DataSourceType.PASTE);
av = af.getViewport();
al = av.getAlignment();
-
- // JAL-3765 bug test data
- String longSeqData =
- ">O80429_MAIZE/2-140 Ferredoxin\n" +
- "AAT---------ALSMSILR---APPPCFSSPLRLRV--AVAKPLA-APMRRQLLRAQATYNVKLITPEGEV\n" +
- "ELQVPDDVYILDFAEEEGIDLPFSCRAGSCSSCAGKVVSGSVDQSDQSFLNDNQVADGWVLTCAAYPTSDVV\n" +
- "IETHKEDDLL--\n" ;
- af_oneseq=new FileLoader().LoadFileWaitTillLoaded(longSeqData, DataSourceType.PASTE);
- av_oneseq = af_oneseq.getViewport();
- al_oneseq = av_oneseq.getAlignment();
}
@AfterMethod(alwaysRun = true)
assertEquals(matches.get(1).getEnd(), 6);
}
+ @Test(groups = "Functional")
+ public void testFind_findAll()
+ {
+ /*
+ * simple JAL-3765 test
+ * single symbol should find *all* matching symbols
+ */
+ Finder f = new Finder(av);
+ f.findAll("M", false, false, false);
+ SearchResultsI sr = f.getSearchResults();
+ assertEquals(sr.getCount(), 5);
+
+ }
+
/**
* Test for (undocumented) find residue by position
*/
sg.addSequence(al.getSequenceAt(1), false);
sg.addSequence(al.getSequenceAt(2), false);
av.setSelectionGroup(sg);
-
+
/*
* search for 'e' should match two sequence ids and one residue
*/
}
/**
- * Test that find does not report hidden positions, but does report matches that
- * span hidden gaps
+ * Test that find does not report hidden positions, but does report matches
+ * that span hidden gaps
*/
@Test(groups = "Functional")
public void testFind_withHiddenColumns()
* --bcdEFH
* aa---aMMMMMaaa
*/
-
+
/*
* hide columns 2-4 and 6-7
*/
hc.hideColumns(2, 4);
hc.hideColumns(6, 7);
al.setHiddenColumns(hc);
-
+
/*
* select rows 2-3
*/