/*
- * Jalview - A Sequence Alignment Editor and Viewer
- * Copyright (C) 2006 AM Waterhouse, J Procter, G Barton, M Clamp, S Searle
- *
- * This program is free software; you can redistribute it and/or
- * modify it under the terms of the GNU General Public License
- * as published by the Free Software Foundation; either version 2
- * of the License, or (at your option) any later version.
- *
- * This program is distributed in the hope that it will be useful,
- * but WITHOUT ANY WARRANTY; without even the implied warranty of
- * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
- * GNU General Public License for more details.
- *
- * You should have received a copy of the GNU General Public License
- * along with this program; if not, write to the Free Software
- * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA
+ * Jalview - A Sequence Alignment Editor and Viewer (Version 2.5)
+ * Copyright (C) 2010 J Procter, AM Waterhouse, G Barton, M Clamp, S Searle
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License along with Jalview. If not, see <http://www.gnu.org/licenses/>.
*/
package jalview.datamodel;
+import java.util.Hashtable;
+
import jalview.analysis.*;
-import jalview.util.ShiftList;
-import java.util.Vector;
+import jalview.util.*;
-public class SeqCigar
- extends CigarSimple
+public class SeqCigar extends CigarSimple
{
- /**
- * start(inclusive) and end(exclusive) of subsequence on refseq
- */
- private int start, end;
+ /**
+ * start(inclusive) and end(exclusive) of subsequence on refseq
+ */
+ private int start, end;
+
private SequenceI refseq = null;
+
+ private Hashtable seqProps;
+
/**
* Reference dataset sequence for the cigar string
+ *
* @return SequenceI
*/
public SequenceI getRefSeq()
{
return refseq;
}
+
/**
- *
+ *
* @return int start index of cigar ops on refSeq
*/
- public int getStart() {
+ public int getStart()
+ {
return start;
}
+
/**
- *
+ *
* @return int end index (exclusive) of cigar ops on refSeq
*/
- public int getEnd() {
+ public int getEnd()
+ {
return end;
}
+
/**
* Returns sequence as a string with cigar operations applied to it
+ *
* @return String
*/
public String getSequenceString(char GapChar)
{
- return (length == 0) ? "" :
- (String) getSequenceAndDeletions(refseq.getSequenceAsString(start, end), GapChar)[0];
+ return (length == 0) ? "" : (String) getSequenceAndDeletions(refseq
+ .getSequenceAsString(start, end), GapChar)[0];
}
/**
- * recreates a gapped and edited version of RefSeq or null for an empty cigar string
+ * recreates a gapped and edited version of RefSeq or null for an empty cigar
+ * string
+ *
* @return SequenceI
*/
public SequenceI getSeq(char GapChar)
{
return null;
}
- Object[] edit_result = getSequenceAndDeletions(refseq.getSequenceAsString(start,end),
- GapChar);
+ Object[] edit_result = getSequenceAndDeletions(refseq
+ .getSequenceAsString(start, end), GapChar);
if (edit_result == null)
{
throw new Error(
- "Implementation Error - unexpected null from getSequenceAndDeletions");
+ "Implementation Error - unexpected null from getSequenceAndDeletions");
}
int bounds[] = (int[]) edit_result[1];
- seq = new Sequence(refseq.getName(), (String) edit_result[0],
- refseq.getStart() + start+bounds[0],
- refseq.getStart() + start+((bounds[2]==0) ? -1 : bounds[2]));
+ seq = new Sequence(refseq.getName(), (String) edit_result[0], refseq
+ .getStart()
+ + start + bounds[0], refseq.getStart() + start
+ + ((bounds[2] == 0) ? -1 : bounds[2]));
+ seq.setDescription(refseq.getDescription());
+ int sstart = seq.getStart(), send = seq.getEnd();
// seq.checkValidRange(); probably not needed
+ // recover local properties if present
+ if (seqProps != null)
+ {
+ // this recovers dataset sequence reference as well as local features,
+ // names, start/end settings.
