;
}
+ final URL u3 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "14909?format=nexus" );
+ final NexusPhylogeniesParser parser3 = new NexusPhylogeniesParser();
+ final Phylogeny[] phys3 = ForesterUtil.readPhylogeniesFromUrl( u3, parser3 );
+ if ( ( phys3 == null ) || ( phys3.length != 2 ) ) {
+ return false;
+ }
+ final Phylogeny[] phys4 = ForesterUtil.readPhylogeniesFromUrl(
+ new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE
+ + "14525?format=nexus" ),
+ new NexusPhylogeniesParser() );
+ if ( ( phys4 == null ) || ( phys4.length != 1 ) ) {
+ return false;
+ }
+ final Phylogeny[] phys5 = ForesterUtil.readPhylogeniesFromUrl(
+ new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE
+ + "15632?format=nexus" ),
+ new NexusPhylogeniesParser() );
+ if ( ( phys5 == null ) || ( phys5.length != 1 ) ) {
+ return false;
+ }
+ final Phylogeny[] phys6 = ForesterUtil.readPhylogeniesFromUrl(
+ new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE
+ + "10190?format=nexus" ),
+ new NexusPhylogeniesParser() );
+ if ( ( phys6 == null ) || ( phys6.length != 1 ) ) {
+ return false;
+ }
+ final Phylogeny[] phys7 = ForesterUtil.readPhylogeniesFromUrl(
+ new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE
+ + "13246?format=nexus" ),
+ new NexusPhylogeniesParser() );
+ if ( ( phys7 == null ) || ( phys7.length != 2 ) ) {
+ return false;
+ }
+ final Phylogeny[] phys8 = ForesterUtil.readPhylogeniesFromUrl(
+ new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE
+ + "11662?format=nexus" ),
+ new NexusPhylogeniesParser() );
+ if ( ( phys8 == null ) || ( phys8.length != 2 ) ) {
+ return false;
+ }
+ final Phylogeny[] phys9 = ForesterUtil.readPhylogeniesFromUrl(
+ new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE
+ + "562?format=nexus" ),
+ new NexusPhylogeniesParser() );
+ if ( ( phys9 == null ) || ( phys9.length != 4 ) ) {
+ return false;
+ }
+ final Phylogeny[] phys16424 = ForesterUtil.readPhylogeniesFromUrl(
+ new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE
+ + "16424?format=nexus" ),
+ new NexusPhylogeniesParser() );
+ if ( ( phys16424 == null ) || ( phys16424.length != 1 ) ) {
+ return false;
+ }
+ final Phylogeny[] phys17878 = ForesterUtil.readPhylogeniesFromUrl(
+ new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE
+ + "17878?format=nexus" ),
+ new NexusPhylogeniesParser() );
+ if ( ( phys17878 == null ) || ( phys17878.length != 17 ) ) {
+ return false;
+ }
+ final Phylogeny[] phys18804 = ForesterUtil.readPhylogeniesFromUrl(
+ new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE
+ + "18804?format=nexus" ),
+ new NexusPhylogeniesParser() );
+ if ( ( phys18804 == null ) || ( phys18804.length != 2 ) ) {
+ return false;
+ }
+ final Phylogeny[] phys346 = ForesterUtil.readPhylogeniesFromUrl(
+ new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE
+ + "346?format=nexus" ),
+ new NexusPhylogeniesParser() );
+ if ( ( phys346 == null ) || ( phys346.length != 1 ) ) {
+ return false;
+ }
}
catch ( final Exception e ) {
e.printStackTrace();
+ return false;
}
return true;
}
- public static final boolean testTreeFamReading() {
+ private static final boolean testTreeFamReading() {
try {
final URL u = new URL( WebserviceUtil.TREE_FAM_URL_BASE + "101004" + "/tree/newick" );
final NHXParser parser = new NHXParser();
parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO );
parser.setReplaceUnderscores( false );
parser.setGuessRootedness( true );
- final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
- final Phylogeny[] phys = factory.create( u.openStream(), parser );
+ final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, parser );
if ( ( phys == null ) || ( phys.length != 1 ) ) {
return false;
}
}
catch ( final Exception e ) {
e.printStackTrace();
+ return false;
}
return true;
}
private static boolean testAminoAcidSequence() {
try {
- final Sequence aa1 = BasicSequence.createAaSequence( "aa1", "aAklm-?xX*z$#" );
+ final MolecularSequence aa1 = BasicSequence.createAaSequence( "aa1", "aAklm-?xX*z$#" );
if ( aa1.getLength() != 13 ) {
return false;
}
if ( !new String( aa1.getMolecularSequence() ).equals( "AAKLM-XXX*ZXX" ) ) {
return false;
}
- final Sequence aa2 = BasicSequence.createAaSequence( "aa3", "ARNDCQEGHILKMFPSTWYVX*-BZOJU" );
- if ( !new String( aa2.getMolecularSequence() ).equals( "ARNDCQEGHILKMFPSTWYVX*-BZXXU" ) ) {
+ final MolecularSequence aa2 = BasicSequence.createAaSequence( "aa3", "ARNDCQEGHILKMFPSTWYVX*-BZOJU" );
+ if ( !new String( aa2.getMolecularSequence() ).equals( "ARNDCQEGHILKMFPSTWYVX*-BZOXU" ) ) {
return false;
}
- final Sequence dna1 = BasicSequence.createDnaSequence( "dna1", "ACGTUX*-?RYMKWSN" );
+ final MolecularSequence dna1 = BasicSequence.createDnaSequence( "dna1", "ACGTUX*-?RYMKWSN" );
if ( !new String( dna1.getMolecularSequence() ).equals( "ACGTNN*-NRYMKWSN" ) ) {
return false;
}
- final Sequence rna1 = BasicSequence.createRnaSequence( "rna1", "..ACGUTX*-?RYMKWSN" );
+ final MolecularSequence rna1 = BasicSequence.createRnaSequence( "rna1", "..ACGUTX*-?RYMKWSN" );
if ( !new String( rna1.getMolecularSequence() ).equals( "--ACGUNN*-NRYMKWSN" ) ) {
return false;
}
return true;
}
- private static boolean testBasicPhyloXMLparsing() {
- try {
- final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
- final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser();
- final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml",
- xml_parser );
- if ( xml_parser.getErrorCount() > 0 ) {
- System.out.println( xml_parser.getErrorMessages().toString() );
- return false;
- }
- if ( phylogenies_0.length != 4 ) {
- return false;
- }
- final Phylogeny t1 = phylogenies_0[ 0 ];
- final Phylogeny t2 = phylogenies_0[ 1 ];
- final Phylogeny t3 = phylogenies_0[ 2 ];
- final Phylogeny t4 = phylogenies_0[ 3 ];
- if ( t1.getNumberOfExternalNodes() != 1 ) {
- return false;
- }
- if ( !t1.isRooted() ) {
- return false;
- }
- if ( t1.isRerootable() ) {
- return false;
- }
- if ( !t1.getType().equals( "gene_tree" ) ) {
- return false;
- }
- if ( t2.getNumberOfExternalNodes() != 2 ) {
- return false;
- }
- if ( !isEqual( t2.getNode( "node a" ).getDistanceToParent(), 1.0 ) ) {
- return false;
- }
- if ( !isEqual( t2.getNode( "node b" ).getDistanceToParent(), 2.0 ) ) {
- return false;
- }
- if ( t2.getNode( "node a" ).getNodeData().getTaxonomies().size() != 2 ) {
- return false;
- }
- if ( !t2.getNode( "node a" ).getNodeData().getTaxonomy( 0 ).getCommonName().equals( "some parasite" ) ) {
- return false;
- }
- if ( !t2.getNode( "node a" ).getNodeData().getTaxonomy( 1 ).getCommonName().equals( "the host" ) ) {
- return false;
- }
- if ( t2.getNode( "node a" ).getNodeData().getSequences().size() != 2 ) {
- return false;
- }
- if ( !t2.getNode( "node a" ).getNodeData().getSequence( 0 ).getMolecularSequence()
- .startsWith( "actgtgggggt" ) ) {
- return false;
+ private static boolean testCommonPrefix() {
+ final List<String> l0 = new ArrayList<String>();
+ l0.add( "abc" );
+ if ( !ForesterUtil.greatestCommonPrefix( l0 ).equals( "abc" ) ) {
+ return false;
+ }
+ final List<String> l1 = new ArrayList<String>();
+ l1.add( "abc" );
+ l1.add( "abX" );
+ if ( !ForesterUtil.greatestCommonPrefix( l1 ).equals( "ab" ) ) {
+ return false;
+ }
+ final List<String> l2 = new ArrayList<String>();
+ l2.add( "abc" );
+ l2.add( "abX" );
+ l2.add( "axy" );
+ if ( !ForesterUtil.greatestCommonPrefix( l2 ).equals( "a" ) ) {
+ return false;
+ }
+ final List<String> l3 = new ArrayList<String>();
+ l3.add( "abXsdfsdfsdfsdfsdfsd" );
+ l3.add( "abXsdfsdfsdfsdfsdfsd" );
+ l3.add( "abc" );
+ l3.add( "abXsdfsdfsdfsdfsdfsd" );
+ l3.add( "ab" );
+ l3.add( "abc" );
+ l3.add( "ab" );
+ if ( !ForesterUtil.greatestCommonPrefix( l3 ).equals( "ab" ) ) {
+ return false;
+ }
+ final List<String> l4 = new ArrayList<String>();
+ l4.add( "abXsdfsdfsdfsdfsdfsd" );
+ l4.add( "abXsdfsdfsdfsdfsdfsd" );
+ l4.add( "abc" );
+ l4.add( "Xsdfsdfsdfsdfsdfsd" );
+ l4.add( "ab" );
+ l4.add( "abc" );
+ if ( !ForesterUtil.greatestCommonPrefix( l4 ).equals( "" ) ) {
+ return false;
+ }
+ final List<String> l5 = new ArrayList<String>();
+ l5.add( "" );
+ if ( !ForesterUtil.greatestCommonPrefix( l5 ).equals( "" ) ) {
+ return false;
+ }
+ final List<String> l6 = new ArrayList<String>();
+ l6.add( "abc" );
+ l6.add( "abX" );
+ l6.add( "" );
+ if ( !ForesterUtil.greatestCommonPrefix( l6 ).equals( "" ) ) {
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testCommonPrefixSep() {
+ final List<String> l0 = new ArrayList<String>();
+ l0.add( "a.b.c" );
+ if ( !ForesterUtil.greatestCommonPrefix( l0, "." ).equals( "a.b.c" ) ) {
+ return false;
+ }
+ final List<String> l1 = new ArrayList<String>();
+ l1.add( "a.b.c" );
+ l1.add( "a.b.X" );
+ if ( !ForesterUtil.greatestCommonPrefix( l1, "." ).equals( "a.b" ) ) {
+ return false;
+ }
+ final List<String> l2 = new ArrayList<String>();
+ l2.add( "a.b.c." );
+ l2.add( "a.b.X." );
+ l2.add( "a.x.y." );
+ if ( !ForesterUtil.greatestCommonPrefix( l2, "." ).equals( "a" ) ) {
+ return false;
+ }
+ final List<String> l3 = new ArrayList<String>();
+ l3.add( "a/b/X/s/d/f/s/d/f/s/d/f/s/d/f/s/d/f/s/d/" );
+ l3.add( "a/b/X/s/d/f/s/d/f/s/d/f/s/d/f/s/d/f/s/d" );
+ l3.add( "a/b/c" );
+ l3.add( "a/b/X/s/d/f/s/d/f/s/d/f/s/d/f/s/d/f/s/d/" );
+ l3.add( "a/b/" );
+ l3.add( "a/b/c/" );
+ l3.add( "a/b////////" );
+ if ( !ForesterUtil.greatestCommonPrefix( l3, "/" ).equals( "a/b" ) ) {
+ return false;
+ }
+ final List<String> l4 = new ArrayList<String>();
+ l4.add( "a.b.X.s.d.f.s.d.f.s.d.f.s.d.f.s.d.f.s.d" );
+ l4.add( "a.b.X.s.d.f.s.d.f.s.d.f.s.d.f.s.d.f.s.d" );
+ l4.add( "a.b.c" );
+ l4.add( "X.s.d.f.s.d.f.s.d.f.s.d.f.s.d.f.s.d..." );
+ l4.add( "a.b" );
+ l4.add( "a.b.c" );
+ if ( !ForesterUtil.greatestCommonPrefix( l4, "." ).equals( "" ) ) {
+ return false;
+ }
+ final List<String> l5 = new ArrayList<String>();
+ l5.add( "" );
+ if ( !ForesterUtil.greatestCommonPrefix( l5, "_" ).equals( "" ) ) {
+ return false;
+ }
+ final List<String> l6 = new ArrayList<String>();
+ l6.add( "_" );
+ l6.add( "__" );
+ if ( !ForesterUtil.greatestCommonPrefix( l6, "_" ).equals( "" ) ) {
+ return false;
+ }
+ final List<String> l7 = new ArrayList<String>();
+ l7.add( "a,b,c" );
+ l7.add( "a,b,X" );
+ l7.add( "" );
+ l7.add( ",,,,,,,,,," );
+ if ( !ForesterUtil.greatestCommonPrefix( l7, "," ).equals( "" ) ) {
+ return false;
+ }
+ final List<String> l8 = new ArrayList<String>();
+ l8.add( "123.304.403.04" );
+ l8.add( "123.304.403.04.02" );
+ l8.add( "123.304.403.03.03" );
+ if ( !ForesterUtil.greatestCommonPrefix( l8, "." ).equals( "123.304.403" ) ) {
+ return false;
+ }
+ final List<String> l9 = new ArrayList<String>();
+ l9.add( "123.304.403.04" );
+ l9.add( "123.304.403.04.02" );
+ l9.add( "123.304.402.03.03" );
+ if ( !ForesterUtil.greatestCommonPrefix( l9, "." ).equals( "123.304" ) ) {
+ return false;
+ }
+ final List<String> l10 = new ArrayList<String>();
+ l10.add( "abcde" );
+ l10.add( "adc" );
+ if ( !ForesterUtil.greatestCommonPrefix( l10, "." ).equals( "" ) ) {
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testContainsPrefix() {
+ if ( !ForesterUtil.isContainsPrefix( "a.b", "a", "." ) ) {
+ return false;
+ }
+ if ( !ForesterUtil.isContainsPrefix( "a.b.c", "a", "." ) ) {
+ return false;
+ }
+ if ( !ForesterUtil.isContainsPrefix( "a.b.c", "a.b", "." ) ) {
+ return false;
+ }
+ if ( !ForesterUtil.isContainsPrefix( "a.b", "a.b", "." ) ) {
+ return false;
+ }
+ if ( !ForesterUtil.isContainsPrefix( "a", "a", "." ) ) {
+ return false;
+ }
+ if ( !ForesterUtil.isContainsPrefix( ".a.b", ".a", "." ) ) {
+ return false;
+ }
+ if ( !ForesterUtil.isContainsPrefix( ".a.b.", ".a", "." ) ) {
+ return false;
+ }
+ if ( !ForesterUtil.isContainsPrefix( ".a.b.", ".a.", "." ) ) {
+ return false;
+ }
+ if ( !ForesterUtil.isContainsPrefix( "a..b.", "a", "." ) ) {
+ return false;
+ }
+ if ( !ForesterUtil.isContainsPrefix( "a..b.", "a..", "." ) ) {
+ return false;
+ }
+ if ( ForesterUtil.isContainsPrefix( "a", "a.b", "." ) ) {
+ return false;
+ }
+ if ( ForesterUtil.isContainsPrefix( "a_b", "a", "." ) ) {
+ return false;
+ }
+ if ( ForesterUtil.isContainsPrefix( ".a.", ".a.b.", "." ) ) {
+ return false;
+ }
+ if ( ForesterUtil.isContainsPrefix( "a.b.c", "a.x", "." ) ) {
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testUTF8ParsingFromFile() {
+ try {
+ final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser();
+ final Phylogeny[] phylogenies_xml = ParserBasedPhylogenyFactory.getInstance()
+ .create( new File( Test.PATH_TO_TEST_DATA + "chars.xml" ), xml_parser );
+ if ( xml_parser.getErrorCount() > 0 ) {
+ System.out.println( xml_parser.getErrorMessages().toString() );
+ return false;
+ }
+ if ( phylogenies_xml.length != 1 ) {
+ return false;
+ }
+ final Phylogeny[] phylogenies_xml2 = ParserBasedPhylogenyFactory.getInstance()
+ .create( new StringBuffer( phylogenies_xml[ 0 ].toPhyloXML( 0 ) ), xml_parser );
+ final Phylogeny[] phylogenies_nh = ParserBasedPhylogenyFactory.getInstance()
+ .create( new File( Test.PATH_TO_TEST_DATA + "chars.nh" ), new NHXParser() );
+ if ( phylogenies_nh.length != 1 ) {
+ return false;
+ }
+ final Phylogeny[] phylogenies_nex = ParserBasedPhylogenyFactory.getInstance()
+ .create( new File( Test.PATH_TO_TEST_DATA + "chars.nex" ), new NexusPhylogeniesParser() );
+ if ( phylogenies_nex.length != 1 ) {
+ return false;
+ }
+ final String[] xml_n = phylogenies_xml[ 0 ].getAllExternalNodeNames();
+ final String[] xml_n2 = phylogenies_xml2[ 0 ].getAllExternalNodeNames();
+ final String[] nh_n = phylogenies_nh[ 0 ].getAllExternalNodeNames();
+ final String[] nex_n = phylogenies_nex[ 0 ].getAllExternalNodeNames();
+ final String n0 = "AQ~!@#$%^&*()_+-=\\{}|;:\"<>?,./";
+ final String n1 = "€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜˜˜™š›œžŸ¡¢£¤¥¦§¨©ª«¬®¯°±¹²³´µ¶·¸º»¼¿À÷þÿ";
+ final String n2 = "漢字ひらがなカタカナ";
+ final String n3 = "อักษรไทย";
+ final String n4 = "繁體字";
+ final String n5 = "한글";
+ final String n6 = "देवनागरी";
+ final String n7 = "chữ Quốc ngữ";
+ final String n8 = "ру́сский язы́к";
+ final String n9 = "អក្សរខ្មែរ";
+ if ( !xml_n[ 0 ].equals( n0 ) ) {
+ System.out.println( xml_n[ 0 ] );
+ System.out.println( n0 );
+ return false;
+ }
+ if ( !xml_n2[ 0 ].equals( n0 ) ) {
+ System.out.println( xml_n2[ 0 ] );
+ System.out.println( n0 );
+ return false;
+ }
+ if ( !nh_n[ 0 ].equals( n0 ) ) {
+ System.out.println( nh_n[ 0 ] );
+ System.out.println( n0 );
+ return false;
+ }
+ if ( !nex_n[ 0 ].equals( n0 ) ) {
+ System.out.println( nex_n[ 0 ] );
+ System.out.println( n0 );
+ return false;
+ }
+ if ( !xml_n[ 1 ].equals( n1 ) ) {
+ System.out.println( xml_n[ 1 ] );
+ System.out.println( n1 );
+ return false;
+ }
+ if ( !xml_n2[ 1 ].equals( n1 ) ) {
+ System.out.println( xml_n2[ 1 ] );
+ System.out.println( n1 );
+ return false;
+ }
+ if ( !nh_n[ 1 ].equals( n1 ) ) {
+ System.out.println( nh_n[ 1 ] );
+ System.out.println( n1 );
+ return false;
+ }
+ if ( !nex_n[ 1 ].equals( n1 ) ) {
+ System.out.println( nex_n[ 1 ] );
+ System.out.println( n1 );
+ return false;
+ }
+ if ( !xml_n[ 2 ].equals( n2 ) ) {
+ System.out.println( xml_n[ 2 ] );
+ System.out.println( n2 );
+ return false;
+ }
+ if ( !xml_n2[ 2 ].equals( n2 ) ) {
+ System.out.println( xml_n2[ 2 ] );
+ System.out.println( n2 );
+ return false;
+ }
+ if ( !nh_n[ 2 ].equals( n2 ) ) {
+ System.out.println( nh_n[ 2 ] );
+ System.out.println( n2 );
+ return false;
+ }
+ if ( !nex_n[ 2 ].equals( n2 ) ) {
+ System.out.println( nex_n[ 2 ] );
+ System.out.println( n2 );
+ return false;
+ }
+ //
+ if ( !xml_n[ 3 ].equals( n3 ) ) {
+ System.out.println( xml_n[ 3 ] );
+ System.out.println( n3 );
+ return false;
+ }
+ if ( !xml_n2[ 3 ].equals( n3 ) ) {
+ System.out.println( xml_n2[ 3 ] );
+ System.out.println( n3 );
+ return false;
+ }
+ if ( !nh_n[ 3 ].equals( n3 ) ) {
+ System.out.println( nh_n[ 3 ] );
+ System.out.println( n3 );
+ return false;
+ }
+ if ( !nex_n[ 3 ].equals( n3 ) ) {
+ System.out.println( nex_n[ 3 ] );
+ System.out.println( n3 );
+ return false;
+ }
+ //
+ if ( !xml_n[ 4 ].equals( n4 ) ) {
+ System.out.println( xml_n[ 4 ] );
+ System.out.println( n4 );
+ return false;
+ }
+ if ( !nh_n[ 4 ].equals( n4 ) ) {
+ System.out.println( nh_n[ 4 ] );
+ System.out.println( n4 );
+ return false;
+ }
+ if ( !nex_n[ 4 ].equals( n4 ) ) {
+ System.out.println( nex_n[ 4 ] );
+ System.out.println( n4 );
+ return false;
+ }
+ //
+ if ( !xml_n[ 5 ].equals( n5 ) ) {
+ System.out.println( xml_n[ 5 ] );
+ System.out.println( n5 );
+ return false;
+ }
+ if ( !nh_n[ 5 ].equals( n5 ) ) {
+ System.out.println( nh_n[ 5 ] );
+ System.out.println( n5 );
+ return false;
+ }
+ if ( !nex_n[ 5 ].equals( n5 ) ) {
+ System.out.println( nex_n[ 5 ] );
+ System.out.println( n5 );
+ return false;
+ }
+ //
+ if ( !xml_n[ 6 ].equals( n6 ) ) {
+ System.out.println( xml_n[ 6 ] );
+ System.out.println( n6 );
+ return false;
+ }
+ if ( !nh_n[ 6 ].equals( n6 ) ) {
+ System.out.println( nh_n[ 6 ] );
+ System.out.println( n6 );
+ return false;
+ }
+ if ( !nex_n[ 6 ].equals( n6 ) ) {
+ System.out.println( nex_n[ 6 ] );
+ System.out.println( n6 );
+ return false;
+ }
+ //
+ if ( !xml_n[ 7 ].equals( n7 ) ) {
+ System.out.println( xml_n[ 7 ] );
+ System.out.println( n7 );
+ return false;
+ }
+ if ( !nh_n[ 7 ].equals( n7 ) ) {
+ System.out.println( nh_n[ 7 ] );
+ System.out.println( n7 );
+ return false;
+ }
+ if ( !nex_n[ 7 ].equals( n7 ) ) {
+ System.out.println( nex_n[ 7 ] );
+ System.out.println( n7 );
+ return false;
+ }
+ if ( !xml_n[ 8 ].equals( n8 ) ) {
+ System.out.println( xml_n[ 8 ] );
+ System.out.println( n8 );
+ return false;
+ }
+ if ( !nh_n[ 8 ].equals( n8 ) ) {
+ System.out.println( nh_n[ 8 ] );
+ System.out.println( n8 );
+ return false;
+ }
+ if ( !nex_n[ 8 ].equals( n8 ) ) {
+ System.out.println( nex_n[ 8 ] );
+ System.out.println( n8 );
+ return false;
+ }
+ if ( !xml_n[ 9 ].equals( n9 ) ) {
+ System.out.println( xml_n[ 9 ] );
+ System.out.println( n9 );
+ return false;
+ }
+ if ( !xml_n2[ 9 ].equals( n9 ) ) {
+ System.out.println( xml_n2[ 9 ] );
+ System.out.println( n9 );
+ return false;
+ }
+ if ( !nh_n[ 9 ].equals( n9 ) ) {
+ System.out.println( nh_n[ 9 ] );
+ System.out.println( n9 );
+ return false;
+ }
+ if ( !nex_n[ 9 ].equals( n9 ) ) {
+ System.out.println( nex_n[ 9 ] );
+ System.out.println( n9 );
+ return false;
+ }
+ if ( !phylogenies_xml[ 0 ].toNewHampshire().equals( phylogenies_nh[ 0 ].toNewHampshire() ) ) {
+ System.out.println( phylogenies_xml[ 0 ].toNewHampshire() );
+ System.out.println( phylogenies_nh[ 0 ].toNewHampshire() );
+ return false;
+ }
+ if ( !phylogenies_xml[ 0 ].toNewHampshire().equals( phylogenies_nex[ 0 ].toNewHampshire() ) ) {
+ System.out.println( phylogenies_xml[ 0 ].toNewHampshire() );
+ System.out.println( phylogenies_nex[ 0 ].toNewHampshire() );
+ return false;
+ }
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace( System.out );
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testBasicPhyloXMLparsing() {
+ try {
+ final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
+ final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser();
+ final Phylogeny[] phylogenies_0 = factory
+ .create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml" ), xml_parser );
+ if ( xml_parser.getErrorCount() > 0 ) {
+ System.out.println( xml_parser.getErrorMessages().toString() );
+ return false;
+ }
+ if ( phylogenies_0.length != 4 ) {
+ return false;
+ }
+ final Phylogeny t1 = phylogenies_0[ 0 ];
+ final Phylogeny t2 = phylogenies_0[ 1 ];
+ final Phylogeny t3 = phylogenies_0[ 2 ];
+ final Phylogeny t4 = phylogenies_0[ 3 ];
+ if ( t1.getNumberOfExternalNodes() != 1 ) {
+ return false;
+ }
+ if ( !t1.isRooted() ) {
+ return false;
+ }
+ if ( t1.isRerootable() ) {
+ return false;
+ }
+ if ( !t1.getType().equals( "gene_tree" ) ) {
+ return false;