+ SeqsetUtils.SeqCharacterUnhash(seq, seqProps);
+ }
+ // ensure dataset sequence is up to date from local reference
seq.setDatasetSequence(refseq);
+ seq.setStart(sstart);
+ seq.setEnd(send);
return seq;
}
/*
- We don't allow this - refseq is given at construction time only
- public void setSeq(SequenceI seq) {
- this.seq = seq;
- }
+ * We don't allow this - refseq is given at construction time only public void
+ * setSeq(SequenceI seq) { this.seq = seq; }
*/
/**
- * internal constructor - sets seq to a gapless sequence derived from seq
- * and prepends any 'D' operations needed to get to the first residue of seq.
- * @param seq SequenceI
- * @param initialDeletion true to mark initial dataset sequence residues as deleted in subsequence
- * @param _s index of first position in seq
- * @param _e index after last position in (possibly gapped) seq
+ * internal constructor - sets seq to a gapless sequence derived from seq and
+ * prepends any 'D' operations needed to get to the first residue of seq.
+ *
+ * @param seq
+ * SequenceI
+ * @param initialDeletion
+ * true to mark initial dataset sequence residues as deleted in
+ * subsequence
+ * @param _s
+ * index of first position in seq
+ * @param _e
+ * index after last position in (possibly gapped) seq
* @return true if gaps are present in seq
*/
- private boolean _setSeq(SequenceI seq, boolean initialDeletion, int _s, int _e)
+ private boolean _setSeq(SequenceI seq, boolean initialDeletion, int _s,
+ int _e)
{
boolean hasgaps = false;
if (seq == null)
{
throw new Error("Implementation Error - _setSeq(null,...)");
}
- if (_s<0)
- throw new Error("Implementation Error: _s="+_s);
+ if (_s < 0)
+ {
+ throw new Error("Implementation Error: _s=" + _s);
+ }
String seq_string = seq.getSequenceAsString();
- if (_e==0 || _e<_s || _e>seq_string.length())
- _e=seq_string.length();
+ if (_e == 0 || _e < _s || _e > seq_string.length())
+ {
+ _e = seq_string.length();
+ }
// resolve start and end positions relative to ungapped reference sequence
- start = seq.findPosition(_s)-seq.getStart();
- end = seq.findPosition(_e)-seq.getStart();
- int l_ungapped = end-start;
- // Find correct sequence to reference and correct start and end - if necessary
+ start = seq.findPosition(_s) - seq.getStart();
+ end = seq.findPosition(_e) - seq.getStart();
+ int l_ungapped = end - start;
+ // Find correct sequence to reference and correct start and end - if
+ // necessary
SequenceI ds = seq.getDatasetSequence();
if (ds == null)
{
// make a new dataset sequence
- String ungapped = AlignSeq.extractGaps(jalview.util.Comparison.GapChars,
- new String(seq_string));
- l_ungapped=ungapped.length();
+ String ungapped = AlignSeq.extractGaps(
+ jalview.util.Comparison.GapChars, new String(seq_string));
+ l_ungapped = ungapped.length();
// check that we haven't just duplicated an ungapped sequence.
if (l_ungapped == seq.getLength())
{
}
else
{
- ds = new Sequence(seq.getName(), ungapped,
- seq.getStart(),
- seq.getStart()+ungapped.length()-1);
+ ds = new Sequence(seq.getName(), ungapped, seq.getStart(), seq
+ .getStart()
+ + ungapped.length() - 1);
// JBPNote: this would be consistent but may not be useful
- // seq.setDatasetSequence(ds);
+ // seq.setDatasetSequence(ds);
}
}
// add in offset between seq and the dataset sequence
if (ds.getStart() < seq.getStart())
{
- int offset=seq.getStart()-ds.getStart();
- if (initialDeletion) {
- // absolute cigar string
- addDeleted(_s+offset);
- start=0;
- end+=offset;
- } else {
- // normal behaviour - just mark start and end subsequence
- start+=offset;
- end+=offset;
+ int offset = seq.getStart() - ds.getStart();
+ if (initialDeletion)
+ {
+ // absolute cigar string
+ addDeleted(_s + offset);
+ start = 0;
+ end += offset;
+ }
+ else
+ {
+ // normal behaviour - just mark start and end subsequence
+ start += offset;
+ end += offset;
}
}
// any gaps to process ?