+ }
+ if ( t2.getNumberOfExternalNodes() != 2 ) {
+ return false;
+ }
+ if ( !isEqual( t2.getNode( "node a" ).getDistanceToParent(), 1.0 ) ) {
+ return false;
+ }
+ if ( !isEqual( t2.getNode( "node b" ).getDistanceToParent(), 2.0 ) ) {
+ return false;
+ }
+ if ( t2.getNode( "node a" ).getNodeData().getTaxonomies().size() != 2 ) {
+ return false;
+ }
+ if ( !t2.getNode( "node a" ).getNodeData().getTaxonomy( 0 ).getCommonName().equals( "some parasite" ) ) {
+ return false;
+ }
+ if ( !t2.getNode( "node a" ).getNodeData().getTaxonomy( 1 ).getCommonName().equals( "the host" ) ) {
+ return false;
+ }
+ if ( t2.getNode( "node a" ).getNodeData().getSequences().size() != 2 ) {
+ return false;
+ }
+ if ( !t2.getNode( "node a" ).getNodeData().getSequence( 0 ).getMolecularSequence()
+ .startsWith( "actgtgggggt" ) ) {
+ return false;
}
if ( !t2.getNode( "node a" ).getNodeData().getSequence( 1 ).getMolecularSequence()
.startsWith( "ctgtgatgcat" ) ) {
if ( !t3.getIdentifier().getProvider().equals( "treebank" ) ) {
return false;
}
+ if ( !t3.getNode( "root node" ).isDuplication() ) {
+ return false;
+ }
+ if ( !t3.getNode( "node a" ).isDuplication() ) {
+ return false;
+ }
+ if ( t3.getNode( "node a" ).isSpeciation() ) {
+ return false;
+ }
+ if ( t3.getNode( "node bc" ).isDuplication() ) {
+ return false;
+ }
+ if ( !t3.getNode( "node bc" ).isSpeciation() ) {
+ return false;
+ }
if ( !t3.getNode( "root node" ).getNodeData().getSequence().getType().equals( "protein" ) ) {
return false;
}
if ( !t3.getNode( "root node" ).getNodeData().getSequence().getAccession().getValue().equals( "Q9BZR8" ) ) {
return false;
}
- if ( !t3.getNode( "root node" ).getNodeData().getSequence().getAccession().getSource().equals( "UniProtKB" ) ) {
+ if ( !t3.getNode( "root node" ).getNodeData().getSequence().getAccession().getSource()
+ .equals( "UniProtKB" ) ) {
return false;
}
if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
.getValue() != 1 ) {
return false;
}
- if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
- .getType().equals( "ml" ) ) {
+ if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence().getType()
+ .equals( "ml" ) ) {
return false;
}
if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
return false;
}
if ( ( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "AFFY:expression" ).getAppliesTo() != AppliesTo.ANNOTATION ) {
+ .getProperties( "AFFY:expression" ).get( 0 ).getAppliesTo() != AppliesTo.ANNOTATION ) {
return false;
}
if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "AFFY:expression" ).getDataType().equals( "xsd:double" ) ) {
+ .getProperties( "AFFY:expression" ).get( 0 ).getDataType().equals( "xsd:double" ) ) {
return false;
}
if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "AFFY:expression" ).getRef().equals( "AFFY:expression" ) ) {
+ .getProperties( "AFFY:expression" ).get( 0 ).getRef().equals( "AFFY:expression" ) ) {
return false;
}
if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "AFFY:expression" ).getUnit().equals( "AFFY:x" ) ) {
+ .getProperties( "AFFY:expression" ).get( 0 ).getUnit().equals( "AFFY:x" ) ) {
return false;
}
if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "AFFY:expression" ).getValue().equals( "0.2" ) ) {
+ .getProperties( "AFFY:expression" ).get( 0 ).getValue().equals( "0.2" ) ) {
return false;
}
if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "MED:disease" ).getValue().equals( "lymphoma" ) ) {
+ .getProperties( "MED:disease" ).get( 0 ).getValue().equals( "lymphoma" ) ) {
return false;
}
if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 1 ) ).getRef()
else {
xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
}
- final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml",
- xml_parser );
+ final Phylogeny[] phylogenies_0 = factory
+ .create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml" ), xml_parser );
if ( xml_parser.getErrorCount() > 0 ) {
System.out.println( xml_parser.getErrorMessages().toString() );
return false;
if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getSymbol().equals( "BCL2L14" ) ) {
return false;
}
- if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getAccession().getValue().equals( "Q9BZR8" ) ) {
+ if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getAccession().getValue()
+ .equals( "Q9BZR8" ) ) {
return false;
}
if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getAccession().getSource()
return false;
}
if ( ( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "AFFY:expression" ).getAppliesTo() != AppliesTo.ANNOTATION ) {
+ .getProperties( "AFFY:expression" ).get( 0 ).getAppliesTo() != AppliesTo.ANNOTATION ) {
return false;
}
if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "AFFY:expression" ).getDataType().equals( "xsd:double" ) ) {
+ .getProperties( "AFFY:expression" ).get( 0 ).getDataType().equals( "xsd:double" ) ) {
return false;
}
if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "AFFY:expression" ).getRef().equals( "AFFY:expression" ) ) {
+ .getProperties( "AFFY:expression" ).get( 0 ).getRef().equals( "AFFY:expression" ) ) {
return false;
}
if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "AFFY:expression" ).getUnit().equals( "AFFY:x" ) ) {
+ .getProperties( "AFFY:expression" ).get( 0 ).getUnit().equals( "AFFY:x" ) ) {
return false;
}
if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "AFFY:expression" ).getValue().equals( "0.2" ) ) {
+ .getProperties( "AFFY:expression" ).get( 0 ).getValue().equals( "0.2" ) ) {
return false;
}
if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
- .getProperty( "MED:disease" ).getValue().equals( "lymphoma" ) ) {
+ .getProperties( "MED:disease" ).get( 0 ).getValue().equals( "lymphoma" ) ) {
return false;
}
if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 1 ) ).getRef()
.equals( "intracellular organelle" ) ) {
return false;
}
- if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getType().equals( "source" ) ) ) {
+ if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getType()
+ .equals( "source" ) ) ) {
return false;
}
if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getDescription()
if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getLocation().equals( "12p13-p12" ) ) ) {
return false;
}
- if ( !( t3_rt.getNode( "root node" ).getNodeData().getReference().getDoi().equals( "10.1038/387489a0" ) ) ) {
+ if ( !( t3_rt.getNode( "root node" ).getNodeData().getReference().getDoi()
+ .equals( "10.1038/387489a0" ) ) ) {
return false;
}
if ( !( t3_rt.getNode( "root node" ).getNodeData().getReference().getDescription()
.equals( "Aguinaldo, A. M. A.; J. M. Turbeville, L. S. Linford, M. C. Rivera, J. R. Garey, R. A. Raff, & J. A. Lake (1997). \"Evidence for a clade of nematodes, arthropods and other moulting animals\". Nature 387 (6632): 489–493." ) ) ) {
+ System.out.println( t3_rt.getNode( "root node" ).getNodeData().getReference().getDescription() );
return false;
}
if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getTaxonomyCode().equals( "ECDYS" ) ) {
if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getScientificName().equals( "ecdysozoa" ) ) {
return false;
}
- if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getCommonName().equals( "molting animals" ) ) {
+ if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getCommonName()
+ .equals( "molting animals" ) ) {
return false;
}
if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1" ) ) {
.equals( "ncbi" ) ) {
return false;
}
- if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getTotalLength() != 124 ) {
+ if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture()
+ .getTotalLength() != 124 ) {
return false;
}
if ( !t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
.getFrom() != 21 ) {
return false;
}
- if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ).getTo() != 44 ) {
+ if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
+ .getTo() != 44 ) {
return false;
}
if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
return false;
}
if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
- .getConfidence() != 2144 ) {
+ .getConfidence() != 0 ) {
return false;
}
if ( !t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ).getId()
if ( !t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getType().equals( "characters" ) ) {
return false;
}
- //
if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getDesc().equals( "Silurian" ) ) {
return false;
}
.equalsIgnoreCase( "435" ) ) {
return false;
}
- if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getMin().toPlainString().equalsIgnoreCase( "416" ) ) {
+ if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getMin().toPlainString()
+ .equalsIgnoreCase( "416" ) ) {
return false;
}
if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getMax().toPlainString()
xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
}
}
- final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml",
- xml_parser );
+ final Phylogeny[] phylogenies_0 = factory
+ .create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml" ), xml_parser );
if ( xml_parser.getErrorCount() > 0 ) {
System.out.println( xml_parser.getErrorMessages().toString() );
return false;
return false;
}
final String x2 = Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml";
- final Phylogeny[] phylogenies_1 = factory.create( x2, xml_parser );
+ final Phylogeny[] phylogenies_1 = factory.create( new File( x2 ), xml_parser );
if ( xml_parser.getErrorCount() > 0 ) {
System.out.println( "errors:" );
System.out.println( xml_parser.getErrorMessages().toString() );
if ( phylogenies_1.length != 4 ) {
return false;
}
- final Phylogeny[] phylogenies_2 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t3.xml",
- xml_parser );
+ final Phylogeny[] phylogenies_2 = factory
+ .create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t3.xml" ), xml_parser );
if ( xml_parser.getErrorCount() > 0 ) {
System.out.println( "errors:" );
System.out.println( xml_parser.getErrorMessages().toString() );
if ( phylogenies_2[ 0 ].getNumberOfExternalNodes() != 2 ) {
return false;
}
- final Phylogeny[] phylogenies_3 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t4.xml",
- xml_parser );
+ final Phylogeny[] phylogenies_3 = factory
+ .create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t4.xml" ), xml_parser );
if ( xml_parser.getErrorCount() > 0 ) {
System.out.println( xml_parser.getErrorMessages().toString() );
return false;
if ( !a.getNode( "node b1" ).getNodeData().getTaxonomy().getCommonName().equals( "b1 species" ) ) {
return false;
}
- final Phylogeny[] phylogenies_4 = factory.create( Test.PATH_TO_TEST_DATA + "special_characters.xml",
- xml_parser );
+ final Phylogeny[] phylogenies_4 = factory
+ .create( new File( Test.PATH_TO_TEST_DATA + "special_characters.xml" ), xml_parser );
if ( xml_parser.getErrorCount() > 0 ) {
System.out.println( xml_parser.getErrorMessages().toString() );
return false;
return true;
}
- private static boolean testBasicProtein() {
+ private static boolean testPhyloXMLparsingValidating() {
try {
- final BasicProtein p0 = new BasicProtein( "p0", "owl", 0 );
- final Domain a = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
- final Domain b = new BasicDomain( "b", 11, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
- final Domain c = new BasicDomain( "c", 9, 23, ( short ) 1, ( short ) 5, 0.1, -12 );
- final Domain d = new BasicDomain( "d", 15, 30, ( short ) 1, ( short ) 5, 0.1, -12 );
- final Domain e = new BasicDomain( "e", 60, 70, ( short ) 1, ( short ) 5, 0.1, -12 );
- final Domain x = new BasicDomain( "x", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
- final Domain y = new BasicDomain( "y", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
- p0.addProteinDomain( y );
- p0.addProteinDomain( e );
- p0.addProteinDomain( b );
- p0.addProteinDomain( c );
- p0.addProteinDomain( d );
- p0.addProteinDomain( a );
- p0.addProteinDomain( x );
- if ( !p0.toDomainArchitectureString( "~" ).equals( "a~b~c~d~e~x~y" ) ) {
- return false;
- }
+ final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
+ PhyloXmlParser xml_parser = null;
+ try {
+ xml_parser = PhyloXmlParser.createPhyloXmlParserXsdValidating();
+ }
+ catch ( final Exception e ) {
+ // Do nothing -- means were not running from jar.
+ }
+ if ( xml_parser == null ) {
+ xml_parser = PhyloXmlParser.createPhyloXmlParser();
+ if ( USE_LOCAL_PHYLOXML_SCHEMA ) {
+ xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD );
+ }
+ else {
+ xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
+ }
+ }
+ final Phylogeny[] phylogenies_0 = factory
+ .create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_1.xml" ), xml_parser );
+ if ( xml_parser.getErrorCount() > 0 ) {
+ System.out.println( xml_parser.getErrorMessages().toString() );
+ return false;
+ }
+ if ( phylogenies_0.length != 3 ) {
+ return false;
+ }
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace( System.out );
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testBasicProtein() {
+ try {
+ final BasicProtein p0 = new BasicProtein( "p0", "owl", 0 );
+ final Domain a = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
+ final Domain b = new BasicDomain( "b", 11, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
+ final Domain c = new BasicDomain( "c", 9, 23, ( short ) 1, ( short ) 5, 0.1, -12 );
+ final Domain d = new BasicDomain( "d", 15, 30, ( short ) 1, ( short ) 5, 0.1, -12 );
+ final Domain e = new BasicDomain( "e", 60, 70, ( short ) 1, ( short ) 5, 0.1, -12 );
+ final Domain x = new BasicDomain( "x", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
+ final Domain y = new BasicDomain( "y", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
+ p0.addProteinDomain( y );
+ p0.addProteinDomain( e );
+ p0.addProteinDomain( b );
+ p0.addProteinDomain( c );
+ p0.addProteinDomain( d );
+ p0.addProteinDomain( a );
+ p0.addProteinDomain( x );
+ if ( !p0.toDomainArchitectureString( "~" ).equals( "a~b~c~d~e~x~y" ) ) {
+ return false;
+ }
if ( !p0.toDomainArchitectureString( "~", 3, "=" ).equals( "a~b~c~d~e~x~y" ) ) {
return false;
}
if ( !t1.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "2484" ) ) {
return false;
}
- if ( !t1.getRoot().getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName().equals( "Rhombozoa" ) ) {
+ if ( !t1.getRoot().getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName()
+ .equals( "Rhombozoa" ) ) {
return false;
}
if ( t1.getRoot().getChildNode( 0 ).getNumberOfDescendants() != 3 ) {
if ( t2.getRoot().getNumberOfDescendants() != 24 ) {
return false;
}
- if ( !t2.getRoot().getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName().equals( "Aquificae" ) ) {
+ if ( !t2.getRoot().getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName()
+ .equals( "Aquificae" ) ) {
return false;
}
if ( !t2.getRoot().getChildNode( 0 ).getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName()
if ( t2.getNumberOfExternalNodes() != 4 ) {
return false;
}
- if ( t2.getHeight() != 8.5 ) {
+ if ( t2.calculateHeight( false ) != 8.5 ) {
return false;
}
if ( !t2.isCompletelyBinary() ) {
if ( t3.getNumberOfExternalNodes() != 5 ) {
return false;
}
- if ( t3.getHeight() != 11 ) {
+ if ( t3.calculateHeight( true ) != 11 ) {
return false;
}
if ( t3.isCompletelyBinary() ) {
return false;
}
final PhylogenyNode n = t3.getNode( "ABC" );
- final Phylogeny t4 = factory.create( "((A:1,B:2,C:10)ABC:1,(D:3,E:5)DE:3,(F,G,H,I))", new NHXParser() )[ 0 ];
+ final Phylogeny t4 = factory.create( "((A:1,B:2,C:10)ABC:1,(D:3,E:5)DE:3,(F,G,H,I))",
+ new NHXParser() )[ 0 ];
if ( t4.getNumberOfExternalNodes() != 9 ) {
return false;
}
- if ( t4.getHeight() != 11 ) {
+ if ( t4.calculateHeight( false ) != 11 ) {
return false;
}
if ( t4.isCompletelyBinary() ) {
return false;
}
final StringBuffer sb5 = new StringBuffer( "(((A11:2)A1:2,(A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:3,D:8)" );
- final Phylogeny t5 = factory.create( sb5, new NHXParser() )[ 0 ];
+ final Phylogeny t5 = factory.create( sb5.toString(), new NHXParser() )[ 0 ];
if ( t5.getNumberOfExternalNodes() != 8 ) {
return false;
}
- if ( t5.getHeight() != 15 ) {
+ if ( t5.calculateHeight( false ) != 15 ) {
return false;
}
final StringBuffer sb6 = new StringBuffer( "(X,Y,Z,(((A111)A11:2)A1:2,(X,Y,Z,A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:3,D:8)" );
- final Phylogeny t6 = factory.create( sb6, new NHXParser() )[ 0 ];
- if ( t6.getHeight() != 15 ) {
+ final Phylogeny t6 = factory.create( sb6.toString(), new NHXParser() )[ 0 ];
+ if ( t6.calculateHeight( true ) != 15 ) {
return false;
}
final StringBuffer sb7 = new StringBuffer( "(((A11:2)A1:2,(A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:15,D:8)" );
- final Phylogeny t7 = factory.create( sb7, new NHXParser() )[ 0 ];
- if ( t7.getHeight() != 15 ) {
+ final Phylogeny t7 = factory.create( sb7.toString(), new NHXParser() )[ 0 ];
+ if ( t7.calculateHeight( true ) != 15 ) {
return false;
}
final StringBuffer sb8 = new StringBuffer( "(((A11:11)A1:2,(A21:2,A22:2,A23,A24,AA:)A2:11,A3:2)A:2,B:15,C:15,D:15)" );
- final Phylogeny t8 = factory.create( sb8, new NHXParser() )[ 0 ];
+ final Phylogeny t8 = factory.create( sb8.toString(), new NHXParser() )[ 0 ];
if ( t8.getNumberOfExternalNodes() != 10 ) {
return false;
}
- if ( t8.getHeight() != 15 ) {
+ if ( t8.calculateHeight( true ) != 15 ) {
return false;
}
final char[] a9 = new char[] { 'a' };
final Phylogeny t9 = factory.create( a9, new NHXParser() )[ 0 ];
- if ( t9.getHeight() != 0 ) {
+ if ( t9.calculateHeight( true ) != 0 ) {
return false;
}
final char[] a10 = new char[] { 'a', ':', '6' };
final Phylogeny t10 = factory.create( a10, new NHXParser() )[ 0 ];
- if ( t10.getHeight() != 6 ) {
+ if ( t10.calculateHeight( true ) != 6 ) {
return false;
}
}
try {
final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
final Phylogeny t0 = factory.create( "((((A,B)ab,C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
- final Phylogeny[] ev0 = factory
- .create( "((((A,B),C),D),E);((((A,B),C),D),E);((((A,B),C),D),E);((((A,B),C),D),E);",
- new NHXParser() );
+ final Phylogeny[] ev0 = factory.create(
+ "((((A,B),C),D),E);((((A,B),C),D),E);((((A,B),C),D),E);((((A,B),C),D),E);",
+ new NHXParser() );
ConfidenceAssessor.evaluate( "bootstrap", ev0, t0, false, 1, 0, 2 );
if ( !isEqual( t0.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 3 ) ) {
return false;
return false;
}
final Phylogeny t1 = factory.create( "((((A,B)ab[&&NHX:B=50],C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
- final Phylogeny[] ev1 = factory
- .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));",
- new NHXParser() );
+ final Phylogeny[] ev1 = factory.create(
+ "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));",
+ new NHXParser() );
ConfidenceAssessor.evaluate( "bootstrap", ev1, t1, false, 1 );
if ( !isEqual( t1.getNode( "ab" ).getBranchData().getConfidence( 1 ).getValue(), 7 ) ) {
return false;
return false;
}
final Phylogeny t_b = factory.create( "((((A,C)ac,D)acd,E)acde,B)abcde", new NHXParser() )[ 0 ];
- final Phylogeny[] ev_b = factory
- .create( "((A,C),X);((A,X),C);(A,C);((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));((((A,C)ac,D)acd,E)acde,B)abcd",
- new NHXParser() );
+ final Phylogeny[] ev_b = factory.create(
+ "((A,C),X);((A,X),C);(A,C);((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));((((A,C)ac,D)acd,E)acde,B)abcd",
+ new NHXParser() );
ConfidenceAssessor.evaluate( "bootstrap", ev_b, t_b, false, 1 );
if ( !isEqual( t_b.getNode( "ac" ).getBranchData().getConfidence( 0 ).getValue(), 4 ) ) {
return false;
}
//
final Phylogeny t1x = factory.create( "((((A,B)ab,C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
- final Phylogeny[] ev1x = factory
- .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));",
- new NHXParser() );
+ final Phylogeny[] ev1x = factory.create(
+ "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));",
+ new NHXParser() );
ConfidenceAssessor.evaluate( "bootstrap", ev1x, t1x, true, 1 );
if ( !isEqual( t1x.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 7 ) ) {
return false;
return false;
}
final Phylogeny t_bx = factory.create( "((((A,C)ac,D)acd,E)acde,B)abcde", new NHXParser() )[ 0 ];
- final Phylogeny[] ev_bx = factory
- .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));((((A,C)ac,D)acd,E)acde,B)abcd",
- new NHXParser() );
+ final Phylogeny[] ev_bx = factory.create(
+ "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));((((A,C)ac,D)acd,E)acde,B)abcd",
+ new NHXParser() );
ConfidenceAssessor.evaluate( "bootstrap", ev_bx, t_bx, true, 1 );
if ( !isEqual( t_bx.getNode( "ac" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
return false;
if ( !isEqual( t_bx.getNode( "acd" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
return false;
}
- //
- final Phylogeny[] t2 = factory
- .create( "((((a,b),c),d),e);(((a,b),c),(d,e));(((((a,b),c),d),e),f);((((a,b),c),(d,e)),f);(((a,b),c),d,e);((a,b,c),d,e);",
- new NHXParser() );
- final Phylogeny[] ev2 = factory
- .create( "((((a,b),c),d),e);((((a,b),c),d),e);((((a,b),e),d),c);((((a,b),e),d),c);(((a,b),(c,d)),e);((a,b),x);((a,b),(x,y));(a,b);(a,e);(a,b,c);",
- new NHXParser() );
+ final Phylogeny[] t2 = factory.create(
+ "((((a,b),c),d),e);(((a,b),c),(d,e));(((((a,b),c),d),e),f);((((a,b),c),(d,e)),f);(((a,b),c),d,e);((a,b,c),d,e);",
+ new NHXParser() );
+ final Phylogeny[] ev2 = factory.create(
+ "((((a,b),c),d),e);((((a,b),c),d),e);((((a,b),e),d),c);((((a,b),e),d),c);(((a,b),(c,d)),e);((a,b),x);((a,b),(x,y));(a,b);(a,e);(a,b,c);",
+ new NHXParser() );
for( final Phylogeny target : t2 ) {
ConfidenceAssessor.evaluate( "bootstrap", ev2, target, false, 1 );
}
- //
final Phylogeny t4 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,G)abcdefg",
new NHXParser() )[ 0 ];
final Phylogeny[] ev4 = factory.create( "(((A,B),C),(X,Y));((F,G),((A,B,C),(D,E)))", new NHXParser() );
return false;
}
n.setName( "B0LM41_HUMAN" );
- if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "B0LM41_HUMAN" ) ) {
+ if ( !TreePanelUtil.createUriForSeqWeb( n, null, null )
+ .equals( ForesterUtil.UNIPROT_KB + "B0LM41_HUMAN" ) ) {
return false;
}
n.setName( "NP_001025424" );
- if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_PROTEIN + "NP_001025424" ) ) {
+ if ( !TreePanelUtil.createUriForSeqWeb( n, null, null )
+ .equals( ForesterUtil.NCBI_PROTEIN + "NP_001025424" ) ) {
return false;
}
n.setName( "_NM_001030253-" );
- if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_NUCCORE + "NM_001030253" ) ) {
+ if ( !TreePanelUtil.createUriForSeqWeb( n, null, null )
+ .equals( ForesterUtil.NCBI_NUCCORE + "NM_001030253" ) ) {
return false;
}
n.setName( "XM_002122186" );
- if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_NUCCORE + "XM_002122186" ) ) {
+ if ( !TreePanelUtil.createUriForSeqWeb( n, null, null )
+ .equals( ForesterUtil.NCBI_NUCCORE + "XM_002122186" ) ) {
return false;
}
n.setName( "dgh_AAA34956_gdg" );
if ( t4.getNumberOfExternalNodes() != 5 ) {
return false;
}
- String s = w.toNewHampshire( t4, false, true ).toString();
+ String s = w.toNewHampshire( t4, true ).toString();
if ( !s.equals( "((A,(B11,B12)),(C,D));" ) ) {
return false;
}
if ( !n.getName().equals( "D" ) ) {
return false;
}
- s = w.toNewHampshire( t4, false, true ).toString();
+ s = w.toNewHampshire( t4, true ).toString();
if ( !s.equals( "((A,B12),D);" ) ) {
return false;
}
if ( t5.getNumberOfExternalNodes() != 5 ) {
return false;
}
- s = w.toNewHampshire( t5, false, true ).toString();
+ s = w.toNewHampshire( t5, true ).toString();
if ( !s.equals( "(((B11,B12),B2),(C,D));" ) ) {
return false;
}
if ( t6.getNumberOfExternalNodes() != 5 ) {
return false;
}
- s = w.toNewHampshire( t6, false, false ).toString();
+ s = w.toNewHampshire( t6, false ).toString();
if ( !s.equals( "((A,(B12,B2)),(C,D));" ) ) {
return false;
}
if ( t7.getNumberOfExternalNodes() != 5 ) {
return false;
}
- s = w.toNewHampshire( t7, false, true ).toString();
+ s = w.toNewHampshire( t7, true ).toString();
if ( !s.equals( "((A,(B11,B2)),(C,D));" ) ) {
return false;
}
if ( t8.getNumberOfExternalNodes() != 5 ) {
return false;
}
- s = w.toNewHampshire( t8, false, false ).toString();
+ s = w.toNewHampshire( t8, false ).toString();
if ( !s.equals( "((A,(B11,B12)),(C,D));" ) ) {
return false;
}
if ( t9.getNumberOfExternalNodes() != 5 ) {
return false;
}
- s = w.toNewHampshire( t9, false, true ).toString();
+ s = w.toNewHampshire( t9, true ).toString();
if ( !s.equals( "((A,((B11,B12),B2)),D);" ) ) {
return false;
}
if ( t10.getNumberOfExternalNodes() != 5 ) {
return false;
}
- s = w.toNewHampshire( t10, false, true ).toString();
+ s = w.toNewHampshire( t10, true ).toString();
if ( !s.equals( "((A,((B11,B12),B2)),C);" ) ) {
return false;
}
if ( t11.getNumberOfExternalNodes() != 2 ) {
return false;
}
- s = w.toNewHampshire( t11, false, true ).toString();
+ s = w.toNewHampshire( t11, true ).toString();
if ( !s.equals( "(B,C);" ) ) {
return false;
}
if ( t11.getNumberOfExternalNodes() != 1 ) {
return false;
}
- s = w.toNewHampshire( t11, false, false ).toString();
+ s = w.toNewHampshire( t11, false ).toString();
if ( !s.equals( "B;" ) ) {
return false;
}
if ( t12.getNumberOfExternalNodes() != 8 ) {
return false;
}
- s = w.toNewHampshire( t12, false, true ).toString();
+ s = w.toNewHampshire( t12, true ).toString();
if ( !s.equals( "((A1,A2,A3),(B1,B3),(C1,C2,C3));" ) ) {
return false;
}
if ( t12.getNumberOfExternalNodes() != 7 ) {
return false;
}
- s = w.toNewHampshire( t12, false, true ).toString();
+ s = w.toNewHampshire( t12, true ).toString();
if ( !s.equals( "((A1,A2,A3),B1,(C1,C2,C3));" ) ) {
return false;
}
if ( t12.getNumberOfExternalNodes() != 6 ) {
return false;
}
- s = w.toNewHampshire( t12, false, true ).toString();
+ s = w.toNewHampshire( t12, true ).toString();
if ( !s.equals( "((A1,A2,A3),B1,(C1,C2));" ) ) {
return false;
}
if ( t12.getNumberOfExternalNodes() != 5 ) {
return false;
}
- s = w.toNewHampshire( t12, false, true ).toString();
+ s = w.toNewHampshire( t12, true ).toString();
if ( !s.equals( "((A2,A3),B1,(C1,C2));" ) ) {
return false;
}
if ( t12.getNumberOfExternalNodes() != 4 ) {
return false;
}
- s = w.toNewHampshire( t12, false, true ).toString();
+ s = w.toNewHampshire( t12, true ).toString();
if ( !s.equals( "((A2,A3),(C1,C2));" ) ) {
return false;
}
if ( t12.getNumberOfExternalNodes() != 3 ) {
return false;
}
- s = w.toNewHampshire( t12, false, true ).toString();
+ s = w.toNewHampshire( t12, true ).toString();
if ( !s.equals( "(A2,(C1,C2));" ) ) {
return false;
}
if ( t12.getNumberOfExternalNodes() != 2 ) {
return false;
}
- s = w.toNewHampshire( t12, false, true ).toString();
+ s = w.toNewHampshire( t12, true ).toString();
if ( !s.equals( "(C1,C2);" ) ) {
return false;
}
if ( t13.getNumberOfExternalNodes() != 4 ) {
return false;
}
- s = w.toNewHampshire( t13, false, true ).toString();
+ s = w.toNewHampshire( t13, true ).toString();
if ( !s.equals( "(A,B,C,E:5.0);" ) ) {
return false;
}
if ( t14.getNumberOfExternalNodes() != 5 ) {
return false;
}
- s = w.toNewHampshire( t14, false, true ).toString();
+ s = w.toNewHampshire( t14, true ).toString();
if ( !s.equals( "((A,B,C,D:1.1),F);" ) ) {
return false;
}
System.out.println( entry.getSequenceName() );
return false;
}
- // if ( !entry.getSequenceSymbol().equals( "" ) ) {
- // System.out.println( entry.getSequenceSymbol() );
- // return false;
- // }
if ( !entry.getGeneName().equals( "treX-like" ) ) {
System.out.println( entry.getGeneName() );
return false;
System.out.println( entry.getAnnotations().first().getRefSource() );
return false;
}
- if ( entry.getCrossReferences().size() != 5 ) {
+ if ( entry.getCrossReferences().size() < 1 ) {
return false;
}
- //
final SequenceDatabaseEntry entry1 = SequenceDbWsTools.obtainEntry( "ABJ16409" );
if ( !entry1.getAccession().equals( "ABJ16409" ) ) {
return false;
System.out.println( entry1.getGeneName() );
return false;
}
- if ( entry1.getCrossReferences().size() != 6 ) {
+ if ( entry1.getCrossReferences().size() < 1 ) {
return false;
}
- //
final SequenceDatabaseEntry entry2 = SequenceDbWsTools.obtainEntry( "NM_184234" );
if ( !entry2.getAccession().equals( "NM_184234" ) ) {
return false;
System.out.println( entry2.getGeneName() );
return false;
}
- if ( entry2.getCrossReferences().size() != 3 ) {
+ if ( entry2.getCrossReferences().size() < 1 ) {
+ return false;
+ }
+ if ( !entry2.getChromosome().equals( "20" ) ) {
+ return false;
+ }
+ if ( !entry2.getMap().equals( "20q11.22" ) ) {
return false;
}
- //
final SequenceDatabaseEntry entry3 = SequenceDbWsTools.obtainEntry( "HM043801" );
if ( !entry3.getAccession().equals( "HM043801" ) ) {
return false;
System.out.println( entry3.getTaxonomyScientificName() );
return false;
}
- if ( !entry3.getSequenceName().equals( "Bursaphelenchus xylophilus RAF gene, complete cds" ) ) {
- System.out.println( entry3.getSequenceName() );
+ if ( !entry3.getSequenceName().equals( "Bursaphelenchus xylophilus RAF gene, complete cds" ) ) {
+ System.out.println( entry3.getSequenceName() );
+ return false;
+ }
+ if ( !entry3.getTaxonomyIdentifier().equals( "6326" ) ) {
+ System.out.println( entry3.getTaxonomyIdentifier() );
+ return false;
+ }
+ if ( !entry3.getSequenceSymbol().equals( "RAF" ) ) {
+ System.out.println( entry3.getSequenceSymbol() );
+ return false;
+ }
+ if ( !ForesterUtil.isEmpty( entry3.getGeneName() ) ) {
+ return false;
+ }
+ if ( entry3.getCrossReferences().size() < 1 ) {
+ return false;
+ }
+ final SequenceDatabaseEntry entry4 = SequenceDbWsTools.obtainEntry( "AAA36557.1" );
+ if ( !entry4.getAccession().equals( "AAA36557" ) ) {
+ return false;
+ }
+ if ( !entry4.getTaxonomyScientificName().equals( "Homo sapiens" ) ) {
+ System.out.println( entry4.getTaxonomyScientificName() );
+ return false;
+ }
+ if ( !entry4.getSequenceName().equals( "Homo sapiens (human) ras protein" ) ) {
+ System.out.println( entry4.getSequenceName() );
+ return false;
+ }
+ if ( !entry4.getTaxonomyIdentifier().equals( "9606" ) ) {
+ System.out.println( entry4.getTaxonomyIdentifier() );
+ return false;
+ }
+ if ( !entry4.getGeneName().equals( "ras" ) ) {
+ System.out.println( entry4.getGeneName() );
+ return false;
+ }
+ final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "AAZ45343.1" );
+ if ( !entry5.getAccession().equals( "AAZ45343" ) ) {
+ return false;
+ }
+ if ( !entry5.getTaxonomyScientificName().equals( "Dechloromonas aromatica RCB" ) ) {
+ System.out.println( entry5.getTaxonomyScientificName() );
+ return false;
+ }
+ if ( !entry5.getSequenceName().equals( "Dechloromonas aromatica RCB 1,4-alpha-glucan branching enzyme" ) ) {
+ System.out.println( entry5.getSequenceName() );
+ return false;
+ }
+ if ( !entry5.getTaxonomyIdentifier().equals( "159087" ) ) {
+ System.out.println( entry5.getTaxonomyIdentifier() );
+ return false;
+ }
+ final SequenceDatabaseEntry entry6 = SequenceDbWsTools.obtainEntry( "M30539" );
+ if ( !entry6.getAccession().equals( "M30539" ) ) {
+ return false;
+ }
+ if ( !entry6.getGeneName().equals( "ras" ) ) {
+ return false;
+ }
+ if ( !entry6.getSequenceName().equals( "Human SK2 c-Ha-ras-1 oncogene-encoded protein gene, exon 1" ) ) {
+ return false;
+ }
+ if ( !entry6.getTaxonomyIdentifier().equals( "9606" ) ) {
+ return false;
+ }
+ if ( !entry6.getTaxonomyScientificName().equals( "Homo sapiens" ) ) {
+ return false;
+ }
+ if ( entry6.getCrossReferences().size() < 1 ) {
+ return false;
+ }
+ }
+ catch ( final IOException e ) {
+ System.out.println();
+ System.out.println( "the following might be due to absence internet connection:" );
+ e.printStackTrace( System.out );
+ return true;
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace();
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testExternalNodeRelatedMethods() {
+ try {
+ final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
+ final Phylogeny t1 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
+ PhylogenyNode n = t1.getNode( "A" );
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "B" ) ) {
+ return false;
+ }
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "C" ) ) {
+ return false;
+ }
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "D" ) ) {
+ return false;
+ }
+ n = t1.getNode( "B" );
+ while ( !n.isLastExternalNode() ) {
+ n = n.getNextExternalNode();
+ }
+ final Phylogeny t2 = factory.create( "(((A,B),C),D)", new NHXParser() )[ 0 ];
+ n = t2.getNode( "A" );
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "B" ) ) {
+ return false;
+ }
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "C" ) ) {
+ return false;
+ }
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "D" ) ) {
+ return false;
+ }
+ n = t2.getNode( "B" );
+ while ( !n.isLastExternalNode() ) {
+ n = n.getNextExternalNode();
+ }
+ final Phylogeny t3 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ];
+ n = t3.getNode( "A" );
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "B" ) ) {
+ return false;
+ }
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "C" ) ) {
+ return false;
+ }
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "D" ) ) {
+ return false;
+ }
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "E" ) ) {
+ return false;
+ }
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "F" ) ) {
+ return false;
+ }
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "G" ) ) {
+ return false;
+ }
+ n = n.getNextExternalNode();
+ if ( !n.getName().equals( "H" ) ) {
+ return false;
+ }
+ n = t3.getNode( "B" );
+ while ( !n.isLastExternalNode() ) {
+ n = n.getNextExternalNode();
+ }
+ final Phylogeny t4 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
+ for( final PhylogenyNodeIterator iter = t4.iteratorExternalForward(); iter.hasNext(); ) {
+ final PhylogenyNode node = iter.next();
+ }
+ final Phylogeny t5 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ];
+ for( final PhylogenyNodeIterator iter = t5.iteratorExternalForward(); iter.hasNext(); ) {
+ final PhylogenyNode node = iter.next();
+ }
+ final Phylogeny t6 = factory.create( "((((((A))),(((B))),((C)),((((D)))),E)),((F)))",
+ new NHXParser() )[ 0 ];
+ final PhylogenyNodeIterator iter = t6.iteratorExternalForward();
+ if ( !iter.next().getName().equals( "A" ) ) {
+ return false;
+ }
+ if ( !iter.next().getName().equals( "B" ) ) {
+ return false;
+ }
+ if ( !iter.next().getName().equals( "C" ) ) {
+ return false;
+ }
+ if ( !iter.next().getName().equals( "D" ) ) {
+ return false;
+ }
+ if ( !iter.next().getName().equals( "E" ) ) {
+ return false;
+ }
+ if ( !iter.next().getName().equals( "F" ) ) {
+ return false;
+ }
+ if ( iter.hasNext() ) {
+ return false;
+ }
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace( System.out );
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testExtractSNFromNodeName() {
+ try {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus" ).equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2 Mus musculus" ).equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_BCDO2" ).equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus musculus BCDO2" )
+ .equals( "Mus musculus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_BCDO2" )
+ .equals( "Mus musculus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2 Mus musculus musculus" )
+ .equals( "Mus musculus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Bcl Mus musculus musculus" )
+ .equals( "Mus musculus musculus" ) ) {
+ return false;
+ }
+ if ( ParserUtils.extractScientificNameFromNodeName( "vcl Mus musculus musculus" ) != null ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_BCDO2" )
+ .equals( "Mus musculus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_Musculus" )
+ .equals( "Mus musculus musculus" ) ) {
+ return false;
+ }
+ if ( ParserUtils
+ .extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_musculus" ) != null ) {
+ return false;
+ }
+ if ( ParserUtils.extractScientificNameFromNodeName( "musculus" ) != null ) {
+ return false;
+ }
+ if ( ParserUtils.extractScientificNameFromNodeName( "mus_musculus" ) != null ) {
+ return false;
+ }
+ if ( ParserUtils.extractScientificNameFromNodeName( "mus_musculus_musculus" ) != null ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_1" )
+ .equals( "Mus musculus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_1" ).equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_bcl" ) != null ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_BCL" ).equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( ParserUtils.extractScientificNameFromNodeName( "Mus musculus bcl" ) != null ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus BCL" ).equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus xBCL" ).equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus x1" ).equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( " -XS12_Mus_musculus_12" ).equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus_12 affrre e" )
+ .equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus_12_affrre_e" )
+ .equals( "Mus musculus" ) ) {
+ return false;
+ }
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus" ).equals( "Mus musculus" ) ) {
return false;
}
- if ( !entry3.getTaxonomyIdentifier().equals( "6326" ) ) {
- System.out.println( entry3.getTaxonomyIdentifier() );
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_2bcl2" )
+ .equals( "Mus musculus musculus" ) ) {
return false;
}
- if ( !entry3.getSequenceSymbol().equals( "RAF" ) ) {
- System.out.println( entry3.getSequenceSymbol() );
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_2bcl2" )
+ .equals( "Mus musculus musculus" ) ) {
return false;
}
- if ( !ForesterUtil.isEmpty( entry3.getGeneName() ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_bcl2" )
+ .equals( "Mus musculus musculus" ) ) {
return false;
}
- if ( entry3.getCrossReferences().size() != 8 ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_123" ).equals( "Mus musculus" ) ) {
return false;
}
- //
- //
- final SequenceDatabaseEntry entry4 = SequenceDbWsTools.obtainEntry( "AAA36557.1" );
- if ( !entry4.getAccession().equals( "AAA36557" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Pilostyles mexicana Mexico Breedlove 27233" )
+ .equals( "Pilostyles mexicana" ) ) {
return false;
}
- if ( !entry4.getTaxonomyScientificName().equals( "Homo sapiens" ) ) {
- System.out.println( entry4.getTaxonomyScientificName() );
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_strain_K12/DH10B" )
+ .equals( "Escherichia coli strain K12/DH10B" ) ) {
return false;
}
- if ( !entry4.getSequenceName().equals( "Homo sapiens (human) ras protein" ) ) {
- System.out.println( entry4.getSequenceName() );
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K12/DH10B" )
+ .equals( "Escherichia coli str. K12/DH10B" ) ) {
return false;
}
- if ( !entry4.getTaxonomyIdentifier().equals( "9606" ) ) {
- System.out.println( entry4.getTaxonomyIdentifier() );
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str. K12/DH10B" )
+ .equals( "Escherichia coli str. K12/DH10B" ) ) {
return false;
}
- if ( !entry4.getGeneName().equals( "ras" ) ) {
- System.out.println( entry4.getGeneName() );
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis_lyrata_subsp_lyrata" )
+ .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
return false;
}
- // if ( !entry4.getChromosome().equals( "ras" ) ) {
- // System.out.println( entry4.getChromosome() );
- // return false;
- // }
- // if ( !entry4.getMap().equals( "ras" ) ) {
- // System.out.println( entry4.getMap() );
- // return false;
- // }
- //TODO FIXME gi...