- if (l_ungapped!=(_e-_s))
- hasgaps=true;
-
- this.refseq = ds;
+ if (l_ungapped != (_e - _s))
+ {
+ hasgaps = true;
+ }
- // Check offsets
- if (end>ds.getLength()) {
- throw new Error("SeqCigar: Possible implementation error: sequence is longer than dataset sequence");
-// end = ds.getLength();
+ refseq = ds;
+ // copy over local properties for the sequence instance of the refseq
+ seqProps = SeqsetUtils.SeqCharacterHash(seq);
+ // Check offsets
+ if (end > ds.getLength())
+ {
+ throw new Error(
+ "SeqCigar: Possible implementation error: sequence is longer than dataset sequence");
+ // end = ds.getLength();
}
return hasgaps;
}
/**
- * directly initialise a cigar object with a sequence of range, operation pairs and a sequence to apply it to.
- * operation and range should be relative to the seq.getStart()'th residue of the dataset seq resolved from seq.
- * @param seq SequenceI
- * @param operation char[]
- * @param range int[]
+ * directly initialise a cigar object with a sequence of range, operation
+ * pairs and a sequence to apply it to. operation and range should be relative
+ * to the seq.getStart()'th residue of the dataset seq resolved from seq.
+ *
+ * @param seq
+ * SequenceI
+ * @param operation
+ * char[]
+ * @param range
+ * int[]
*/
public SeqCigar(SequenceI seq, char operation[], int range[])
{
}
if (operation.length != range.length)
{
- throw new Error("Implementation Bug. Cigar Operation list!= range list");
+ throw new Error(
+ "Implementation Bug. Cigar Operation list!= range list");
}
if (operation != null)
if (_setSeq(seq, false, 0, 0))
{
- throw new Error("NOT YET Implemented: Constructing a Cigar object from a cigar string and a gapped sequence.");
+ throw new Error(
+ "NOT YET Implemented: Constructing a Cigar object from a cigar string and a gapped sequence.");
}
for (int i = this.length, j = 0; j < operation.length; i++, j++)
{
char op = operation[j];
if (op != M && op != I && op != D)
{
- throw new Error(
- "Implementation Bug. Cigar Operation '" + j + "' '" + op +
- "' not one of '" + M + "', '" + I + "', or '" + D + "'.");
+ throw new Error("Implementation Bug. Cigar Operation '" + j
+ + "' '" + op + "' not one of '" + M + "', '" + I
+ + "', or '" + D + "'.");
}
this.operation[i] = op;
this.range[i] = range[j];
this.operation = null;
this.range = null;
this.length = 0;
- if (_setSeq(seq, false,0, 0))
+ if (_setSeq(seq, false, 0, 0))
{
- throw new Error("NOT YET Implemented: Constructing a Cigar object from a cigar string and a gapped sequence.");
+ throw new Error(
+ "NOT YET Implemented: Constructing a Cigar object from a cigar string and a gapped sequence.");
}
}
}
/**
* add range matched residues to cigar string
- * @param range int
+ *
+ * @param range
+ * int
*/
public void addMatch(int range)
{
this.addOperation(M, range);
}
+
/**
- * Adds
- * insertion and match operations based on seq to the cigar up to
- * the endpos column of seq.
- *
- * @param cigar CigarBase
- * @param seq SequenceI
- * @param startpos int
- * @param endpos int
- * @param initialDeletions if true then initial deletions will be added from start of seq to startpos
+ * Adds insertion and match operations based on seq to the cigar up to the
+ * endpos column of seq.