- //
- //TODO fails:
- // final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "M30539" );
- // if ( !entry5.getAccession().equals( "HM043801" ) ) {
- // return false;
- // }
- final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "AAZ45343.1" );
- if ( !entry5.getAccession().equals( "AAZ45343" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata" )
+ .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
return false;
}
- if ( !entry5.getTaxonomyScientificName().equals( "Dechloromonas aromatica RCB" ) ) {
- System.out.println( entry5.getTaxonomyScientificName() );
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata 395" )
+ .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
return false;
}
- if ( !entry5.getSequenceName().equals( "Dechloromonas aromatica RCB 1,4-alpha-glucan branching enzyme" ) ) {
- System.out.println( entry5.getSequenceName() );
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata bcl2" )
+ .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
return false;
}
- if ( !entry5.getTaxonomyIdentifier().equals( "159087" ) ) {
- System.out.println( entry5.getTaxonomyIdentifier() );
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp lyrata bcl2" )
+ .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
return false;
}
- }
- catch ( final IOException e ) {
- System.out.println();
- System.out.println( "the following might be due to absence internet connection:" );
- e.printStackTrace( System.out );
- return true;
- }
- catch ( final Exception e ) {
- e.printStackTrace();
- return false;
- }
- return true;
- }
-
- private static boolean testExternalNodeRelatedMethods() {
- try {
- final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
- final Phylogeny t1 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
- PhylogenyNode n = t1.getNode( "A" );
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "B" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subspecies lyrata bcl2" )
+ .equals( "Arabidopsis lyrata subspecies lyrata" ) ) {
return false;
}
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "C" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Verbascum sinuatum var. adenosepalum bcl2" )
+ .equals( "Verbascum sinuatum var. adenosepalum" ) ) {
return false;
}
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "D" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (strain K12)" )
+ .equals( "Escherichia coli (strain K12)" ) ) {
return false;
}
- n = t1.getNode( "B" );
- while ( !n.isLastExternalNode() ) {
- n = n.getNextExternalNode();
- }
- final Phylogeny t2 = factory.create( "(((A,B),C),D)", new NHXParser() )[ 0 ];
- n = t2.getNode( "A" );
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "B" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (strain K12) bcl2" )
+ .equals( "Escherichia coli (strain K12)" ) ) {
return false;
}
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "C" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str. K12)" )
+ .equals( "Escherichia coli (str. K12)" ) ) {
return false;
}
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "D" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str K12)" )
+ .equals( "Escherichia coli (str. K12)" ) ) {
return false;
}
- n = t2.getNode( "B" );
- while ( !n.isLastExternalNode() ) {
- n = n.getNextExternalNode();
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str. K12) bcl2" )
+ .equals( "Escherichia coli (str. K12)" ) ) {
+ return false;
}
- final Phylogeny t3 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ];
- n = t3.getNode( "A" );
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "B" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (var K12) bcl2" )
+ .equals( "Escherichia coli (var. K12)" ) ) {
return false;
}
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "C" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str. K-12 substr. MG1655star" )
+ .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
return false;
}
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "D" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str K-12 substr MG1655star" )
+ .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
return false;
}
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "E" ) ) {
+ if ( !ParserUtils
+ .extractScientificNameFromNodeName( "could be anything Escherichia coli str K-12 substr MG1655star" )
+ .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
return false;
}
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "F" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str K-12 substr MG1655star gene1" )
+ .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
return false;
}
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "G" ) ) {
+ if ( !ParserUtils
+ .extractScientificNameFromNodeName( "could be anything Escherichia coli str K-12 substr MG1655star GENE1" )
+ .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
return false;
}
- n = n.getNextExternalNode();
- if ( !n.getName().equals( "H" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K-12_substr_MG1655star" )
+ .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
return false;
}
- n = t3.getNode( "B" );
- while ( !n.isLastExternalNode() ) {
- n = n.getNextExternalNode();
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K-12_substr_MG1655star" )
+ .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
+ return false;
}
- final Phylogeny t4 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
- for( final PhylogenyNodeIterator iter = t4.iteratorExternalForward(); iter.hasNext(); ) {
- final PhylogenyNode node = iter.next();
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp." ).equals( "Macrocera sp." ) ) {
+ return false;
}
- final Phylogeny t5 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ];
- for( final PhylogenyNodeIterator iter = t5.iteratorExternalForward(); iter.hasNext(); ) {
- final PhylogenyNode node = iter.next();
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp. 123" ).equals( "Macrocera sp." ) ) {
+ return false;
}
- final Phylogeny t6 = factory.create( "((((((A))),(((B))),((C)),((((D)))),E)),((F)))", new NHXParser() )[ 0 ];
- final PhylogenyNodeIterator iter = t6.iteratorExternalForward();
- if ( !iter.next().getName().equals( "A" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp. K12" ).equals( "Macrocera sp." ) ) {
return false;
}
- if ( !iter.next().getName().equals( "B" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "something Macrocera sp. K12" )
+ .equals( "Macrocera sp." ) ) {
return false;
}
- if ( !iter.next().getName().equals( "C" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp" ).equals( "Macrocera sp." ) ) {
return false;
}
- if ( !iter.next().getName().equals( "D" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum ssp merenskyanum 07 48" )
+ .equals( "Sesamum rigidum subsp. merenskyanum" ) ) {
return false;
}
- if ( !iter.next().getName().equals( "E" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum ssp. merenskyanum" )
+ .equals( "Sesamum rigidum subsp. merenskyanum" ) ) {
return false;
}
- if ( !iter.next().getName().equals( "F" ) ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum (ssp. merenskyanum)" )
+ .equals( "Sesamum rigidum (subsp. merenskyanum)" ) ) {
return false;
}
- if ( iter.hasNext() ) {
+ if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum (ssp merenskyanum)" )
+ .equals( "Sesamum rigidum (subsp. merenskyanum)" ) ) {
return false;
}
}
return true;
}
- private static boolean testExtractSNFromNodeName() {
+ private static boolean testExtractTaxonomyDataFromNodeName() {
try {
- if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus" ).equals( "Mus musculus" ) ) {
+ PhylogenyNode n = new PhylogenyNode( "tr|B1AM49|B1AM49_HUMAN" );
+ if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
return false;
}
- if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus_musculus" )
- .equals( "Mus musculus musculus" ) ) {
- return false;
- }
- if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus_musculus-12" )
- .equals( "Mus musculus musculus" ) ) {
+ n = new PhylogenyNode( "tr|B1AM49|B1AM49_HUMAN~1-2" );
+ if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
return false;
}
- if ( !ParserUtils.extractScientificNameFromNodeName( " -XS12_Mus_musculus-12" ).equals( "Mus musculus" ) ) {
+ n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN" );
+ if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
return false;
}
- if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus-12 affrre e" )
- .equals( "Mus musculus" ) ) {
+ n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN|" );
+ if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
return false;
}
- if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus" ).equals( "Mus musculus" ) ) {
+ n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN~12" );
+ if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
return false;
}
- if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus" )
- .equals( "Mus musculus musculus" ) ) {
+ n = new PhylogenyNode( "HNRPR_HUMAN" );
+ if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
return false;
}
- if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_123" ).equals( "Mus musculus" ) ) {
+ n = new PhylogenyNode( "HNRPR_HUMAN_X" );
+ if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
return false;
}
}
private static boolean testExtractTaxonomyCodeFromNodeName() {
try {
- if ( ParserUtils.extractTaxonomyCodeFromNodeName( "MOUSE", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
+ if ( ParserUtils.extractTaxonomyCodeFromNodeName( "MOUSE",
+ TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
return false;
}
if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
.equals( "ARATH" ) ) {
return false;
}
- if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "RAT", TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "RAT" ) ) {
+ if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "RAT", TAXONOMY_EXTRACTION.AGGRESSIVE )
+ .equals( "RAT" ) ) {
return false;
}
- if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "RAT", TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "RAT" ) ) {
+ if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "RAT", TAXONOMY_EXTRACTION.AGGRESSIVE )
+ .equals( "RAT" ) ) {
return false;
}
- if ( ParserUtils.extractTaxonomyCodeFromNodeName( "RAT1", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
+ if ( ParserUtils.extractTaxonomyCodeFromNodeName( "RAT1",
+ TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
return false;
}
if ( !ParserUtils.extractTaxonomyCodeFromNodeName( " _SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
.equals( "SOYBN" ) ) {
return false;
}
- if ( ParserUtils.extractTaxonomyCodeFromNodeName( "xxxSOYBNxxx", TAXONOMY_EXTRACTION.AGGRESSIVE ) != null ) {
+ if ( ParserUtils.extractTaxonomyCodeFromNodeName( "xxxSOYBNxxx",
+ TAXONOMY_EXTRACTION.AGGRESSIVE ) != null ) {
return false;
}
if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "-SOYBN~", TAXONOMY_EXTRACTION.AGGRESSIVE )
.equals( "SOYBN" ) ) {
return false;
}
- if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "NNN8_ECOLI/1-2:0.01",
- TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT ).equals( "ECOLI" ) ) {
+ if ( !ParserUtils
+ .extractTaxonomyCodeFromNodeName( "NNN8_ECOLI/1-2:0.01", TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT )
+ .equals( "ECOLI" ) ) {
return false;
}
- if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "blag_9YX45-blag", TAXONOMY_EXTRACTION.AGGRESSIVE )
+ if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "blagg_9YX45-blag", TAXONOMY_EXTRACTION.AGGRESSIVE )
.equals( "9YX45" ) ) {
return false;
}
return false;
}
if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT function = 23445",
- TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
+ TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
+ .equals( "RAT" ) ) {
return false;
}
if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT function = 23445",
- TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
+ TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
+ .equals( "RAT" ) ) {
return false;
}
if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT|function = 23445",
- TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
+ TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
+ .equals( "RAT" ) ) {
return false;
}
if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RATfunction = 23445",
.equals( "MOUSE" ) ) {
return false;
}
- if ( ParserUtils.extractTaxonomyCodeFromNodeName( "_MOUSE ", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
+ if ( ParserUtils.extractTaxonomyCodeFromNodeName( "_MOUSE ",
+ TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
return false;
}
}
private static boolean testFastaParser() {
try {
- if ( !FastaParser.isLikelyFasta( new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" ) ) ) {
+ final FileInputStream fis1 = new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" );
+ if ( !FastaParser.isLikelyFasta( fis1 ) ) {
+ fis1.close();
return false;
}
- if ( FastaParser.isLikelyFasta( new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" ) ) ) {
+ else {
+ fis1.close();
+ }
+ final FileInputStream fis2 = new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" );
+ if ( FastaParser.isLikelyFasta( fis2 ) ) {
+ fis2.close();
return false;
}
+ else {
+ fis2.close();
+ }
final Msa msa_0 = FastaParser.parseMsa( new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" ) );
if ( !msa_0.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "ACGTGKXFMFDMXEXXXSFMFMF" ) ) {
return false;
if ( !msa_0.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "DKXASDFXSFXFKFKSXDFKSLX" ) ) {
return false;
}
- if ( !msa_0.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "SXDFKSXLFSFPWEXPRXWXERR" ) ) {
+ if ( !msa_0.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "SXDFKSXLFSFPWEXPROWXERR" ) ) {
return false;
}
if ( !msa_0.getSequenceAsString( 3 ).toString().equalsIgnoreCase( "AAAAAAAAAAAAAAAAAAAAAAA" ) ) {
if ( !SequenceAccessionTools.parseGenbankAccessorFromString( ".AY423861.2" ).equals( "AY423861.2" ) ) {
return false;
}
- if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "345_.AY423861.24_345" ).equals( "AY423861.24" ) ) {
+ if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "345_.AY423861.24_345" )
+ .equals( "AY423861.24" ) ) {
return false;
}
if ( SequenceAccessionTools.parseGenbankAccessorFromString( "AAY423861" ) != null ) {
private static boolean testGeneralMsaParser() {
try {
final String msa_str_0 = "seq1 abcd\n\nseq2 efgh\n";
- final Msa msa_0 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_0.getBytes() ) );
+ final Msa msa_0 = GeneralMsaParser.parseMsa( new ByteArrayInputStream( msa_str_0.getBytes() ) );
final String msa_str_1 = "seq1 abc\nseq2 ghi\nseq1 def\nseq2 jkm\n";
- final Msa msa_1 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_1.getBytes() ) );
+ final Msa msa_1 = GeneralMsaParser.parseMsa( new ByteArrayInputStream( msa_str_1.getBytes() ) );
final String msa_str_2 = "seq1 abc\nseq2 ghi\n\ndef\njkm\n";
- final Msa msa_2 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_2.getBytes() ) );
+ final Msa msa_2 = GeneralMsaParser.parseMsa( new ByteArrayInputStream( msa_str_2.getBytes() ) );
final String msa_str_3 = "seq1 abc\n def\nseq2 ghi\n jkm\n";
- final Msa msa_3 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_3.getBytes() ) );
+ final Msa msa_3 = GeneralMsaParser.parseMsa( new ByteArrayInputStream( msa_str_3.getBytes() ) );
if ( !msa_1.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdef" ) ) {
return false;
}
if ( !msa_3.getIdentifier( 1 ).toString().equals( "seq2" ) ) {
return false;
}
- final Msa msa_4 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_1.txt" ) );
+ final Msa msa_4 = GeneralMsaParser.parseMsa( new FileInputStream( PATH_TO_TEST_DATA + "msa_1.txt" ) );
if ( !msa_4.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefeeeeeeeexx" ) ) {
return false;
}
if ( !msa_4.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxphhhhhhhhzz" ) ) {
return false;
}
- final Msa msa_5 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_2.txt" ) );
+ final Msa msa_5 = GeneralMsaParser.parseMsa( new FileInputStream( PATH_TO_TEST_DATA + "msa_2.txt" ) );
if ( !msa_5.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefxx" ) ) {
return false;
}
if ( !msa_5.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxpzz" ) ) {
return false;
}
- final Msa msa_6 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" ) );
+ final Msa msa_6 = GeneralMsaParser.parseMsa( new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" ) );
if ( !msa_6.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefeeeeeeeexx" ) ) {
return false;
}
if ( !rt.getName().equals( "r" ) ) {
return false;
}
- final Phylogeny p3 = factory
- .create( "((((a,(b,c)bc)abc,(d,e)de)abcde,f)abcdef,(((g,h)gh,(i,j)ij)ghij,k)ghijk,l)",
- new NHXParser() )[ 0 ];
+ final Phylogeny p3 = factory.create(
+ "((((a,(b,c)bc)abc,(d,e)de)abcde,f)abcdef,(((g,h)gh,(i,j)ij)ghij,k)ghijk,l)",
+ new NHXParser() )[ 0 ];
final PhylogenyNode bc_3 = PhylogenyMethods.calculateLCA( p3.getNode( "b" ), p3.getNode( "c" ) );
if ( !bc_3.getName().equals( "bc" ) ) {
return false;
if ( !rt.getName().equals( "r" ) ) {
return false;
}
- final Phylogeny p3 = factory
- .create( "((((a,(b,c)bc)abc,(d,e)de)abcde,f)abcdef,(((g,h)gh,(i,j)ij)ghij,k)ghijk,l)",
- new NHXParser() )[ 0 ];
+ final Phylogeny p3 = factory.create(
+ "((((a,(b,c)bc)abc,(d,e)de)abcde,f)abcdef,(((g,h)gh,(i,j)ij)ghij,k)ghijk,l)",
+ new NHXParser() )[ 0 ];
PhylogenyMethods.preOrderReId( p3 );
final PhylogenyNode bc_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "b" ),
p3.getNode( "c" ) );
final String test_dir = Test.PATH_TO_TEST_DATA;
try {
final HmmscanPerDomainTableParser parser1 = new HmmscanPerDomainTableParser( new File( test_dir
- + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_1" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE );
+ + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_1" ),
+ "MONBR",
+ INDIVIDUAL_SCORE_CUTOFF.NONE );
parser1.parse();
final HmmscanPerDomainTableParser parser2 = new HmmscanPerDomainTableParser( new File( test_dir
- + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_2" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE );
+ + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_2" ),
+ "MONBR",
+ INDIVIDUAL_SCORE_CUTOFF.NONE );
final List<Protein> proteins = parser2.parse();
if ( parser2.getProteinsEncountered() != 4 ) {
return false;
if ( !isEqual( t0.getNode( "E" ).getDistanceToParent(), 5 ) ) {
return false;
}
- if ( !isEqual( t0.getNode( "B" ).getDistanceToParent(), 4 ) ) {
+ if ( !isEqual( t0.getNode( "B" ).getDistanceToParent(), 4 ) ) {
+ return false;
+ }
+ if ( !isEqual( PhylogenyMethods.calculateLCA( t0.getNode( "F" ), t0.getNode( "G" ) ).getDistanceToParent(),
+ 1 ) ) {
+ return false;
+ }
+ final Phylogeny t1 = factory.create( "((A:1,B:2)AB:1[&&NHX:B=55],(C:3,D:4)CD:3[&&NHX:B=10])ABCD:0.5",
+ new NHXParser() )[ 0 ];
+ if ( !t1.isRooted() ) {
+ return false;
+ }
+ PhylogenyMethods.midpointRoot( t1 );
+ if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
+ return false;
+ }
+ if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
+ return false;
+ }
+ if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
+ return false;
+ }
+ if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) {
+ return false;
+ }
+ if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) {
+ return false;
+ }
+ if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) {
+ return false;
+ }
+ t1.reRoot( t1.getNode( "A" ) );
+ PhylogenyMethods.midpointRoot( t1 );
+ if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
+ return false;
+ }
+ if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
+ return false;
+ }
+ if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
+ return false;
+ }
+ if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) {
+ return false;
+ }
+ if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) {
+ System.exit( -1 );
+ return false;
+ }
+ if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) {
+ return false;
+ }
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace( System.out );
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testMsaQualityMethod() {
+ try {
+ final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "ABAXEFGHIJJE-" );
+ final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "ABBXEFGHIJJBB" );
+ final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "AXCXEFGHIJJ--" );
+ final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "AXDDEFGHIJ---" );
+ final List<MolecularSequence> l = new ArrayList<MolecularSequence>();
+ l.add( s0 );
+ l.add( s1 );
+ l.add( s2 );
+ l.add( s3 );
+ final Msa msa = BasicMsa.createInstance( l );
+ if ( !isEqual( 1, MsaMethods.calculateIdentityRatio( msa, 0 ) ) ) {
+ return false;
+ }
+ if ( !isEqual( 0.5, MsaMethods.calculateIdentityRatio( msa, 1 ) ) ) {
+ return false;
+ }
+ if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 2 ) ) ) {
+ return false;
+ }
+ if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 3 ) ) ) {
+ return false;
+ }
+ if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 10 ) ) ) {
+ return false;
+ }
+ if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 11 ) ) ) {
+ return false;