+ *
+ * @param cigar
+ * CigarBase
+ * @param seq
+ * SequenceI
+ * @param startpos
+ * int
+ * @param endpos
+ * int
+ * @param initialDeletions
+ * if true then initial deletions will be added from start of seq to
+ * startpos
*/
protected static void addSequenceOps(CigarBase cigar, SequenceI seq,
- int startpos, int endpos, boolean initialDeletions)
+ int startpos, int endpos, boolean initialDeletions)
{
char op = '\0';
int range = 0;
int p = 0, res = seq.getLength();
if (!initialDeletions)
- p=startpos;
-
+ {
+ p = startpos;
+ }
while (p <= endpos)
{
- boolean isGap = (p < res) ? jalview.util.Comparison.isGap(seq.getCharAt(p)) : true;
- if ( (startpos <= p) && (p <= endpos))
+ boolean isGap = (p < res) ? jalview.util.Comparison.isGap(seq
+ .getCharAt(p)) : true;
+ if ((startpos <= p) && (p <= endpos))
{
if (isGap)
{
/**
* create a cigar string for given sequence
- * @param seq SequenceI
+ *
+ * @param seq
+ * SequenceI
*/
public SeqCigar(SequenceI seq)
{
}
_setSeq(seq, false, 0, 0);
// there is still work to do
- addSequenceOps(this, seq, 0, seq.getLength()-1, false);
+ addSequenceOps(this, seq, 0, seq.getLength() - 1, false);
}
/**
* Create Cigar from a range of gaps and residues on a sequence object
- * @param seq SequenceI
- * @param start int - first column in range
- * @param end int - last column in range
+ *
+ * @param seq
+ * SequenceI
+ * @param start
+ * int - first column in range
+ * @param end
+ * int - last column in range
*/
public SeqCigar(SequenceI seq, int start, int end)
{
{
throw new Error("Implementation error for new Cigar(SequenceI)");
}
- _setSeq(seq, false, start, end+1);
+ _setSeq(seq, false, start, end + 1);
// there is still work to do
addSequenceOps(this, seq, start, end, false);
}
/**
- * Create a cigar object from a cigar string like '[<I|D|M><range>]+'
- * Will fail if the given seq already contains gaps (JBPNote: future implementation will fix)
- * @param seq SequenceI object resolvable to a dataset sequence
- * @param cigarString String
+ * Create a cigar object from a cigar string like '[<I|D|M><range>]+' Will
+ * fail if the given seq already contains gaps (JBPNote: future implementation
+ * will fix)
+ *
+ * @param seq
+ * SequenceI object resolvable to a dataset sequence
+ * @param cigarString
+ * String
* @return Cigar
*/
public static SeqCigar parseCigar(SequenceI seq, String cigarString)
- throws Exception
+ throws Exception
{
Object[] opsandrange = parseCigarString(cigarString);
- return new SeqCigar(seq, (char[]) opsandrange[0], (int[]) opsandrange[1]);
+ return new SeqCigar(seq, (char[]) opsandrange[0],
+ (int[]) opsandrange[1]);
}
/**
* createAlignment
- *
- * @param alseqs SeqCigar[]
- * @param gapCharacter char
+ *
+ * @param alseqs
+ * SeqCigar[]
+ * @param gapCharacter
+ * char
* @return SequenceI[]
*/
public static SequenceI[] createAlignmentSequences(SeqCigar[] alseqs,
- char gapCharacter, ColumnSelection colsel, int[] segments)
+ char gapCharacter, ColumnSelection colsel, int[] segments)
{
SequenceI[] seqs = new SequenceI[alseqs.length];
StringBuffer[] g_seqs = new StringBuffer[alseqs.length];
- String[] alseqs_string=new String[alseqs.length];
+ String[] alseqs_string = new String[alseqs.length];
Object[] gs_regions = new Object[alseqs.length];
for (int i = 0; i < alseqs.length; i++)
{
- alseqs_string[i]=alseqs[i].getRefSeq().
- getSequenceAsString(alseqs[i].start,alseqs[i].end);
- gs_regions[i] = alseqs[i].getSequenceAndDeletions(alseqs_string[i], gapCharacter); // gapped sequence, {start, start col, end. endcol}, hidden regions {{start, end, col}})
+ alseqs_string[i] = alseqs[i].getRefSeq().getSequenceAsString(
+ alseqs[i].start, alseqs[i].end);
+ gs_regions[i] = alseqs[i].getSequenceAndDeletions(alseqs_string[i],
+ gapCharacter); // gapped sequence, {start, start col, end.
+ // endcol}, hidden regions {{start, end, col}})
if (gs_regions[i] == null)
{
- throw new Error("Implementation error: " + i +
- "'th sequence Cigar has no operations.");
+ throw new Error("Implementation error: " + i
+ + "'th sequence Cigar has no operations.");
}
- g_seqs[i] = new StringBuffer( (String) ( (Object[]) gs_regions[i])[0]); // the visible gapped sequence
+ g_seqs[i] = new StringBuffer((String) ((Object[]) gs_regions[i])[0]); // the
+ // visible
+ // gapped
+ // sequence
}
// Now account for insertions. (well - deletions)
- // this is complicated because we must keep track of shifted positions in each sequence
+ // this is complicated because we must keep track of shifted positions in
+ // each sequence
ShiftList shifts = new ShiftList();
for (int i = 0; i < alseqs.length; i++)
{
- Object[] gs_region = ( (Object[]) ( (Object[]) gs_regions[i])[2]);
+ Object[] gs_region = ((Object[]) ((Object[]) gs_regions[i])[2]);
if (gs_region != null)
{
{
insert[s] = gapCharacter;
}
- int inspos = shifts.shift(region[2]); // resolve insertion position in current alignment frame of reference
+ int inspos = shifts.shift(region[2]); // resolve insertion position in
+ // current alignment frame of
+ // reference
for (int s = 0; s < alseqs.length; s++)
{
if (s != i)
// prefix insertion with more gaps.
for (int l = inspos - g_seqs[s].length(); l > 0; l--)
{
- g_seqs[s].append(gapCharacter); // to debug - use a diffferent gap character here
+ g_seqs[s].append(gapCharacter); // to debug - use a diffferent
+ // gap character here
}
}
g_seqs[s].insert(inspos, insert);
}
else
{
- g_seqs[s].insert(inspos,
- alseqs_string[i].substring(region[0], region[1] + 1));
+ g_seqs[s].insert(inspos, alseqs_string[i].substring(
+ region[0], region[1] + 1));
}
}
- shifts.addShift(region[2], insert.length); // update shift in alignment frame of reference
- if (segments==null)
+ shifts.addShift(region[2], insert.length); // update shift in
+ // alignment frame of
+ // reference
+ if (segments == null)
+ {
// add a hidden column for this deletion
- colsel.hideColumns(inspos, inspos+insert.length-1);
+ colsel.hideColumns(inspos, inspos + insert.length - 1);
+ }
}
}
}
for (int i = 0; i < alseqs.length; i++)
{
- int[] bounds = ( (int[]) ( (Object[]) gs_regions[i])[1]);
+ int[] bounds = ((int[]) ((Object[]) gs_regions[i])[1]);
SequenceI ref = alseqs[i].getRefSeq();
- seqs[i] = new Sequence(ref.getName(), g_seqs[i].toString(),
- ref.getStart() + alseqs[i].start+bounds[0],
- ref.getStart() + alseqs[i].start+(bounds[2]==0 ? -1 : bounds[2]));
+ seqs[i] = new Sequence(ref.getName(), g_seqs[i].toString(), ref
+ .getStart()
+ + alseqs[i].start + bounds[0], ref.getStart()
+ + alseqs[i].start + (bounds[2] == 0 ? -1 : bounds[2]));
seqs[i].setDatasetSequence(ref);
seqs[i].setDescription(ref.getDescription());
}
- if (segments!=null) {
- for (int i=0; i<segments.length; i+=3) {
- //int start=shifts.shift(segments[i]-1)+1;
- //int end=shifts.shift(segments[i]+segments[i+1]-1)-1;
- colsel.hideColumns(segments[i+1], segments[i+1]+segments[i+2]-1);
+ if (segments != null)
+ {
+ for (int i = 0; i < segments.length; i += 3)
+ {
+ // int start=shifts.shift(segments[i]-1)+1;
+ // int end=shifts.shift(segments[i]+segments[i+1]-1)-1;
+ colsel.hideColumns(segments[i + 1], segments[i + 1]
+ + segments[i + 2] - 1);
}
}
return seqs;
* non rigorous testing
*/
/**
- *
- * @param seq Sequence
- * @param ex_cs_gapped String
+ *
+ * @param seq
+ * Sequence
+ * @param ex_cs_gapped
+ * String
* @return String
*/
public static String testCigar_string(Sequence seq, String ex_cs_gapped)
String cs_gapped = c_sgapped.getCigarstring();
if (!cs_gapped.equals(ex_cs_gapped))
{
- System.err.println("Failed getCigarstring: incorect string '" + cs_gapped +
- "' != " + ex_cs_gapped);
+ System.err.println("Failed getCigarstring: incorect string '"
+ + cs_gapped + "' != " + ex_cs_gapped);
}
return cs_gapped;
}
public static boolean testSeqRecovery(SeqCigar gen_sgapped,
- SequenceI s_gapped)
+ SequenceI s_gapped)
{
- // this is non-rigorous - start and end recovery is not tested.