+ }
+ if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 12 ) ) ) {
+ return false;
+ }
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace( System.out );
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testMsaEntropy() {
+ try {
+ final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "AAAAAAA" );
+ final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "AAAIACC" );
+ final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "AAIIIIF" );
+ final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "AIIIVVW" );
+ final List<MolecularSequence> l = new ArrayList<MolecularSequence>();
+ l.add( s0 );
+ l.add( s1 );
+ l.add( s2 );
+ l.add( s3 );
+ final Msa msa = BasicMsa.createInstance( l );
+ //TODO need to DO the tests!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
+ //FIXME
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 0 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 1 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 2 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 3 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 4 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 5 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 6 ) );
+ // System.out.println();
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 0 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 1 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 2 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 3 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 4 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 5 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 6 ) );
+ final List<MolecularSequence> l2 = new ArrayList<MolecularSequence>();
+ l2.add( BasicSequence.createAaSequence( "1", "AAAAAAA" ) );
+ l2.add( BasicSequence.createAaSequence( "2", "AAAIACC" ) );
+ l2.add( BasicSequence.createAaSequence( "3", "AAIIIIF" ) );
+ l2.add( BasicSequence.createAaSequence( "4", "AIIIVVW" ) );
+ l2.add( BasicSequence.createAaSequence( "5", "AAAAAAA" ) );
+ l2.add( BasicSequence.createAaSequence( "6", "AAAIACC" ) );
+ l2.add( BasicSequence.createAaSequence( "7", "AAIIIIF" ) );
+ l2.add( BasicSequence.createAaSequence( "8", "AIIIVVW" ) );
+ l2.add( BasicSequence.createAaSequence( "9", "AAAAAAA" ) );
+ l2.add( BasicSequence.createAaSequence( "10", "AAAIACC" ) );
+ l2.add( BasicSequence.createAaSequence( "11", "AAIIIIF" ) );
+ l2.add( BasicSequence.createAaSequence( "12", "AIIIVVW" ) );
+ l2.add( BasicSequence.createAaSequence( "13", "AAIIIIF" ) );
+ l2.add( BasicSequence.createAaSequence( "14", "AIIIVVW" ) );
+ l2.add( BasicSequence.createAaSequence( "15", "AAAAAAA" ) );
+ l2.add( BasicSequence.createAaSequence( "16", "AAAIACC" ) );
+ l2.add( BasicSequence.createAaSequence( "17", "AAIIIIF" ) );
+ l2.add( BasicSequence.createAaSequence( "18", "AIIIVVW" ) );
+ l2.add( BasicSequence.createAaSequence( "19", "AAAAAAA" ) );
+ l2.add( BasicSequence.createAaSequence( "20", "AAAIACC" ) );
+ l2.add( BasicSequence.createAaSequence( "21", "AAIIIIF" ) );
+ l2.add( BasicSequence.createAaSequence( "22", "AIIIVVW" ) );
+ final Msa msa2 = BasicMsa.createInstance( l2 );
+ // System.out.println();
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 0 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 1 ) );
+ // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 2 ) );
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace( System.out );
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testDeleteableMsa() {
+ try {
+ final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "AAAA" );
+ final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "BAAA" );
+ final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "CAAA" );
+ final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "DAAA" );
+ final MolecularSequence s4 = BasicSequence.createAaSequence( "e", "EAAA" );
+ final MolecularSequence s5 = BasicSequence.createAaSequence( "f", "FAAA" );
+ final List<MolecularSequence> l0 = new ArrayList<MolecularSequence>();
+ l0.add( s0 );
+ l0.add( s1 );
+ l0.add( s2 );
+ l0.add( s3 );
+ l0.add( s4 );
+ l0.add( s5 );
+ final DeleteableMsa dmsa0 = DeleteableMsa.createInstance( l0 );
+ dmsa0.deleteRow( "b", false );
+ if ( !dmsa0.getIdentifier( 1 ).equals( "c" ) ) {
+ return false;
+ }
+ dmsa0.deleteRow( "e", false );
+ dmsa0.deleteRow( "a", false );
+ dmsa0.deleteRow( "f", false );
+ if ( dmsa0.getLength() != 4 ) {
return false;
}
- if ( !isEqual( PhylogenyMethods.calculateLCA( t0.getNode( "F" ), t0.getNode( "G" ) ).getDistanceToParent(),
- 1 ) ) {
+ if ( dmsa0.getNumberOfSequences() != 2 ) {
return false;
}
- final Phylogeny t1 = factory.create( "((A:1,B:2)AB:1[&&NHX:B=55],(C:3,D:4)CD:3[&&NHX:B=10])ABCD:0.5",
- new NHXParser() )[ 0 ];
- if ( !t1.isRooted() ) {
+ if ( !dmsa0.getIdentifier( 0 ).equals( "c" ) ) {
return false;
}
- PhylogenyMethods.midpointRoot( t1 );
- if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
+ if ( !dmsa0.getIdentifier( 1 ).equals( "d" ) ) {
return false;
}
- if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
+ if ( dmsa0.getResidueAt( 0, 0 ) != 'C' ) {
return false;
}
- if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
+ if ( !dmsa0.getSequenceAsString( 0 ).toString().equals( "CAAA" ) ) {
return false;
}
- if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) {
+ if ( dmsa0.getColumnAt( 0 ).size() != 2 ) {
return false;
}
- if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) {
+ dmsa0.deleteRow( "c", false );
+ dmsa0.deleteRow( "d", false );
+ if ( dmsa0.getNumberOfSequences() != 0 ) {
return false;
}
- if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) {
+ //
+ final MolecularSequence s_0 = BasicSequence.createAaSequence( "a", "--A---B-C--X----" );
+ final MolecularSequence s_1 = BasicSequence.createAaSequence( "b", "--B-----C-------" );
+ final MolecularSequence s_2 = BasicSequence.createAaSequence( "c", "--C--AB-C------Z" );
+ final MolecularSequence s_3 = BasicSequence.createAaSequence( "d", "--D--AA-C-------" );
+ final MolecularSequence s_4 = BasicSequence.createAaSequence( "e", "--E--AA-C-------" );
+ final MolecularSequence s_5 = BasicSequence.createAaSequence( "f", "--F--AB-CD--Y---" );
+ final List<MolecularSequence> l1 = new ArrayList<MolecularSequence>();
+ l1.add( s_0 );
+ l1.add( s_1 );
+ l1.add( s_2 );
+ l1.add( s_3 );
+ l1.add( s_4 );
+ l1.add( s_5 );
+ final DeleteableMsa dmsa1 = DeleteableMsa.createInstance( l1 );
+ dmsa1.deleteGapOnlyColumns();
+ dmsa1.deleteRow( "a", false );
+ dmsa1.deleteRow( "f", false );
+ dmsa1.deleteRow( "d", false );
+ dmsa1.deleteGapOnlyColumns();
+ if ( !dmsa1.getSequenceAsString( 0 ).toString().equals( "B--C-" ) ) {
return false;
}
- t1.reRoot( t1.getNode( "A" ) );
- PhylogenyMethods.midpointRoot( t1 );
- if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
+ if ( !dmsa1.getSequenceAsString( 1 ).toString().equals( "CABCZ" ) ) {
return false;
}
- if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
+ if ( !dmsa1.getSequenceAsString( 2 ).toString().equals( "EAAC-" ) ) {
return false;
}
- if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
+ dmsa1.deleteRow( "c", false );
+ dmsa1.deleteGapOnlyColumns();
+ final Writer w0 = new StringWriter();
+ dmsa1.write( w0, MSA_FORMAT.FASTA );
+ final Writer w1 = new StringWriter();
+ dmsa1.write( w1, MSA_FORMAT.PHYLIP );
+ if ( !dmsa1.getSequenceAsString( 0 ).toString().equals( "B--C" ) ) {
return false;
}
- if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) {
+ if ( !dmsa1.getSequenceAsString( 1 ).toString().equals( "EAAC" ) ) {
return false;
}
- if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) {
- System.exit( -1 );
+ final MolecularSequence s__0 = BasicSequence.createAaSequence( "a", "A------" );
+ final MolecularSequence s__1 = BasicSequence.createAaSequence( "b", "BB-----" );
+ final MolecularSequence s__2 = BasicSequence.createAaSequence( "c", "CCC----" );
+ final MolecularSequence s__3 = BasicSequence.createAaSequence( "d", "DDDD---" );
+ final MolecularSequence s__4 = BasicSequence.createAaSequence( "e", "EEEEE--" );
+ final MolecularSequence s__5 = BasicSequence.createAaSequence( "f", "FFFFFF-" );
+ final List<MolecularSequence> l2 = new ArrayList<MolecularSequence>();
+ l2.add( s__0 );
+ l2.add( s__1 );
+ l2.add( s__2 );
+ l2.add( s__3 );
+ l2.add( s__4 );
+ l2.add( s__5 );
+ final DeleteableMsa dmsa2 = DeleteableMsa.createInstance( l2 );
+ dmsa2.deleteGapColumns( 0.5 );
+ if ( !dmsa2.getSequenceAsString( 0 ).toString().equals( "A---" ) ) {
return false;
}
- if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) {
+ if ( !dmsa2.getSequenceAsString( 1 ).toString().equals( "BB--" ) ) {
return false;
}
- }
- catch ( final Exception e ) {
- e.printStackTrace( System.out );
- return false;
- }
- return true;
- }
-
- private static boolean testMsaQualityMethod() {
- try {
- final Sequence s0 = BasicSequence.createAaSequence( "a", "ABAXEFGHIJJE-" );
- final Sequence s1 = BasicSequence.createAaSequence( "b", "ABBXEFGHIJJBB" );
- final Sequence s2 = BasicSequence.createAaSequence( "c", "AXCXEFGHIJJ--" );
- final Sequence s3 = BasicSequence.createAaSequence( "d", "AXDDEFGHIJ---" );
- final List<Sequence> l = new ArrayList<Sequence>();
- l.add( s0 );
- l.add( s1 );
- l.add( s2 );
- l.add( s3 );
- final Msa msa = BasicMsa.createInstance( l );
- if ( !isEqual( 1, MsaMethods.calculateIdentityRatio( msa, 0 ) ) ) {
+ if ( !dmsa2.getSequenceAsString( 2 ).toString().equals( "CCC-" ) ) {
return false;
}
- if ( !isEqual( 0.5, MsaMethods.calculateIdentityRatio( msa, 1 ) ) ) {
+ dmsa2.deleteGapColumns( 0.2 );
+ if ( !dmsa2.getSequenceAsString( 0 ).toString().equals( "A-" ) ) {
return false;
}
- if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 2 ) ) ) {
+ if ( !dmsa2.getSequenceAsString( 1 ).toString().equals( "BB" ) ) {
return false;
}
- if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 3 ) ) ) {
+ if ( !dmsa2.getSequenceAsString( 2 ).toString().equals( "CC" ) ) {
return false;
}
- if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 10 ) ) ) {
+ dmsa2.deleteGapColumns( 0 );
+ dmsa2.deleteRow( "a", false );
+ dmsa2.deleteRow( "b", false );
+ dmsa2.deleteRow( "f", false );
+ dmsa2.deleteRow( "e", false );
+ dmsa2.setIdentifier( 0, "new_c" );
+ dmsa2.setIdentifier( 1, "new_d" );
+ dmsa2.setResidueAt( 0, 0, 'x' );
+ final MolecularSequence s = dmsa2.deleteRow( "new_d", true );
+ if ( !s.getMolecularSequenceAsString().equals( "D" ) ) {
return false;
}
- if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 11 ) ) ) {
+ final Writer w = new StringWriter();
+ dmsa2.write( w, MSA_FORMAT.PHYLIP );
+ final String phylip = w.toString();
+ if ( !phylip.equals( "1 1" + ForesterUtil.LINE_SEPARATOR + "new_c x" + ForesterUtil.LINE_SEPARATOR ) ) {
+ System.out.println( phylip );
return false;
}
- if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 12 ) ) ) {
+ final Writer w2 = new StringWriter();
+ dmsa2.write( w2, MSA_FORMAT.FASTA );
+ final String fasta = w2.toString();
+ if ( !fasta.equals( ">new_c" + ForesterUtil.LINE_SEPARATOR + "x" + ForesterUtil.LINE_SEPARATOR ) ) {
+ System.out.println( fasta );
return false;
}
}
PhylogenyNode n;
List<PhylogenyNode> ext = new ArrayList<PhylogenyNode>();
final StringBuffer sb0 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
- final Phylogeny t0 = factory.create( sb0, new NHXParser() )[ 0 ];
+ final Phylogeny t0 = factory.create( sb0.toString(), new NHXParser() )[ 0 ];
t0.getNode( "cd" ).setCollapse( true );
t0.getNode( "cde" ).setCollapse( true );
n = t0.getFirstExternalNode();
}
ext.clear();
final StringBuffer sb1 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
- final Phylogeny t1 = factory.create( sb1, new NHXParser() )[ 0 ];
+ final Phylogeny t1 = factory.create( sb1.toString(), new NHXParser() )[ 0 ];
t1.getNode( "ab" ).setCollapse( true );
t1.getNode( "cd" ).setCollapse( true );
t1.getNode( "cde" ).setCollapse( true );
if ( !ext.get( 4 ).getName().equals( "h" ) ) {
return false;
}
- //
- //
ext.clear();
final StringBuffer sb2 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
- final Phylogeny t2 = factory.create( sb2, new NHXParser() )[ 0 ];
+ final Phylogeny t2 = factory.create( sb2.toString(), new NHXParser() )[ 0 ];
t2.getNode( "ab" ).setCollapse( true );
t2.getNode( "cd" ).setCollapse( true );
t2.getNode( "cde" ).setCollapse( true );
if ( !ext.get( 3 ).getName().equals( "gh" ) ) {
return false;
}
- //
- //
ext.clear();
final StringBuffer sb3 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
- final Phylogeny t3 = factory.create( sb3, new NHXParser() )[ 0 ];
+ final Phylogeny t3 = factory.create( sb3.toString(), new NHXParser() )[ 0 ];
t3.getNode( "ab" ).setCollapse( true );
t3.getNode( "cd" ).setCollapse( true );
t3.getNode( "cde" ).setCollapse( true );
if ( !ext.get( 2 ).getName().equals( "fgh" ) ) {
return false;
}
- //
- //
ext.clear();
final StringBuffer sb4 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
- final Phylogeny t4 = factory.create( sb4, new NHXParser() )[ 0 ];
+ final Phylogeny t4 = factory.create( sb4.toString(), new NHXParser() )[ 0 ];
t4.getNode( "ab" ).setCollapse( true );
t4.getNode( "cd" ).setCollapse( true );
t4.getNode( "cde" ).setCollapse( true );
if ( n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes() != null ) {
return false;
}
- //
- //
final StringBuffer sb5 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
- final Phylogeny t5 = factory.create( sb5, new NHXParser() )[ 0 ];
+ final Phylogeny t5 = factory.create( sb5.toString(), new NHXParser() )[ 0 ];
ext.clear();
n = t5.getFirstExternalNode();
while ( n != null ) {
if ( !ext.get( 7 ).getName().equals( "h" ) ) {
return false;
}
- //
- //
final StringBuffer sb6 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
- final Phylogeny t6 = factory.create( sb6, new NHXParser() )[ 0 ];
+ final Phylogeny t6 = factory.create( sb6.toString(), new NHXParser() )[ 0 ];
ext.clear();
t6.getNode( "ab" ).setCollapse( true );
n = t6.getNode( "ab" );
if ( !ext.get( 6 ).getName().equals( "h" ) ) {
return false;
}
- //
- //
final StringBuffer sb7 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
- final Phylogeny t7 = factory.create( sb7, new NHXParser() )[ 0 ];
+ final Phylogeny t7 = factory.create( sb7.toString(), new NHXParser() )[ 0 ];
ext.clear();
t7.getNode( "cd" ).setCollapse( true );
n = t7.getNode( "a" );
if ( !ext.get( 6 ).getName().equals( "h" ) ) {
return false;
}
- //
- //
final StringBuffer sb8 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
- final Phylogeny t8 = factory.create( sb8, new NHXParser() )[ 0 ];
+ final Phylogeny t8 = factory.create( sb8.toString(), new NHXParser() )[ 0 ];
ext.clear();
t8.getNode( "cd" ).setCollapse( true );
t8.getNode( "c" ).setCollapse( true );
if ( !ext.get( 6 ).getName().equals( "h" ) ) {
return false;
}
- //
- //
final StringBuffer sb9 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
- final Phylogeny t9 = factory.create( sb9, new NHXParser() )[ 0 ];
+ final Phylogeny t9 = factory.create( sb9.toString(), new NHXParser() )[ 0 ];
ext.clear();
t9.getNode( "gh" ).setCollapse( true );
n = t9.getNode( "a" );
if ( !ext.get( 6 ).getName().equals( "gh" ) ) {
return false;
}
- //
- //
final StringBuffer sb10 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
- final Phylogeny t10 = factory.create( sb10, new NHXParser() )[ 0 ];
+ final Phylogeny t10 = factory.create( sb10.toString(), new NHXParser() )[ 0 ];
ext.clear();
t10.getNode( "gh" ).setCollapse( true );
t10.getNode( "g" ).setCollapse( true );
if ( !ext.get( 6 ).getName().equals( "gh" ) ) {
return false;
}
- //
- //
final StringBuffer sb11 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
- final Phylogeny t11 = factory.create( sb11, new NHXParser() )[ 0 ];
+ final Phylogeny t11 = factory.create( sb11.toString(), new NHXParser() )[ 0 ];
ext.clear();
t11.getNode( "gh" ).setCollapse( true );
t11.getNode( "fgh" ).setCollapse( true );
if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
return false;
}
- //
- //
final StringBuffer sb12 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
- final Phylogeny t12 = factory.create( sb12, new NHXParser() )[ 0 ];
+ final Phylogeny t12 = factory.create( sb12.toString(), new NHXParser() )[ 0 ];
ext.clear();
t12.getNode( "gh" ).setCollapse( true );
t12.getNode( "fgh" ).setCollapse( true );
if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
return false;
}
- //
- //
final StringBuffer sb13 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
- final Phylogeny t13 = factory.create( sb13, new NHXParser() )[ 0 ];
+ final Phylogeny t13 = factory.create( sb13.toString(), new NHXParser() )[ 0 ];
ext.clear();
t13.getNode( "ab" ).setCollapse( true );
t13.getNode( "b" ).setCollapse( true );
if ( !ext.get( 4 ).getName().equals( "fgh" ) ) {
return false;
}
- //
- //
final StringBuffer sb14 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
- final Phylogeny t14 = factory.create( sb14, new NHXParser() )[ 0 ];
+ final Phylogeny t14 = factory.create( sb14.toString(), new NHXParser() )[ 0 ];
ext.clear();
t14.getNode( "ab" ).setCollapse( true );
t14.getNode( "a" ).setCollapse( true );
if ( !ext.get( 4 ).getName().equals( "fgh" ) ) {
return false;
}
- //
- //
final StringBuffer sb15 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
- final Phylogeny t15 = factory.create( sb15, new NHXParser() )[ 0 ];
+ final Phylogeny t15 = factory.create( sb15.toString(), new NHXParser() )[ 0 ];
ext.clear();
t15.getNode( "ab" ).setCollapse( true );
t15.getNode( "a" ).setCollapse( true );
//
//
final StringBuffer sb16 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
- final Phylogeny t16 = factory.create( sb16, new NHXParser() )[ 0 ];
+ final Phylogeny t16 = factory.create( sb16.toString(), new NHXParser() )[ 0 ];
ext.clear();
t16.getNode( "ab" ).setCollapse( true );
t16.getNode( "a" ).setCollapse( true );
if ( phylogenies.length != 9 ) {
return false;
}
- if ( !isEqual( 0.48039661496919533, phylogenies[ 0 ].getNode( "Diadocidia_spinosula" )
- .getDistanceToParent() ) ) {
+ if ( !isEqual( 0.48039661496919533,
+ phylogenies[ 0 ].getNode( "Diadocidia_spinosula" ).getDistanceToParent() ) ) {
return false;
}
- if ( !isEqual( 0.3959796191512233, phylogenies[ 0 ].getNode( "Diadocidia_stanfordensis" )
- .getDistanceToParent() ) ) {
+ if ( !isEqual( 0.3959796191512233,
+ phylogenies[ 0 ].getNode( "Diadocidia_stanfordensis" ).getDistanceToParent() ) ) {
return false;
}
if ( !phylogenies[ 0 ].getName().equals( "Family Diadocidiidae MLT (Imported_tree_0)" ) ) {
if ( phy != null ) {
return false;
}
- //
p.reset();
if ( !p.hasNext() ) {
return false;
if ( phy != null ) {
return false;
}
- ////
p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_2.nex" );
if ( !p.hasNext() ) {
return false;
if ( phy != null ) {
return false;
}
- //
p.reset();
if ( !p.hasNext() ) {
return false;
if ( phy != null ) {
return false;
}
- //
p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_3.nex" );
if ( !p.hasNext() ) {
return false;
System.out.println( phy.getNumberOfExternalNodes() );
return false;
}
- if ( !phy
- .toNewHampshire()
+ if ( !phy.toNewHampshire()
.equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
System.out.println( phy.toNewHampshire() );
return false;
System.out.println( phy.getNumberOfExternalNodes() );
return false;
}
- if ( !phy
- .toNewHampshire()
+ if ( !phy.toNewHampshire()
.equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
System.out.println( phy.toNewHampshire() );
return false;
System.out.println( phy.getNumberOfExternalNodes() );
return false;
}
- if ( !phy
- .toNewHampshire()
+ if ( !phy.toNewHampshire()
.equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
System.out.println( phy.toNewHampshire() );
return false;
System.out.println( phy.getNumberOfExternalNodes() );
return false;
}
- if ( !phy
- .toNewHampshire()
+ if ( !phy.toNewHampshire()
.equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
System.out.println( phy.toNewHampshire() );
return false;
.equals( "Aranaeus" ) ) {
return false;
}
+ phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "S14117.nex", parser );
+ if ( phylogenies.length != 3 ) {
+ return false;
+ }
+ if ( !isEqual( phylogenies[ 2 ].getNode( "Aloysia lycioides 251-76-02169" ).getDistanceToParent(),
+ 0.00100049 ) ) {
+ return false;
+ }
}
catch ( final Exception e ) {
e.printStackTrace( System.out );
nhxp.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO );
nhxp.setReplaceUnderscores( true );
final Phylogeny uc0 = factory.create( "(A__A_,_B_B)", nhxp )[ 0 ];
- if ( !uc0.getRoot().getChildNode( 0 ).getName().equals( "A A " ) ) {
+ if ( !uc0.getRoot().getChildNode( 0 ).getName().equals( "A A" ) ) {
return false;
}
- if ( !uc0.getRoot().getChildNode( 1 ).getName().equals( " B B" ) ) {
+ if ( !uc0.getRoot().getChildNode( 1 ).getName().equals( "B B" ) ) {
return false;
}
- final Phylogeny p1b = factory
- .create( " \n \t \b \r \f ; ( \n \t \b \r \f; A ; \n \t \b \r \f, \n \t \b \r \f; B ; \n \t \b \r \f 1 \n \t \b \r \f ; \n \t \b \r \f );;;;; \n \t \b \r \f;;; \n \t \b \r \f ",
- new NHXParser() )[ 0 ];
+ final Phylogeny p1b = factory.create(
+ " \n \t \b \r \f ; ( \n \t \b \r \f; A ; \n \t \b \r \f, \n \t \b \r \f; B ; \n \t \b \r \f 1 \n \t \b \r \f ; \n \t \b \r \f );;;;; \n \t \b \r \f;;; \n \t \b \r \f ",
+ new NHXParser() )[ 0 ];
if ( !p1b.toNewHampshireX().equals( "(';A;',';B;1;')" ) ) {
return false;
}
if ( !p1b.toNewHampshire().equals( "(';A;',';B;1;');" ) ) {
return false;
}
- final Phylogeny p2 = factory.create( new StringBuffer( "(A,B2)" ), new NHXParser() )[ 0 ];
+ final Phylogeny p2 = factory.create( new StringBuffer( "(A,B2)" ).toString(), new NHXParser() )[ 0 ];
final Phylogeny p3 = factory.create( new char[] { '(', 'A', ',', 'B', '3', ')' }, new NHXParser() )[ 0 ];
final Phylogeny p4 = factory.create( "(A,B4);", new NHXParser() )[ 0 ];
- final Phylogeny p5 = factory.create( new StringBuffer( "(A,B5);" ), new NHXParser() )[ 0 ];
+ final Phylogeny p5 = factory.create( new StringBuffer( "(A,B5);" ).toString(), new NHXParser() )[ 0 ];
final Phylogeny[] p7 = factory.create( "(A,B7);(C,D7)", new NHXParser() );
final Phylogeny[] p8 = factory.create( "(A,B8) (C,D8)", new NHXParser() );
final Phylogeny[] p9 = factory.create( "(A,B9)\n(C,D9)", new NHXParser() );
final Phylogeny[] p11 = factory.create( "(A,B11);(C,D11) (E,F11)\t(G,H11)", new NHXParser() );
final Phylogeny[] p12 = factory.create( "(A,B12) (C,D12) (E,F12) (G,H12)", new NHXParser() );
final Phylogeny[] p13 = factory.create( " ; (;A; , ; B ; 1 3 ; \n)\t ( \n ;"
- + " C ; ,; D;13;);;;;;;(;E;,;F;13 ;) ; "
- + "; ; ( \t\n\r\b; G ;, ;H ;1 3; ) ; ; ;",
+ + " C ; ,; D;13;);;;;;;(;E;,;F;13 ;) ; " + "; ; ( \t\n\r\b; G ;, ;H ;1 3; ) ; ; ;",
new NHXParser() );
if ( !p13[ 0 ].toNewHampshireX().equals( "(';A;',';B;13;')" ) ) {
return false;
if ( p46.length != 0 ) {
return false;
}
- final Phylogeny p47 = factory.create( new StringBuffer( "((A,B)ab:2[0.44],C)" ), new NHXParser() )[ 0 ];
+ final Phylogeny p47 = factory.create( new StringBuffer( "((A,B)ab:2[0.44],C)" ).toString(),
+ new NHXParser() )[ 0 ];
if ( !isEqual( 0.44, p47.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
return false;
}
- final Phylogeny p48 = factory.create( new StringBuffer( "((A,B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
+ final Phylogeny p48 = factory.create( new StringBuffer( "((A,B)ab:2[88],C)" ).toString(),
+ new NHXParser() )[ 0 ];
if ( !isEqual( 88, p48.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
return false;
}
final Phylogeny p49 = factory
- .create( new StringBuffer( "((A,B)a[comment:a,b;(a)]b:2[0.44][comment(a,b,b);],C)" ),
+ .create( new StringBuffer( "((A,B)a[comment:a,b;(a)]b:2[0.44][comment(a,b,b);],C)" ).toString(),
new NHXParser() )[ 0 ];
if ( !isEqual( 0.44, p49.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
return false;
}
- final Phylogeny p50 = factory.create( new StringBuffer( "((\"A\",B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
+ final Phylogeny p50 = factory.create( new StringBuffer( "((\"A\",B)ab:2[88],C)" ).toString(),
+ new NHXParser() )[ 0 ];
if ( p50.getNode( "A" ) == null ) {
return false;
}
- if ( !p50.toNewHampshire( false, NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
+ if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
.equals( "((A,B)ab:2.0[88],C);" ) ) {
return false;
}
- if ( !p50.toNewHampshire( false, NH_CONVERSION_SUPPORT_VALUE_STYLE.NONE ).equals( "((A,B)ab:2.0,C);" ) ) {
+ if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.NONE ).equals( "((A,B)ab:2.0,C);" ) ) {
return false;
}
- if ( !p50.toNewHampshire( false, NH_CONVERSION_SUPPORT_VALUE_STYLE.AS_INTERNAL_NODE_NAMES )
+ if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.AS_INTERNAL_NODE_NAMES )
.equals( "((A,B)88:2.0,C);" ) ) {
return false;
}
- final Phylogeny p51 = factory.create( new StringBuffer( "((\"A(A\",B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
+ final Phylogeny p51 = factory.create( new StringBuffer( "((\"A(A\",B)ab:2[88],C)" ).toString(),
+ new NHXParser() )[ 0 ];
if ( p51.getNode( "A(A" ) == null ) {
return false;
}
- final Phylogeny p52 = factory.create( new StringBuffer( "(('A(A',B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
+ final Phylogeny p52 = factory.create( new StringBuffer( "(('A(A',B)ab:2[88],C)" ).toString(),
+ new NHXParser() )[ 0 ];
if ( p52.getNode( "A(A" ) == null ) {
return false;
}
final Phylogeny p53 = factory
- .create( new StringBuffer( "(('A(A',\"B (x (a' ,b) f(x);\"[com])[ment]ab:2[88],C)" ),
+ .create( new StringBuffer( "(('A(A',\"B (x (a' ,b) f(x);\"[com])[ment]ab:2[88],C)" ).toString(),
new NHXParser() )[ 0 ];
if ( p53.getNode( "B (x (a' ,b) f(x);" ) == null ) {
return false;
}
- //
- final Phylogeny p54 = factory.create( new StringBuffer( "((A,B):[88],C)" ), new NHXParser() )[ 0 ];
+ final Phylogeny p54 = factory.create( new StringBuffer( "((A,B):[88],C)" ).toString(),
+ new NHXParser() )[ 0 ];
if ( p54.getNode( "A" ) == null ) {
return false;
}
- if ( !p54.toNewHampshire( false, NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
+ if ( !p54.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
.equals( "((A,B)[88],C);" ) ) {
return false;
}
+ final Phylogeny p55 = factory
+ .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1x\":0.0798012);" )
+ .toString(), new NHXParser() )[ 0 ];
+ if ( !p55.toNewHampshire()
+ .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,lcl|HPV66_L1.1x:0.0798012);" ) ) {
+ System.out.println( p55.toNewHampshire() );
+ return false;
+ }
+ final Phylogeny p56 = factory
+ .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" )
+ .toString(), new NHXParser() )[ 0 ];
+ if ( !p56.toNewHampshire()
+ .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,'lcl|HPV66_L1.1:x':0.0798012);" ) ) {
+ System.out.println( p56.toNewHampshire() );
+ return false;
+ }
+ final Phylogeny p57 = factory
+ .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" )
+ .toString(), new NHXParser() )[ 0 ];
+ if ( !p57.toNewHampshire()
+ .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,'lcl|HPV66_L1.1:x':0.0798012);" ) ) {
+ System.out.println( p56.toNewHampshire() );
+ return false;
+ }
+ final String s58 = "('Homo \"man\" sapiens:1',\"Homo 'man' sapiens;\")';root \"1_ )';";
+ final Phylogeny p58 = factory.create( s58, new NHXParser() )[ 0 ];
+ if ( !p58.toNewHampshire().equals( s58 ) ) {
+ System.out.println( p58.toNewHampshire() );
+ return false;
+ }
+ final String s59 = "('Homo \"man sapiens:1',\"Homo 'man sapiens\")\"root; '1_ )\";";
+ final Phylogeny p59 = factory.create( s59, new NHXParser() )[ 0 ];
+ if ( !p59.toNewHampshire().equals( s59 ) ) {
+ System.out.println( p59.toNewHampshire() );
+ return false;
+ }
+ final String s60 = "('\" ;,:\":\"',\"'abc def' g's_\",'=:0.45+,.:%~`!@#$%^&*()_-+={} | ;,');";
+ final Phylogeny p60 = factory.create( s60, new NHXParser() )[ 0 ];
+ if ( !p60.toNewHampshire().equals( s60 ) ) {
+ System.out.println( p60.toNewHampshire() );
+ return false;
+ }
+ final String s61 = "('H[omo] \"man\" sapiens:1',\"H[omo] 'man' sapiens;\",H[omo] sapiens)';root \"1_ )';";
+ final Phylogeny p61 = factory.create( s61, new NHXParser() )[ 0 ];
+ if ( !p61.toNewHampshire()
+ .equals( "('H{omo} \"man\" sapiens:1',\"H{omo} 'man' sapiens;\",Hsapiens)';root \"1_ )';" ) ) {
+ System.out.println( p61.toNewHampshire() );
+ return false;
+ }
+ final String s62 = "(1[&type=\"X\",size=123,subtree=(1,2);]:0.003,2[&type=\"(X,Y:3)\"]:0.004)[&type=\"(X,Y)\"]:0.0;";
+ final Phylogeny p62 = factory.create( s62, new NHXParser() )[ 0 ];
+ if ( !p62.toNewHampshire().equals( "(1:0.003,2:0.004):0.0;" ) ) {
+ System.out.println( p62.toNewHampshire() );
+ return false;
+ }
+ final String s63 = "(1:0.003[&type=\"X\",size=123,subtree=(1,2);],2:0.004[&type=\"(X,Y:3)\"]):0.0[&type=\"(X,Y)\"];";
+ final Phylogeny p63 = factory.create( s63, new NHXParser() )[ 0 ];
+ if ( !p63.toNewHampshire().equals( "(1:0.003,2:0.004):0.0;" ) ) {
+ System.out.println( p63.toNewHampshire() );
+ return false;
+ }
+ final String s64 = "((1,2):[95.5],3);";
+ final Phylogeny p64 = factory.create( s64, new NHXParser() )[ 0 ];
+ if ( !p64.toNewHampshireX().equals( "((1,2)[&&NHX:B=95.5],3)" ) ) {
+ System.out.println( p64.toNewHampshireX() );
+ return false;
+ }
+ final String s65 = "((1:0.1,2:0.2):0.3[10.2],3);";
+ final Phylogeny p65 = factory.create( s65, new NHXParser() )[ 0 ];
+ if ( !p65.toNewHampshireX().equals( "((1:0.1,2:0.2):0.3[&&NHX:B=10.2],3)" ) ) {
+ System.out.println( p65.toNewHampshireX() );
+ return false;
+ }
+ final Phylogeny p66 = factory.create( "((A,B)ab:2[0.44],C)", new NHXParser() )[ 0 ];
+ if ( !isEqual( 0.44, p66.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
+ return false;
+ }
+ final Phylogeny p67 = factory.create( "((A,B):2[0.67],C)", new NHXParser() )[ 0 ];
+ if ( !isEqual( 0.67, p67.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() ) ) {
+ return false;
+ }
+ final Phylogeny p68 = factory.create( "((A,B):[0.68],C)", new NHXParser() )[ 0 ];
+ if ( !isEqual( 0.68, p68.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() ) ) {
+ return false;
+ }
+ final Phylogeny p69 = factory.create( "((A,B)[0.69],C)", new NHXParser() )[ 0 ];
+ if ( !isEqual( 0.69, p69.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() ) ) {
+ return false;
+ }
+ final Phylogeny p70 = factory.create( "((A,B)[+0.7],C)", new NHXParser() )[ 0 ];
+ if ( !isEqual( 0.7, p70.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() ) ) {
+ return false;
+ }
+ final Phylogeny p71 = factory.create( "((A,B)[-0.71],C)", new NHXParser() )[ 0 ];
+ if ( !isEqual( -0.71, p71.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() ) ) {
+ return false;
+ }
+ final Phylogeny p72 = factory.create( "((A,B)[],C)", new NHXParser() )[ 0 ];
+ if ( !p72.toNewHampshireX().equals( "((A,B),C)" ) ) {
+ return false;
+ }
+ final Phylogeny p73 = factory.create( "((A,B)[12x],C)", new NHXParser() )[ 0 ];
+ if ( !p73.toNewHampshireX().equals( "((A,B),C)" ) ) {
+ return false;
+ }
+ final Phylogeny p74 = factory.create( "((A,B)[12+],C)", new NHXParser() )[ 0 ];
+ if ( !p74.toNewHampshireX().equals( "((A,B),C)" ) ) {
+ return false;
+ }
+ final Phylogeny p75 = factory.create( "((A,B)ab[222]:3,C)", new NHXParser() )[ 0 ];
+ if ( !isEqual( 222, p75.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() ) ) {
+ return false;
+ }
+ final Phylogeny p76 = factory.create( "((A,B)[100]:12,C)", new NHXParser() )[ 0 ];
+ if ( !isEqual( 100, p76.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() ) ) {
+ return false;
+ }
+ final Phylogeny p77 = factory.create( "((A,B)abcde:13[77],C)", new NHXParser() )[ 0 ];
+ if ( !isEqual( 77, p77.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() ) ) {
+ return false;
+ }
+ final Phylogeny p78 = factory.create( "((A,B):14[0],C)", new NHXParser() )[ 0 ];
+ if ( !isEqual( 0, p78.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() ) ) {
+ return false;
+ }
+ final String the_one = "((((((a,b)ab:3.0[2],c):12.0[100],(d,e)de)abcde:13.0[2],f):14.0[0]):0.0[0]):0.0[0];";
+ final Phylogeny p79 = factory.create(
+ "((((((a,b)ab[2]:3,c)[100]:12,(d,e)de)abcde:13[2],f):14[0]):0[0])[0]:0;",
+ new NHXParser() )[ 0 ];
+ final String str79 = p79.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS );
+ if ( !str79.equals( the_one ) ) {
+ System.out.println( str79 );
+ return false;
+ }
+ final Phylogeny p80 = factory.create(
+ "((((((a[a)],b[12])ab[2]:3,c)[+100]:12,(d,e)de[12d,)])ab[]c[]de:13[2],f):14[0]):0[0])[0]:0;",
+ new NHXParser() )[ 0 ];
+ final String str80 = p80.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS );
+ if ( !str80.equals( the_one ) ) {
+ System.out.println( str80 );
+ return false;
+ }
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace( System.out );
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testNHParsingSpecialChars() {
+ try {
+ final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
+ final String i0 = "(A!+=~QWERTY!@#$%^&*-,€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜˜˜™š›œžŸ¡¢£¤¥¦§¨©ª«¬®¯°±¹²³´µ¶·¸º»¼¿À÷þÿ)";
+ final Phylogeny p0 = factory.create( i0, new NHXParser() )[ 0 ];
+ if ( !p0.toNewHampshireX().equals( i0 ) ) {
+ System.out.println();
+ System.out.println( p0.toNewHampshireX() );
+ System.out.println( i0 );
+ return false;
+ }
+ final String i1 = "(हिंदी,한글,ไทย,'Tiếng Việt',ひらがなカタカナ漢字,繁體字,русский)";
+ final Phylogeny p1 = factory.create( i1, new NHXParser() )[ 0 ];
+ if ( !p1.toNewHampshireX().equals( i1 ) ) {
+ System.out.println();
+ System.out.println( p1.toNewHampshireX() );
+ System.out.println( i1 );
+ return false;
+ }
}
catch ( final Exception e ) {
e.printStackTrace( System.out );
System.out.println( n6.toNewHampshireX() );
return false;
}
+ final PhylogenyNode n7 = new PhylogenyNode();
+ n7.setName( " gks:dr-m4 \" ' `@:[]sadq04 " );
+ if ( !n7.toNewHampshire( true, PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
+ .equals( "'gks:dr-m4 \" ` `@:[]sadq04'" ) ) {
+ System.out.println( n7
+ .toNewHampshire( true, PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ) );
+ return false;
+ }
}
catch ( final Exception e ) {
e.printStackTrace( System.out );
return false;
}
final PhylogenyNode n19 = PhylogenyNode
- .createInstanceFromNhxString( "BLAH_1-roejojoej", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ .createInstanceFromNhxString( "BLAH_1-roejojoej",
+ NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
if ( !n19.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1" ) ) {
return false;
}
if ( !n30.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1234567" ) ) {
return false;
}
- if ( !n30.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
+ if ( !n30.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
+ return false;
+ }
+ final PhylogenyNode n31 = PhylogenyNode
+ .createInstanceFromNhxString( "BLAH_12345678-roejojoej",
+ NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ if ( n31.getNodeData().isHasTaxonomy() ) {
+ return false;
+ }
+ final PhylogenyNode n32 = PhylogenyNode
+ .createInstanceFromNhxString( "sd_12345678", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ if ( n32.getNodeData().isHasTaxonomy() ) {
+ return false;
+ }
+ final PhylogenyNode n40 = PhylogenyNode
+ .createInstanceFromNhxString( "BCL2_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ if ( !n40.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
+ return false;
+ }
+ final PhylogenyNode n41 = PhylogenyNode
+ .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ if ( n41.getNodeData().isHasTaxonomy() ) {
+ return false;
+ }
+ final PhylogenyNode n42 = PhylogenyNode
+ .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
+ if ( n42.getNodeData().isHasTaxonomy() ) {
+ return false;
+ }
+ final PhylogenyNode n43 = PhylogenyNode.createInstanceFromNhxString( "12345",
+ NHXParser.TAXONOMY_EXTRACTION.NO );
+ if ( n43.getNodeData().isHasTaxonomy() ) {
+ return false;
+ }
+ final PhylogenyNode n44 = PhylogenyNode
+ .createInstanceFromNhxString( "12345~1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ if ( n44.getNodeData().isHasTaxonomy() ) {
+ return false;
+ }
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace( System.out );
+ return false;
+ }
+ return true;
+ }
+
+ private static boolean testNHXNodeParsing2() {
+ try {
+ final PhylogenyNode n0_0 = PhylogenyNode.createInstanceFromNhxString( "n0:[ignore me 123]:1E-3",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n0_0.getName().equals( "n0" ) ) {
+ return false;
+ }
+ if ( !isEqual( n0_0.getDistanceToParent(), 0.001 ) ) {
+ return false;
+ }
+ final PhylogenyNode n0_1 = PhylogenyNode.createInstanceFromNhxString( "n0[ignore me 123]:1E-3",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n0_1.getName().equals( "n0" ) ) {
+ return false;
+ }
+ if ( !isEqual( n0_1.getDistanceToParent(), 0.001 ) ) {
+ return false;
+ }
+ final PhylogenyNode n0_2 = PhylogenyNode.createInstanceFromNhxString( "n0:1E-3[ignore me 123]",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n0_2.getName().equals( "n0" ) ) {
+ return false;
+ }
+ if ( !isEqual( n0_2.getDistanceToParent(), 0.001 ) ) {
+ return false;
+ }
+ final PhylogenyNode n0_3 = PhylogenyNode.createInstanceFromNhxString( "n0:1E-3:[ignore me 123]",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n0_3.getName().equals( "n0" ) ) {
+ return false;
+ }
+ if ( !isEqual( n0_3.getDistanceToParent(), 0.001 ) ) {
+ return false;
+ }
+ final PhylogenyNode n0_4 = PhylogenyNode.createInstanceFromNhxString( "n0:0.001:[ignore me 123]",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n0_4.getName().equals( "n0" ) ) {
+ return false;
+ }
+ if ( !isEqual( n0_4.getDistanceToParent(), 0.001 ) ) {
+ return false;
+ }
+ final PhylogenyNode n1_0 = PhylogenyNode
+ .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada[&!color=#FFFFFF]",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n1_0.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) {
+ return false;
+ }
+ if ( n1_0.getBranchData().getBranchColor().getValue().getGreen() != 255 ) {
+ return false;
+ }
+ final PhylogenyNode n1_1 = PhylogenyNode
+ .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada[&!color=#FFFFFF]:0.001",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n1_1.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) {
+ return false;
+ }
+ if ( n1_1.getBranchData().getBranchColor().getValue().getGreen() != 255 ) {
+ return false;
+ }
+ if ( !isEqual( n1_1.getDistanceToParent(), 0.001 ) ) {
+ return false;
+ }
+ final PhylogenyNode n1_2 = PhylogenyNode
+ .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada:0.001[&!color=#FFFFFF]",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n1_2.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) {
+ return false;
+ }
+ if ( n1_2.getBranchData().getBranchColor().getValue().getGreen() != 255 ) {
+ return false;
+ }
+ if ( !isEqual( n1_2.getDistanceToParent(), 0.001 ) ) {
+ return false;
+ }
+ final PhylogenyNode n1_3 = PhylogenyNode
+ .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada:1e-3[&boostrap=69,&!color=#FFFFFF]",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n1_3.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) {
+ return false;
+ }
+ if ( n1_3.getBranchData().getBranchColor().getValue().getGreen() != 255 ) {
+ return false;
+ }
+ if ( !isEqual( n1_3.getDistanceToParent(), 0.001 ) ) {
+ return false;
+ }
+ if ( !isEqual( n1_3.getBranchData().getConfidence( 0 ).getValue(), 69 ) ) {
+ return false;
+ }
+ if ( !n1_3.getBranchData().getConfidence( 0 ).getType().equals( "bootstrap" ) ) {
+ return false;
+ }
+ final PhylogenyNode n1_4 = PhylogenyNode
+ .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada[&bootstrap=69,&!colour=#FFFFFF]:1e-3",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n1_4.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) {
+ return false;
+ }
+ if ( n1_4.getBranchData().getBranchColor().getValue().getGreen() != 255 ) {
+ return false;
+ }
+ if ( !isEqual( n1_4.getDistanceToParent(), 0.001 ) ) {
+ return false;
+ }
+ if ( !isEqual( n1_4.getBranchData().getConfidence( 0 ).getValue(), 69 ) ) {
+ return false;
+ }
+ if ( !n1_4.getBranchData().getConfidence( 0 ).getType().equals( "bootstrap" ) ) {
+ return false;
+ }
+ final PhylogenyNode n1_5 = PhylogenyNode
+ .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada:1e-3[69.0]",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n1_5.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) {
return false;
}
- final PhylogenyNode n31 = PhylogenyNode
- .createInstanceFromNhxString( "BLAH_12345678-roejojoej",
- NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
- if ( n31.getNodeData().isHasTaxonomy() ) {
+ if ( !isEqual( n1_5.getDistanceToParent(), 0.001 ) ) {
return false;
}
- final PhylogenyNode n32 = PhylogenyNode
- .createInstanceFromNhxString( "sd_12345678", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
- if ( n32.getNodeData().isHasTaxonomy() ) {
+ if ( !isEqual( n1_5.getBranchData().getConfidence( 0 ).getValue(), 69 ) ) {
return false;
}
- final PhylogenyNode n40 = PhylogenyNode
- .createInstanceFromNhxString( "BCL2_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
- if ( !n40.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
+ final PhylogenyNode n1_6 = PhylogenyNode
+ .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada[&prob=0.9500000000000000e+00,prob_stddev=0.1100000000000000e+00]:1e-3",
+ NHXParser.TAXONOMY_EXTRACTION.NO,
+ true,
+ true );
+ if ( !n1_6.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) {
return false;
}
- final PhylogenyNode n41 = PhylogenyNode
- .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
- if ( n41.getNodeData().isHasTaxonomy() ) {
+ if ( !isEqual( n1_6.getDistanceToParent(), 0.001 ) ) {
return false;
}
- final PhylogenyNode n42 = PhylogenyNode
- .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
- if ( n42.getNodeData().isHasTaxonomy() ) {
+ if ( !isEqual( n1_6.getBranchData().getConfidence( 0 ).getStandardDeviation(), 0.11 ) ) {
return false;
}
- final PhylogenyNode n43 = PhylogenyNode.createInstanceFromNhxString( "12345",
- NHXParser.TAXONOMY_EXTRACTION.NO );
- if ( n43.getNodeData().isHasTaxonomy() ) {
+ if ( !isEqual( n1_6.getBranchData().getConfidence( 0 ).getValue(), 0.95 ) ) {
return false;
}
- final PhylogenyNode n44 = PhylogenyNode
- .createInstanceFromNhxString( "12345~1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
- if ( n44.getNodeData().isHasTaxonomy() ) {
+ if ( !n1_6.getBranchData().getConfidence( 0 ).getType().equals( "posterior probability" ) ) {
return false;
}
}
private static boolean testNHXParsing() {
try {
final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
- final Phylogeny p1 = factory.create( "(A [&&NHX:S=a_species],B1[&&NHX:S=b_species])", new NHXParser() )[ 0 ];