+ // this is non-rigorous - start and end recovery is not tested.
SequenceI gen_sgapped_s = gen_sgapped.getSeq('-');
if (!gen_sgapped_s.getSequence().equals(s_gapped.getSequence()))
{
- System.err.println("Couldn't reconstruct sequence.\n" +
- gen_sgapped_s.getSequence() + "\n" +
- s_gapped.getSequence());
+ System.err.println("Couldn't reconstruct sequence.\n"
+ + gen_sgapped_s.getSequenceAsString() + "\n"
+ + s_gapped.getSequenceAsString());
return false;
}
return true;
}
- public static void main(String argv[])
- throws Exception
+ public static void main(String argv[]) throws Exception
{
String o_seq;
Sequence s = new Sequence("MySeq",
- o_seq = "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt",
- 39, 80);
+ o_seq = "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt", 39, 80);
String orig_gapped;
- Sequence s_gapped = new Sequence("MySeq",
- orig_gapped = "----asdf------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhttt",
- 39, 80);
+ Sequence s_gapped = new Sequence(
+ "MySeq",
+ orig_gapped = "----asdf------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhttt",
+ 39, 80);
String ex_cs_gapped = "4I4M6I6M3I11M4I12M4I9M";
s_gapped.setDatasetSequence(s);
String sub_gapped_s;
- Sequence s_subsequence_gapped = new Sequence("MySeq",
- sub_gapped_s = "------ktryas---dtqwrtsasll----dddptyipqqwa----slchvh",
- 43, 77);
+ Sequence s_subsequence_gapped = new Sequence(
+ "MySeq",
+ sub_gapped_s = "------ktryas---dtqwrtsasll----dddptyipqqwa----slchvh",
+ 43, 77);
s_subsequence_gapped.setDatasetSequence(s);
SeqCigar c_null = new SeqCigar(s);
String cs_null = c_null.getCigarstring();
if (!cs_null.equals("42M"))
{
- System.err.println(
- "Failed to recover ungapped sequence cigar operations:" +
- ( (cs_null == "") ? "empty string" : cs_null));
+ System.err
+ .println("Failed to recover ungapped sequence cigar operations:"
+ + ((cs_null == "") ? "empty string" : cs_null));
}
testCigar_string(s_gapped, ex_cs_gapped);
SeqCigar gen_sgapped = SeqCigar.parseCigar(s, ex_cs_gapped);
if (!gen_sgapped.getCigarstring().equals(ex_cs_gapped))
{
- System.err.println("Failed parseCigar(" + ex_cs_gapped +
- ")->getCigarString()->'" + gen_sgapped.getCigarstring() +
- "'");
+ System.err.println("Failed parseCigar(" + ex_cs_gapped
+ + ")->getCigarString()->'" + gen_sgapped.getCigarstring()
+ + "'");
}
testSeqRecovery(gen_sgapped, s_gapped);
// Test dataset resolution
SeqCigar sub_gapped = new SeqCigar(s_subsequence_gapped);
if (!testSeqRecovery(sub_gapped, s_subsequence_gapped))
{
- System.err.println("Failed recovery for subsequence of dataset sequence");
+ System.err
+ .println("Failed recovery for subsequence of dataset sequence");
}
// width functions
if (sub_gapped.getWidth() != sub_gapped_s.length())
SeqCigar sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48);
if (sub_se_gp.getWidth() != 41)
{
- System.err.println(
- "SeqCigar(seq, start, end) not properly clipped alignsequence.");
+ System.err
+ .println("SeqCigar(seq, start, end) not properly clipped alignsequence.");
}
- System.out.println("Original sequence align:\n" + sub_gapped_s +
- "\nReconstructed window from 8 to 48\n"
- + "XXXXXXXX" + sub_se_gp.getSequenceString('-') + "..."