+ final Phylogeny p1 = factory.create( "(A [&&NHX:S=a_species],B1[&&NHX:S=b_species])",
+ new NHXParser() )[ 0 ];
if ( !p1.toNewHampshireX().equals( "(A[&&NHX:S=a_species],B1[&&NHX:S=b_species])" ) ) {
return false;
}
if ( !p2b[ 0 ].toNewHampshireX().equals( "(((((((A:0.2):0.2):0.3):0.4):0.5):0.6):0.7):0.8" ) ) {
return false;
}
- final Phylogeny[] p3 = factory
- .create( "[ comment&&NHX,())))](((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq]",
- new NHXParser() );
+ final Phylogeny[] p3 = factory.create(
+ "[ comment&&NHX,())))](((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq]",
+ new NHXParser() );
if ( !p3[ 0 ].toNewHampshireX().equals( p2_S ) ) {
return false;
}
- final Phylogeny[] p4 = factory
- .create( "(((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq][comment(]",
- new NHXParser() );
+ final Phylogeny[] p4 = factory.create(
+ "(((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq][comment(]",
+ new NHXParser() );
if ( !p4[ 0 ].toNewHampshireX().equals( p2_S ) ) {
return false;
}
- final Phylogeny[] p5 = factory
- .create( "[] ( [][ ][ ] ([((( &&NHXcomment only![[[[[[]([]((((A:0.2[&&NHX:S=q[comment )))]werty][,,,,))]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=a[comment,,))]sdf])[comment(((]:0.4[&&NHX:S=zxc][comment(((][comment(((]):0.5[&&NHX:S=a]):0.6[&&NHX:S=a[comment(((]sd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq][comment(((]",
- new NHXParser() );
+ final Phylogeny[] p5 = factory.create(
+ "[] ( [][ ][ ] ([((( &&NHXcomment only![[[[[[]([]((((A:0.2[&&NHX:S=q[comment )))]werty][,,,,))]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=a[comment,,))]sdf])[comment(((]:0.4[&&NHX:S=zxc][comment(((][comment(((]):0.5[&&NHX:S=a]):0.6[&&NHX:S=a[comment(((]sd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq][comment(((]",
+ new NHXParser() );
if ( !p5[ 0 ].toNewHampshireX().equals( p2_S ) ) {
return false;
}
if ( !p9.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
return false;
}
- final Phylogeny p10 = factory
- .create( " [79] ( (A [co mment] :0 .2[comment],B:0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],C: 0.1)[comment]root:0.1[100] [comment]",
- new NHXParser() )[ 0 ];
+ final Phylogeny p10 = factory.create(
+ " [79] ( (A [co mment] :0 .2[comment],B:0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],C: 0.1)[comment]root:0.1[100] [comment]",
+ new NHXParser() )[ 0 ];
if ( !p10.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
return false;
}
+ final Phylogeny p11 = factory.create(
+ " [79] ( ('A: \" ' [co mment] :0 .2[comment],B:0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],C: 0.1)[comment]root:0.1[100] [comment]",
+ new NHXParser() )[ 0 ];
+ if ( !p11.toNewHampshireX().equals( "(('A: \"':0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
+ return false;
+ }
+ final Phylogeny p12 = factory.create( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]",
+ new NHXParser() )[ 0 ];
+ if ( !p12.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
+ return false;
+ }
}
catch ( final Exception e ) {
e.printStackTrace( System.out );
}
final Phylogeny p2 = factory
.create( "(1[something_else(?)s,prob=0.9500000000000000e+00{}(((,p)rob_stddev=0.110000000000e+00,"
- + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
- + "prob+-sd=\"100+-0\"]:4.129000000000000e-02[&length_mean=4.153987461671767e-02,"
- + "length_median=4.129000000000000e-02,length_95%HPD={3.217800000000000e-02,"
- + "5.026800000000000e-02}],2[&prob=0.810000000000000e+00,prob_stddev=0.000000000000000e+00,"
- + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
- + "prob+-sd=\"100+-0\"]:6.375699999999999e-02[&length_mean=6.395210411945065e-02,"
- + "length_median=6.375699999999999e-02,length_95%HPD={5.388600000000000e-02,"
- + "7.369400000000000e-02}])",
- new NHXParser() )[ 0 ];
+ + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
+ + "prob+-sd=\"100+-0\"]:4.129000000000000e-02[&length_mean=4.153987461671767e-02,"
+ + "length_median=4.129000000000000e-02,length_95%HPD={3.217800000000000e-02,"
+ + "5.026800000000000e-02}],2[&prob=0.810000000000000e+00,prob_stddev=0.000000000000000e+00,"
+ + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
+ + "prob+-sd=\"100+-0\"]:6.375699999999999e-02[&length_mean=6.395210411945065e-02,"
+ + "length_median=6.375699999999999e-02,length_95%HPD={5.388600000000000e-02,"
+ + "7.369400000000000e-02}])", new NHXParser() )[ 0 ];
if ( p2.getNode( "1" ) == null ) {
return false;
}
if ( phy.getNodes( "'single quotes' inside double quotes" ).size() != 1 ) {
return false;
}
- if ( phy.getNodes( "double quotes inside single quotes" ).size() != 1 ) {
+ if ( phy.getNodes( "\"double quotes\" inside single quotes" ).size() != 1 ) {
return false;
}
if ( phy.getNodes( "noquotes" ).size() != 1 ) {
return false;
}
- if ( phy.getNodes( "A ( B C '" ).size() != 1 ) {
+ if ( phy.getNodes( "A ( B C '" ).size() != 1 ) {
return false;
}
final NHXParser p1p = new NHXParser();
if ( !p4.toNewHampshire().equals( "('A)','B(),; x');" ) ) {
return false;
}
- final Phylogeny p10 = factory
- .create( " [79] ( (\"A \n\tB \" [co mment] :0 .2[comment],'B':0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],'C (or D?\\//;,))': 0.1)[comment]'\nroot is here (cool, was! ) ':0.1[100] [comment]",
- new NHXParser() )[ 0 ];
- final String p10_clean_str = "(('A B':0.2,B:0.3):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]";
+ final Phylogeny p10 = factory.create(
+ " [79] ( (\"A \n\tB \" [co mment] :0 .2[comment],'B':0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],'C (or D?\\//;,))': 0.1)[comment]'\nroot is here (cool, was! ) ':0.1[100] [comment]",
+ new NHXParser() )[ 0 ];
+ final String p10_clean_str = "(('A B':0.2,B:0.3):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]";
if ( !p10.toNewHampshireX().equals( p10_clean_str ) ) {
return false;
}
if ( !p11.toNewHampshireX().equals( p10_clean_str ) ) {
return false;
}
- //
- final Phylogeny p12 = factory
- .create( " [79] ( (\"A \n\tB \" [[][] :0 .2[comment][\t&\t&\n N\tH\tX:S=mo\tnkey !],'\tB\t\b\t\n\f\rB B ':0.0\b3[])\t[com ment]: 0. 5 \t[ 9 1 ][ \ncomment],'C\t (or D?\\//;,))': 0.\b1)[comment]'\nroot \tis here (cool, \b\t\n\f\r was! ) ':0.1[100] [comment]",
- new NHXParser() )[ 0 ];
- final String p12_clean_str = "(('A B':0.2[&&NHX:S=monkey!],'BB B':0.03):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]";
+ final Phylogeny p12 = factory.create(
+ " [79] ( (\"A \n\tB \" [[][] :0 .2[comment][\t&\t&\n N\tH\tX:S=mo\tnkey !],'\tB\t\b\t\n\f\rB B ':0.0\b3[])\t[com ment]: 0. 5 \t[ 9 1 ][ \ncomment],'C\t (or D?\\//;,))': 0.\b1)[comment]'\nroot \tis here (cool, \b\t\n\f\r was! ) ':0.1[100] [comment]",
+ new NHXParser() )[ 0 ];
+ final String p12_clean_str = "(('A B':0.2[&&NHX:S=monkey!],'BB B':0.03):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]";
if ( !p12.toNewHampshireX().equals( p12_clean_str ) ) {
return false;
}
if ( !p13.toNewHampshireX().equals( p12_clean_str ) ) {
return false;
}
- final String p12_clean_str_nh = "(('A B':0.2,'BB B':0.03):0.5,'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1;";
+ final String p12_clean_str_nh = "(('A B':0.2,'BB B':0.03):0.5,'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1;";
if ( !p13.toNewHampshire().equals( p12_clean_str_nh ) ) {
return false;
}
xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
}
}
- final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_distribution.xml",
- xml_parser );
+ final Phylogeny[] phylogenies_0 = factory
+ .create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_distribution.xml" ), xml_parser );
if ( xml_parser.getErrorCount() > 0 ) {
System.out.println( xml_parser.getErrorMessages().toString() );
return false;
for( it0.reset(); it0.hasNext(); ) {
it0.next();
}
- final Phylogeny t1 = factory.create( "(((A,B)ab,(C,D)cd)abcd,((E,F)ef,(G,H)gh)efgh)r", new NHXParser() )[ 0 ];
+ final Phylogeny t1 = factory.create( "(((A,B)ab,(C,D)cd)abcd,((E,F)ef,(G,H)gh)efgh)r",
+ new NHXParser() )[ 0 ];
final PhylogenyNodeIterator it = t1.iteratorPostorder();
if ( !it.next().getName().equals( "A" ) ) {
return false;
if ( it.hasNext() ) {
return false;
}
- final Phylogeny t1 = factory.create( "(((A,B)ab,(C,D)cd)abcd,((E,F)ef,(G,H)gh)efgh)r", new NHXParser() )[ 0 ];
+ final Phylogeny t1 = factory.create( "(((A,B)ab,(C,D)cd)abcd,((E,F)ef,(G,H)gh)efgh)r",
+ new NHXParser() )[ 0 ];
it = t1.iteratorPreorder();
if ( !it.next().getName().equals( "r" ) ) {
return false;
private static boolean testPropertiesMap() {
try {
- final PropertiesMap pm = new PropertiesMap();
+ final PropertiesList pm = new PropertiesList();
final Property p0 = new Property( "dimensions:diameter", "1", "metric:mm", "xsd:decimal", AppliesTo.NODE );
final Property p1 = new Property( "dimensions:length", "2", "metric:mm", "xsd:decimal", AppliesTo.NODE );
final Property p2 = new Property( "something:else",
pm.addProperty( p0 );
pm.addProperty( p1 );
pm.addProperty( p2 );
- if ( !pm.getProperty( "dimensions:diameter" ).getValue().equals( "1" ) ) {
+ if ( !pm.getProperties( "dimensions:diameter" ).get( 0 ).getValue().equals( "1" ) ) {
return false;
}
- if ( !pm.getProperty( "dimensions:length" ).getValue().equals( "2" ) ) {
+ if ( !pm.getProperties( "dimensions:length" ).get( 0 ).getValue().equals( "2" ) ) {
return false;
}
if ( pm.getProperties().size() != 3 ) {
if ( pm.getProperties().size() != 3 ) {
return false;
}
- pm.removeProperty( "dimensions:diameter" );
- if ( pm.getProperties().size() != 2 ) {
- return false;
- }
- if ( pm.getPropertiesWithGivenReferencePrefix( "dimensions" ).size() != 1 ) {
- return false;
- }
- if ( pm.getPropertiesWithGivenReferencePrefix( "something" ).size() != 1 ) {
- return false;
- }
}
catch ( final Exception e ) {
e.printStackTrace( System.out );
if ( !gene1.getRoot().isDuplication() ) {
return false;
}
- final Phylogeny species2 = factory
- .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
- new NHXParser() )[ 0 ];
- final Phylogeny gene2 = factory
- .create( "(((([&&NHX:S=A],[&&NHX:S=B])ab,[&&NHX:S=C])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
- new NHXParser() )[ 0 ];
+ final Phylogeny species2 = factory.create(
+ "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
+ new NHXParser() )[ 0 ];
+ final Phylogeny gene2 = factory.create(
+ "(((([&&NHX:S=A],[&&NHX:S=B])ab,[&&NHX:S=C])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
+ new NHXParser() )[ 0 ];
species2.setRooted( true );
gene2.setRooted( true );
final SDI sdi2 = new SDI( gene2, species2 );
if ( !gene2.getNode( "r" ).isHasAssignedEvent() ) {
return false;
}
- final Phylogeny species3 = factory
- .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
- new NHXParser() )[ 0 ];
- final Phylogeny gene3 = factory
- .create( "(((([&&NHX:S=A],[&&NHX:S=A])aa,[&&NHX:S=C])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
- new NHXParser() )[ 0 ];
+ final Phylogeny species3 = factory.create(
+ "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
+ new NHXParser() )[ 0 ];
+ final Phylogeny gene3 = factory.create(
+ "(((([&&NHX:S=A],[&&NHX:S=A])aa,[&&NHX:S=C])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
+ new NHXParser() )[ 0 ];
species3.setRooted( true );
gene3.setRooted( true );
final SDI sdi3 = new SDI( gene3, species3 );
if ( !gene3.getNode( "aa" ).isHasAssignedEvent() ) {
return false;
}
- final Phylogeny species4 = factory
- .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
- new NHXParser() )[ 0 ];
- final Phylogeny gene4 = factory
- .create( "(((([&&NHX:S=A],[&&NHX:S=C])ac,[&&NHX:S=B])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
- new NHXParser() )[ 0 ];
+ final Phylogeny species4 = factory.create(
+ "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
+ new NHXParser() )[ 0 ];
+ final Phylogeny gene4 = factory.create(
+ "(((([&&NHX:S=A],[&&NHX:S=C])ac,[&&NHX:S=B])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
+ new NHXParser() )[ 0 ];
species4.setRooted( true );
gene4.setRooted( true );
final SDI sdi4 = new SDI( gene4, species4 );
if ( gene4.getNumberOfExternalNodes() != 6 ) {
return false;
}
- final Phylogeny species5 = factory
- .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
- new NHXParser() )[ 0 ];
- final Phylogeny gene5 = factory
- .create( "(((([&&NHX:S=A],[&&NHX:S=D])ad,[&&NHX:S=C])adc,[&&NHX:S=B])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
- new NHXParser() )[ 0 ];
+ final Phylogeny species5 = factory.create(
+ "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
+ new NHXParser() )[ 0 ];
+ final Phylogeny gene5 = factory.create(
+ "(((([&&NHX:S=A],[&&NHX:S=D])ad,[&&NHX:S=C])adc,[&&NHX:S=B])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
+ new NHXParser() )[ 0 ];
species5.setRooted( true );
gene5.setRooted( true );
final SDI sdi5 = new SDI( gene5, species5 );
// Trees from Louxin Zhang 1997 "On a Mirkin-Muchnik-Smith
// Conjecture for Comparing Molecular Phylogenies"
// J. of Comput Bio. Vol. 4, No 2, pp.177-187
- final Phylogeny species6 = factory
- .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
- + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
- new NHXParser() )[ 0 ];
- final Phylogeny gene6 = factory
- .create( "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1,3:0.1[&&NHX:S=3])1-2-3:0.1,"
- + "((4:0.1[&&NHX:S=4],(5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.1)4-5-6:0.1,"
- + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],9:0.1[&&NHX:S=9])8-9:0.1)7-8-9:0.1)4-5-6-7-8-9:0.1)r;",
- new NHXParser() )[ 0 ];
+ final Phylogeny species6 = factory.create(
+ "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
+ + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
+ new NHXParser() )[ 0 ];
+ final Phylogeny gene6 = factory.create(
+ "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1,3:0.1[&&NHX:S=3])1-2-3:0.1,"
+ + "((4:0.1[&&NHX:S=4],(5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.1)4-5-6:0.1,"
+ + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],9:0.1[&&NHX:S=9])8-9:0.1)7-8-9:0.1)4-5-6-7-8-9:0.1)r;",
+ new NHXParser() )[ 0 ];
species6.setRooted( true );
gene6.setRooted( true );
final SDI sdi6 = new SDI( gene6, species6 );
private static boolean testSDIunrooted() {
try {
final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
- final Phylogeny p0 = factory.create( "((((A,B)ab,(C1,C2)cc)abc,D)abcd,(E,F)ef)abcdef", new NHXParser() )[ 0 ];
+ final Phylogeny p0 = factory.create( "((((A,B)ab,(C1,C2)cc)abc,D)abcd,(E,F)ef)abcdef",
+ new NHXParser() )[ 0 ];
final List<PhylogenyBranch> l = SDIR.getBranchesInPreorder( p0 );
final Iterator<PhylogenyBranch> iter = l.iterator();
PhylogenyBranch br = iter.next();
if ( iter2.hasNext() ) {
return false;
}
- final Phylogeny species0 = factory
- .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
- new NHXParser() )[ 0 ];
- final Phylogeny gene1 = factory
- .create( "(((((A:0.6[&&NHX:S=A],B:0.1[&&NHX:S=B])ab:0.1,C:0.1[&&NHX:S=C])abc:0.3,D:1.0[&&NHX:S=D])abcd:0.2,E:0.1[&&NHX:S=E])abcde:0.2,F:0.2[&&NHX:S=F])",
- new NHXParser() )[ 0 ];
+ final Phylogeny species0 = factory.create(
+ "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
+ new NHXParser() )[ 0 ];
+ final Phylogeny gene1 = factory.create(
+ "(((((A:0.6[&&NHX:S=A],B:0.1[&&NHX:S=B])ab:0.1,C:0.1[&&NHX:S=C])abc:0.3,D:1.0[&&NHX:S=D])abcd:0.2,E:0.1[&&NHX:S=E])abcde:0.2,F:0.2[&&NHX:S=F])",
+ new NHXParser() )[ 0 ];
species0.setRooted( true );
gene1.setRooted( true );
final SDIR sdi_unrooted = new SDIR();
if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
return false;
}
- final Phylogeny gene2 = factory
- .create( "(((((A:2.6[&&NHX:S=A],B:0.1[&&NHX:S=B])ab:0.1,C:0.1[&&NHX:S=C])abc:0.3,D:1.0[&&NHX:S=D])abcd:0.2,E:0.1[&&NHX:S=E])abcde:0.2,F:0.2[&&NHX:S=F])",
- new NHXParser() )[ 0 ];
+ final Phylogeny gene2 = factory.create(
+ "(((((A:2.6[&&NHX:S=A],B:0.1[&&NHX:S=B])ab:0.1,C:0.1[&&NHX:S=C])abc:0.3,D:1.0[&&NHX:S=D])abcd:0.2,E:0.1[&&NHX:S=E])abcde:0.2,F:0.2[&&NHX:S=F])",
+ new NHXParser() )[ 0 ];
gene2.setRooted( true );
sdi_unrooted.infer( gene2, species0, false, false, true, true, 10 );
if ( sdi_unrooted.getCount() != 1 ) {
if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
return false;
}
- final Phylogeny species6 = factory
- .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
- + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
- new NHXParser() )[ 0 ];
- final Phylogeny gene6 = factory
- .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
- + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
- + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
- + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
- + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
- new NHXParser() )[ 0 ];
+ final Phylogeny species6 = factory.create(
+ "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
+ + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
+ new NHXParser() )[ 0 ];
+ final Phylogeny gene6 = factory.create(
+ "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
+ + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
+ + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
+ + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
+ + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
+ new NHXParser() )[ 0 ];
species6.setRooted( true );
gene6.setRooted( true );
Phylogeny[] p6 = sdi_unrooted.infer( gene6, species6, false, true, true, true, 10 );
return false;
}
p6 = null;
- final Phylogeny species7 = factory
- .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
- + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
- new NHXParser() )[ 0 ];
- final Phylogeny gene7 = factory
- .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
- + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
- + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
- + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
- + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
- new NHXParser() )[ 0 ];
+ final Phylogeny species7 = factory.create(
+ "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
+ + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
+ new NHXParser() )[ 0 ];
+ final Phylogeny gene7 = factory.create(
+ "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
+ + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
+ + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
+ + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
+ + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
+ new NHXParser() )[ 0 ];
species7.setRooted( true );
gene7.setRooted( true );
Phylogeny[] p7 = sdi_unrooted.infer( gene7, species7, true, true, true, true, 10 );
return false;
}
p7 = null;
- final Phylogeny species8 = factory
- .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
- + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
- new NHXParser() )[ 0 ];
- final Phylogeny gene8 = factory
- .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
- + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
- + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
- + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
- + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
- new NHXParser() )[ 0 ];
+ final Phylogeny species8 = factory.create(
+ "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
+ + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
+ new NHXParser() )[ 0 ];
+ final Phylogeny gene8 = factory.create(
+ "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
+ + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
+ + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
+ + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
+ + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
+ new NHXParser() )[ 0 ];
species8.setRooted( true );
gene8.setRooted( true );
Phylogeny[] p8 = sdi_unrooted.infer( gene8, species8, false, false, true, true, 10 );
final PhylogenyNode n2 = new PhylogenyNode( "NM_001030253" );
SequenceDbWsTools.obtainSeqInformation( n2 );
if ( !n2.getNodeData().getSequence().getName()
- .equals( "Danio rerio B-cell leukemia/lymphoma 2 (bcl2), mRNA" ) ) {
+ .equals( "Danio rerio B-cell CLL/lymphoma 2a (bcl2a), mRNA" ) ) {
return false;
}
if ( !n2.getNodeData().getTaxonomy().getScientificName().equals( "Danio rerio" ) ) {
}
return false;
}
- //
id = SequenceAccessionTools.parseAccessorFromString( "segmented worms|gb_ADF31344" );
if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
|| !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
}
return false;
}
- //
id = SequenceAccessionTools.parseAccessorFromString( "segmented worms gb_ADF31344 and more" );
if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
|| !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
}
return false;
}
- //
id = SequenceAccessionTools.parseAccessorFromString( "gb_AAA96518_1" );
if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
|| !id.getValue().equals( "AAA96518" ) || !id.getSource().equals( "ncbi" ) ) {
}
return false;
}
- //
id = SequenceAccessionTools.parseAccessorFromString( "gb_EHB07727_1_rodents_" );
if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
|| !id.getValue().equals( "EHB07727" ) || !id.getSource().equals( "ncbi" ) ) {
}
return false;
}
- //
id = SequenceAccessionTools.parseAccessorFromString( "dbj_BAF37827_1_turtles_" );
if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
|| !id.getValue().equals( "BAF37827" ) || !id.getSource().equals( "ncbi" ) ) {
}
return false;
}
- //
id = SequenceAccessionTools.parseAccessorFromString( "emb_CAA73223_1_primates_" );
if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
|| !id.getValue().equals( "CAA73223" ) || !id.getSource().equals( "ncbi" ) ) {
}
return false;
}
- //
id = SequenceAccessionTools.parseAccessorFromString( "mites|ref_XP_002434188_1" );
if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
|| !id.getValue().equals( "XP_002434188" ) || !id.getSource().equals( "refseq" ) ) {
}
return false;
}
- //
id = SequenceAccessionTools.parseAccessorFromString( "mites_ref_XP_002434188_1_bla_XP_12345" );
if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
|| !id.getValue().equals( "XP_002434188" ) || !id.getSource().equals( "refseq" ) ) {
}
return false;
}
- //
id = SequenceAccessionTools.parseAccessorFromString( "P4A123" );
if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
|| !id.getValue().equals( "P4A123" ) || !id.getSource().equals( "uniprot" ) ) {
System.out.println( "provider=" + id.getSource() );
return false;
}
+ id = SequenceAccessionTools.parseAccessorFromString( "N3B004Z009" );
+ if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
+ || !id.getValue().equals( "N3B004Z009" ) || !id.getSource().equals( "uniprot" ) ) {
+ if ( id != null ) {
+ System.out.println( "value =" + id.getValue() );
+ System.out.println( "provider=" + id.getSource() );
+ }
+ return false;
+ }
+ id = SequenceAccessionTools.parseAccessorFromString( "A4CAA4ZBB9" );
+ if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
+ || !id.getValue().equals( "A4CAA4ZBB9" ) || !id.getSource().equals( "uniprot" ) ) {
+ if ( id != null ) {
+ System.out.println( "value =" + id.getValue() );
+ System.out.println( "provider=" + id.getSource() );
+ }
+ return false;
+ }
+ id = SequenceAccessionTools.parseAccessorFromString( "ecoli_A4CAA4ZBB9_rt" );
+ if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
+ || !id.getValue().equals( "A4CAA4ZBB9" ) || !id.getSource().equals( "uniprot" ) ) {
+ if ( id != null ) {
+ System.out.println( "value =" + id.getValue() );
+ System.out.println( "provider=" + id.getSource() );
+ }
+ return false;
+ }
+ id = SequenceAccessionTools.parseAccessorFromString( "Q4CAA4ZBB9" );
+ if ( id != null ) {
+ System.out.println( "value =" + id.getValue() );
+ System.out.println( "provider=" + id.getSource() );
+ return false;
+ }
}
catch ( final Exception e ) {
e.printStackTrace( System.out );
if ( !s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
if ( !s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
if ( !s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
if ( !s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
if ( !s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- /////////
- // query_nodes = new HashSet<PhylogenyNode>();
- // query_nodes.add( new PhylogenyNode( "X" ) );
- // query_nodes.add( new PhylogenyNode( "Y" ) );
- // query_nodes.add( new PhylogenyNode( "A" ) );
- // query_nodes.add( new PhylogenyNode( "B" ) );
- // query_nodes.add( new PhylogenyNode( "C" ) );
- // query_nodes.add( new PhylogenyNode( "D" ) );
- // query_nodes.add( new PhylogenyNode( "E" ) );
- // query_nodes.add( new PhylogenyNode( "F" ) );
- // query_nodes.add( new PhylogenyNode( "G" ) );
- // if ( !s0.match( query_nodes ) ) {
- // return false;
- // }
- // query_nodes = new HashSet<PhylogenyNode>();
- // query_nodes.add( new PhylogenyNode( "X" ) );
- // query_nodes.add( new PhylogenyNode( "Y" ) );
- // query_nodes.add( new PhylogenyNode( "A" ) );
- // query_nodes.add( new PhylogenyNode( "B" ) );
- // query_nodes.add( new PhylogenyNode( "C" ) );
- // if ( !s0.match( query_nodes ) ) {
- // return false;
- // }
- // //
- // query_nodes = new HashSet<PhylogenyNode>();
- // query_nodes.add( new PhylogenyNode( "X" ) );
- // query_nodes.add( new PhylogenyNode( "Y" ) );
- // query_nodes.add( new PhylogenyNode( "D" ) );
- // query_nodes.add( new PhylogenyNode( "E" ) );
- // query_nodes.add( new PhylogenyNode( "F" ) );
- // query_nodes.add( new PhylogenyNode( "G" ) );
- // if ( !s0.match( query_nodes ) ) {
- // return false;
- // }
- // //
- // query_nodes = new HashSet<PhylogenyNode>();
- // query_nodes.add( new PhylogenyNode( "X" ) );
- // query_nodes.add( new PhylogenyNode( "Y" ) );
- // query_nodes.add( new PhylogenyNode( "A" ) );
- // query_nodes.add( new PhylogenyNode( "B" ) );
- // query_nodes.add( new PhylogenyNode( "C" ) );
- // query_nodes.add( new PhylogenyNode( "D" ) );
- // if ( !s0.match( query_nodes ) ) {
- // return false;
- // }
- // //
- // query_nodes = new HashSet<PhylogenyNode>();
- // query_nodes.add( new PhylogenyNode( "X" ) );
- // query_nodes.add( new PhylogenyNode( "Y" ) );
- // query_nodes.add( new PhylogenyNode( "E" ) );
- // query_nodes.add( new PhylogenyNode( "F" ) );
- // query_nodes.add( new PhylogenyNode( "G" ) );
- // if ( !s0.match( query_nodes ) ) {
- // return false;
- // }
- // //
- // query_nodes = new HashSet<PhylogenyNode>();
- // query_nodes.add( new PhylogenyNode( "X" ) );
- // query_nodes.add( new PhylogenyNode( "Y" ) );
- // query_nodes.add( new PhylogenyNode( "F" ) );
- // query_nodes.add( new PhylogenyNode( "G" ) );
- // if ( !s0.match( query_nodes ) ) {
- // return false;
- // }
- //
+
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
if ( s0.match( query_nodes ) ) {
return false;
}
- ///////////////////////////
- //
+
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
if ( !s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
if ( !s0.match( query_nodes ) ) {
return false;
}
- //
query_nodes = new HashSet<PhylogenyNode>();
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
final Phylogeny t0_1 = factory.create( "(((A,B),C),(D,E))", new NHXParser() )[ 0 ];
final Phylogeny[] phylogenies_1 = factory.create( "(((A,B),C),(D,E)) " + "(((C,B),A),(D,E))"
- + "(((A,B),C),(D,E)) " + "(((A,B),C),(D,E))"
- + "(((A,B),C),(D,E))" + "(((C,B),A),(D,E))"
- + "(((E,B),D),(C,A))" + "(((C,B),A),(D,E))"
- + "(((A,B),C),(D,E))" + "(((A,B),C),(D,E))",
+ + "(((A,B),C),(D,E)) " + "(((A,B),C),(D,E))" + "(((A,B),C),(D,E))" + "(((C,B),A),(D,E))"
+ + "(((E,B),D),(C,A))" + "(((C,B),A),(D,E))" + "(((A,B),C),(D,E))" + "(((A,B),C),(D,E))",
new NHXParser() );
SupportCount.count( t0_1, phylogenies_1, true, false );
final Phylogeny t0_2 = factory.create( "(((((A,B),C),D),E),(F,G))", new NHXParser() )[ 0 ];
final Phylogeny[] phylogenies_2 = factory.create( "(((((A,B),C),D),E),(F,G))"
- + "(((((A,B),C),D),E),((F,G),X))"
- + "(((((A,Y),B),C),D),((F,G),E))"
- + "(((((A,B),C),D),E),(F,G))"
- + "(((((A,B),C),D),E),(F,G))"
- + "(((((A,B),C),D),E),(F,G))"
- + "(((((A,B),C),D),E),(F,G),Z)"
- + "(((((A,B),C),D),E),(F,G))"
- + "((((((A,B),C),D),E),F),G)"
- + "(((((X,Y),F,G),E),((A,B),C)),D)",
+ + "(((((A,B),C),D),E),((F,G),X))" + "(((((A,Y),B),C),D),((F,G),E))" + "(((((A,B),C),D),E),(F,G))"
+ + "(((((A,B),C),D),E),(F,G))" + "(((((A,B),C),D),E),(F,G))" + "(((((A,B),C),D),E),(F,G),Z)"
+ + "(((((A,B),C),D),E),(F,G))" + "((((((A,B),C),D),E),F),G)" + "(((((X,Y),F,G),E),((A,B),C)),D)",
new NHXParser() );
SupportCount.count( t0_2, phylogenies_2, true, false );
final PhylogenyNodeIterator it = t0_2.iteratorPostorder();
return false;
}
final Phylogeny t0_4 = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
- final Phylogeny[] phylogenies_4 = factory.create( "((((((A,X),C),B),D),E),F) "
- + "(((A,B,Z),C,Q),(((D,Y),E),F))", new NHXParser() );
+ final Phylogeny[] phylogenies_4 = factory
+ .create( "((((((A,X),C),B),D),E),F) " + "(((A,B,Z),C,Q),(((D,Y),E),F))", new NHXParser() );
SupportCount.count( t0_4, phylogenies_4, true, false );
t0_4.reRoot( t0_4.getNode( "F" ).getId() );
if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "1" ) ) != 1 ) {
final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
final Phylogeny p1 = factory.create( "(((A,B)ab:97,C)abc:57,((D,E)de:10,(F,G)fg:50,(H,I)hi:64)defghi)",
new NHXParser() )[ 0 ];
- final Phylogeny p2 = factory
- .create( "(((A:0.1,B:0.3)ab:0.4,C)abc:0.5,((D,E)de,(F,G)fg,(H,I)hi:0.59)defghi)", new NHXParser() )[ 0 ];
+ final Phylogeny p2 = factory.create(
+ "(((A:0.1,B:0.3)ab:0.4,C)abc:0.5,((D,E)de,(F,G)fg,(H,I)hi:0.59)defghi)",
+ new NHXParser() )[ 0 ];
if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "ab" ) ) >= 0.0 ) {
return false;
}
return false;
}
final PhylogenyNode n3 = PhylogenyNode
- .createInstanceFromNhxString( "BLAG_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ .createInstanceFromNhxString( "BLAGG_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
if ( !n3.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
System.out.println( n3.toString() );
return false;
return false;
}
final PhylogenyNode n6 = PhylogenyNode
- .createInstanceFromNhxString( "BLAG-12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ .createInstanceFromNhxString( "BLAGG-12345-blag",
+ NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
if ( n6.getNodeData().isHasTaxonomy() ) {
System.out.println( n6.toString() );
return false;
}
final PhylogenyNode n7 = PhylogenyNode
- .createInstanceFromNhxString( "BLAG-12345_blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ .createInstanceFromNhxString( "BL-12345_blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
if ( n7.getNodeData().isHasTaxonomy() ) {
System.out.println( n7.toString() );
return false;
}
final PhylogenyNode n8 = PhylogenyNode
- .createInstanceFromNhxString( "BLAG_12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ .createInstanceFromNhxString( "BLAGG_12345-blag",
+ NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
if ( !n8.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
System.out.println( n8.toString() );
return false;
}
final PhylogenyNode n9 = PhylogenyNode
- .createInstanceFromNhxString( "BLAG_12345/blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ .createInstanceFromNhxString( "BLAGG_12345/blag",
+ NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
if ( !n9.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
System.out.println( n9.toString() );
return false;
}
final PhylogenyNode n10x = PhylogenyNode
- .createInstanceFromNhxString( "BLAG_12X45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ .createInstanceFromNhxString( "BLAG!_12X45-blag",
+ NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
if ( n10x.getNodeData().isHasTaxonomy() ) {
System.out.println( n10x.toString() );
return false;
}
final PhylogenyNode n10xx = PhylogenyNode
- .createInstanceFromNhxString( "BLAG_1YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ .createInstanceFromNhxString( "BLAG!_1YX45-blag",
+ NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
if ( n10xx.getNodeData().isHasTaxonomy() ) {
System.out.println( n10xx.toString() );
return false;
}
final PhylogenyNode n10 = PhylogenyNode
- .createInstanceFromNhxString( "BLAG_9YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ .createInstanceFromNhxString( "BLAGG_9YX45-blag",
+ NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
if ( !n10.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9YX45" ) ) {
System.out.println( n10.toString() );
return false;
}
+ final PhylogenyNode n10v = PhylogenyNode
+ .createInstanceFromNhxString( "BLAGG_BPM1-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ if ( !n10v.getNodeData().getTaxonomy().getTaxonomyCode().equals( "BPM1" ) ) {
+ System.out.println( n10v.toString() );
+ return false;
+ }
+ final PhylogenyNode n10v2 = PhylogenyNode
+ .createInstanceFromNhxString( "BLAGG_ABV-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
+ if ( !n10v2.getNodeData().getTaxonomy().getTaxonomyCode().equals( "ABV" ) ) {
+ System.out.println( n10v2.toString() );
+ return false;
+ }
final PhylogenyNode n11 = PhylogenyNode
- .createInstanceFromNhxString( "BLAG_Mus_musculus", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ .createInstanceFromNhxString( "BLAG@_Mus_musculus", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
if ( !n11.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
System.out.println( n11.toString() );
return false;
}
final PhylogenyNode n12 = PhylogenyNode
- .createInstanceFromNhxString( "BLAG_Mus_musculus_musculus",
+ .createInstanceFromNhxString( "BLA_G_Mus_musculus_musculus",
NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
if ( !n12.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
System.out.println( n12.toString() );
return false;
}
final PhylogenyNode n13 = PhylogenyNode
- .createInstanceFromNhxString( "BLAG_Mus_musculus1", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ .createInstanceFromNhxString( "BLAaG_Mus_musculus1", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
if ( n13.getNodeData().isHasTaxonomy() ) {
System.out.println( n13.toString() );
return false;
}
+ final PhylogenyNode n14 = PhylogenyNode
+ .createInstanceFromNhxString( "Mus_musculus_392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n14.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
+ System.out.println( n14.toString() );
+ return false;
+ }
+ final PhylogenyNode n15 = PhylogenyNode
+ .createInstanceFromNhxString( "Mus_musculus_K392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n15.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
+ System.out.println( n15.toString() );
+ return false;
+ }
+ final PhylogenyNode n16 = PhylogenyNode
+ .createInstanceFromNhxString( "Mus musculus 392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n16.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
+ System.out.println( n16.toString() );
+ return false;
+ }
+ final PhylogenyNode n17 = PhylogenyNode
+ .createInstanceFromNhxString( "Mus musculus K392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n17.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
+ System.out.println( n17.toString() );
+ return false;
+ }
+ final PhylogenyNode n18 = PhylogenyNode
+ .createInstanceFromNhxString( "Mus_musculus_musculus_392",
+ NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n18.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
+ System.out.println( n18.toString() );
+ return false;
+ }
+ final PhylogenyNode n19 = PhylogenyNode
+ .createInstanceFromNhxString( "Mus_musculus_musculus_K392",
+ NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n19.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
+ System.out.println( n19.toString() );
+ return false;
+ }
+ final PhylogenyNode n20 = PhylogenyNode
+ .createInstanceFromNhxString( "Mus musculus musculus 392",
+ NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n20.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
+ System.out.println( n20.toString() );
+ return false;
+ }
+ final PhylogenyNode n21 = PhylogenyNode
+ .createInstanceFromNhxString( "Mus musculus musculus K392",
+ NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n21.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
+ System.out.println( n21.toString() );
+ return false;
+ }
+ final PhylogenyNode n23 = PhylogenyNode
+ .createInstanceFromNhxString( "9EMVE_Nematostella_vectensis",
+ NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n23.getNodeData().getTaxonomy().getScientificName().equals( "Nematostella vectensis" ) ) {
+ System.out.println( n23.toString() );
+ return false;
+ }
+ final PhylogenyNode n24 = PhylogenyNode
+ .createInstanceFromNhxString( "9EMVE_Nematostella", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n24.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9EMVE" ) ) {
+ System.out.println( n24.toString() );
+ return false;
+ }
+ //
+ final PhylogenyNode n25 = PhylogenyNode
+ .createInstanceFromNhxString( "Nematostella_vectensis_NEMVE",
+ NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n25.getNodeData().getTaxonomy().getTaxonomyCode().equals( "NEMVE" ) ) {
+ System.out.println( n25.toString() );
+ return false;
+ }
+ final PhylogenyNode n26 = PhylogenyNode
+ .createInstanceFromNhxString( "Nematostella_vectensis_9EMVE",
+ NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n26.getNodeData().getTaxonomy().getScientificName().equals( "Nematostella vectensis" ) ) {
+ System.out.println( n26.toString() );
+ return false;
+ }
+ final PhylogenyNode n27 = PhylogenyNode
+ .createInstanceFromNhxString( "Nematostella_9EMVE", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
+ if ( !n27.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9EMVE" ) ) {
+ System.out.println( n27.toString() );
+ return false;
+ }
}
catch ( final Exception e ) {
e.printStackTrace( System.out );
return true;
}
+ private static boolean testPhylogenyMethods() {
+ try {
+ final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
+ final Phylogeny t0 = factory.create( "((((A,B)ab,C)abc,D)abcd,E)r", new NHXParser() )[ 0 ];
+ if ( PhylogenyMethods.calculateLevel( t0.getNode( "A" ) ) != 0 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t0.getNode( "B" ) ) != 0 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t0.getNode( "ab" ) ) != 1 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t0.getNode( "C" ) ) != 0 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t0.getNode( "abc" ) ) != 2 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t0.getNode( "D" ) ) != 0 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t0.getNode( "abcd" ) ) != 3 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t0.getNode( "E" ) ) != 0 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t0.getNode( "r" ) ) != 4 ) {
+ return false;
+ }
+ final Phylogeny t1 = factory.create( "((((A,B)ab,C)abc,D)abcd,E,((((((X)1)2)3)4)5)6)r",
+ new NHXParser() )[ 0 ];
+ if ( PhylogenyMethods.calculateLevel( t1.getNode( "r" ) ) != 7 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t1.getNode( "X" ) ) != 0 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t1.getNode( "6" ) ) != 6 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t1.getNode( "5" ) ) != 5 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t1.getNode( "4" ) ) != 4 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t1.getNode( "3" ) ) != 3 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t1.getNode( "2" ) ) != 2 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t1.getNode( "1" ) ) != 1 ) {
+ return false;
+ }
+ if ( PhylogenyMethods.calculateLevel( t1.getNode( "abcd" ) ) != 3 ) {
+ return false;
+ }
+ }
+ catch ( final Exception e ) {
+ e.printStackTrace( System.out );
+ return false;
+ }
+ return true;
+ }
+
private static boolean testUniprotEntryRetrieval() {
try {
- final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainUniProtEntry( "P12345", 200 );
+ final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainUniProtEntry( "P12345", 5000 );
if ( !entry.getAccession().equals( "P12345" ) ) {
return false;
}
if ( !entry.getTaxonomyIdentifier().equals( "9986" ) ) {
return false;
}
+ if ( entry.getMolecularSequence() == null ) {
+ return false;
+ }
+ if ( !entry.getMolecularSequence().getMolecularSequenceAsString()
+ .startsWith( "MALLHSARVLSGVASAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKGLDKEYLPIGGLAEFCRASAELALGENSEV" )
+ || !entry.getMolecularSequence().getMolecularSequenceAsString().endsWith( "LAHAIHQVTK" ) ) {
+ System.out.println( "got: " + entry.getMolecularSequence().getMolecularSequenceAsString() );
+ System.out.println( "expected something else." );
+ return false;
+ }
}
catch ( final IOException e ) {
System.out.println();
e.printStackTrace( System.out );
return true;
}
+ catch ( final NullPointerException f ) {
+ f.printStackTrace( System.out );
+ return false;
+ }
catch ( final Exception e ) {
return false;
}
}
return true;
}
-
- private static boolean testWabiTxSearch() {
- try {
- String result = "";
- result = TxSearch.searchSimple( "nematostella" );
- result = TxSearch.getTxId( "nematostella" );
- if ( !result.equals( "45350" ) ) {
- return false;
- }
- result = TxSearch.getTxName( "45350" );
- if ( !result.equals( "Nematostella" ) ) {
- return false;
- }
- result = TxSearch.getTxId( "nematostella vectensis" );
- if ( !result.equals( "45351" ) ) {
- return false;
- }
- result = TxSearch.getTxName( "45351" );
- if ( !result.equals( "Nematostella vectensis" ) ) {
- return false;
- }
- result = TxSearch.getTxId( "Bacillus subtilis subsp. subtilis str. N170" );
- if ( !result.equals( "536089" ) ) {
- return false;
- }
- result = TxSearch.getTxName( "536089" );
- if ( !result.equals( "Bacillus subtilis subsp. subtilis str. N170" ) ) {
- return false;
- }
- final List<String> queries = new ArrayList<String>();
- queries.add( "Campylobacter coli" );
- queries.add( "Escherichia coli" );
- queries.add( "Arabidopsis" );
- queries.add( "Trichoplax" );
- queries.add( "Samanea saman" );
- queries.add( "Kluyveromyces marxianus" );
- queries.add( "Bacillus subtilis subsp. subtilis str. N170" );
- queries.add( "Bornavirus parrot/PDD/2008" );
- final List<RANKS> ranks = new ArrayList<RANKS>();
- ranks.add( RANKS.SUPERKINGDOM );
- ranks.add( RANKS.KINGDOM );
- ranks.add( RANKS.FAMILY );
- ranks.add( RANKS.GENUS );
- ranks.add( RANKS.TRIBE );
- result = TxSearch.searchLineage( queries, ranks );
- result = TxSearch.searchParam( "Homo sapiens", TAX_NAME_CLASS.ALL, TAX_RANK.SPECIES, 10, true );
- result = TxSearch.searchParam( "Samanea saman", TAX_NAME_CLASS.SCIENTIFIC_NAME, TAX_RANK.ALL, 10, true );
- }
- catch ( final Exception e ) {
- System.out.println();
- System.out.println( "the following might be due to absence internet connection:" );
- e.printStackTrace( System.out );
- return false;
- }
- return true;
- }
}