- + "\nCigar String:" + sub_se_gp.getCigarstring() + "\n"
- );
+ System.out.println("Original sequence align:\n" + sub_gapped_s
+ + "\nReconstructed window from 8 to 48\n" + "XXXXXXXX"
+ + sub_se_gp.getSequenceString('-') + "..." + "\nCigar String:"
+ + sub_se_gp.getCigarstring() + "\n");
SequenceI ssgp = sub_se_gp.getSeq('-');
- System.out.println("\t " + ssgp.getSequence());
+ System.out.println("\t " + ssgp.getSequenceAsString());
for (int r = 0; r < 10; r++)
{
sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48);
sub_se_gp.deleteRange(st, e);
String ssgapedseq = sub_se_gp.getSeq('-').getSequenceAsString();
System.out.println(st + "," + e + "\t:" + ssgapedseq);
- st -=3;
+ st -= 3;
}
}
{
SeqCigar[] set = new SeqCigar[]
- {
- new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48),
- new SeqCigar(s_gapped)};
+ { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48),
+ new SeqCigar(s_gapped) };
Alignment al = new Alignment(set);
for (int i = 0; i < al.getHeight(); i++)
{
- System.out.println("" + al.getSequenceAt(i).getName() + "\t" +
- al.getSequenceAt(i).getStart() + "\t" +
- al.getSequenceAt(i).getEnd() + "\t" +
- al.getSequenceAt(i).getSequence());
+ System.out.println("" + al.getSequenceAt(i).getName() + "\t"
+ + al.getSequenceAt(i).getStart() + "\t"
+ + al.getSequenceAt(i).getEnd() + "\t"
+ + al.getSequenceAt(i).getSequenceAsString());
}
}
{
System.out.println("Gapped.");
SeqCigar[] set = new SeqCigar[]
- {
- new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48),
- new SeqCigar(s_gapped)};
+ { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48),
+ new SeqCigar(s_gapped) };
set[0].deleteRange(20, 25);
Alignment al = new Alignment(set);
for (int i = 0; i < al.getHeight(); i++)
{
- System.out.println("" + al.getSequenceAt(i).getName() + "\t" +
- al.getSequenceAt(i).getStart() + "\t" +
- al.getSequenceAt(i).getEnd() + "\t" +
- al.getSequenceAt(i).getSequence());
+ System.out.println("" + al.getSequenceAt(i).getName() + "\t"
+ + al.getSequenceAt(i).getStart() + "\t"
+ + al.getSequenceAt(i).getEnd() + "\t"
+ + al.getSequenceAt(i).getSequenceAsString());
}
}
-// if (!ssgapedseq.equals("ryas---dtqqwa----slchvh"))
-// System.err.println("Subseqgaped\n------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhryas---dtqwrtsasll--qwa----slchvh\n"+ssgapedseq+"\n"+sub_se_gp.getCigarstring());
+ // if (!ssgapedseq.equals("ryas---dtqqwa----slchvh"))
+ // System.err.println("Subseqgaped\n------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhryas---dtqwrtsasll--qwa----slchvh\n"+ssgapedseq+"\n"+sub_se_gp.getCigarstring());
}
}