Merge branch 'develop' into improvement/JAL-3830_install4j9_macos_setup_application

[jalview.git] / test / jalview / gui / StructureChooserTest.java

diff --git a/test/jalview/gui/StructureChooserTest.java b/test/jalview/gui/StructureChooserTest.java
index 57aa23c..f183e5c 100644 (file)
--- a/test/jalview/gui/StructureChooserTest.java
+++ b/test/jalview/gui/StructureChooserTest.java
@@ -21,42 +21,33 @@
 package jalview.gui;
 
 import static org.testng.Assert.assertEquals;
-import static org.testng.AssertJUnit.assertEquals;
 import static org.testng.AssertJUnit.assertNotNull;
 import static org.testng.AssertJUnit.assertTrue;
 
+import java.util.Collection;
+import java.util.Vector;
+
+import org.junit.Assert;
+import org.testng.annotations.AfterMethod;
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.BeforeMethod;
+import org.testng.annotations.Test;
+
 import jalview.datamodel.DBRefEntry;
-import jalview.datamodel.DBRefSource;
 import jalview.datamodel.PDBEntry;
 import jalview.datamodel.Sequence;
 import jalview.datamodel.SequenceI;
 import jalview.fts.api.FTSData;
-import jalview.fts.api.FTSRestClientI;
 import jalview.fts.core.FTSRestClient;
-import jalview.fts.core.FTSRestRequest;
 import jalview.fts.service.pdb.PDBFTSRestClient;
 import jalview.fts.service.pdb.PDBFTSRestClientTest;
 import jalview.fts.service.threedbeacons.TDBeaconsFTSRestClient;
 import jalview.fts.threedbeacons.TDBeaconsFTSRestClientTest;
 import jalview.gui.structurechooser.PDBStructureChooserQuerySource;
-import jalview.gui.structurechooser.StructureChooserQuerySource;
-import jalview.gui.structurechooser.ThreeDBStructureChooserQuerySource;
 import jalview.jbgui.FilterOption;
-import jalview.ws.params.InvalidArgumentException;
-
-import java.util.Collection;
-import java.util.Vector;
-
-import javax.swing.JComboBox;
-
-import org.junit.Assert;
-import org.testng.annotations.AfterMethod;
-import org.testng.annotations.BeforeClass;
-import org.testng.annotations.BeforeMethod;
-import org.testng.annotations.Test;
-
 import junit.extensions.PA;
 
+@Test(singleThreaded = true)
 public class StructureChooserTest
 {
 
@@ -67,7 +58,7 @@ public class StructureChooserTest
     JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
   }
 
-  Sequence seq,upSeq;
+  Sequence seq,upSeq,upSeq_nocanonical;
 
   @BeforeMethod(alwaysRun = true)
   public void setUp() throws Exception
@@ -120,9 +111,15 @@ public class StructureChooserTest
             + "GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY\n"
             + "", 1,
 1863);
-    upSeq.createDatasetSequence();
     upSeq.setDescription("Breast cancer type 1 susceptibility protein");
+    upSeq_nocanonical = new Sequence(upSeq);
+    upSeq.createDatasetSequence();
     upSeq.addDBRef(new DBRefEntry("UNIPROT","0","P38398",null,true));
+    
+    upSeq_nocanonical.createDatasetSequence();
+    // not a canonical reference
+    upSeq_nocanonical.addDBRef(new DBRefEntry("UNIPROT","0","P38398",null,false));
+
   }
 
   @AfterMethod(alwaysRun = true)
@@ -130,6 +127,7 @@ public class StructureChooserTest
   {
     seq = null;
     upSeq=null;
+    upSeq_nocanonical=null;
   }
 
   @Test(groups = { "Functional" })
@@ -140,6 +138,7 @@ public class StructureChooserTest
 
     SequenceI[] selectedSeqs = new SequenceI[] { seq };
     StructureChooser sc = new StructureChooser(selectedSeqs, seq, null);
+    ThreadwaitFor(200, sc);
     
     // if structures are not discovered then don't
     // populate filter options
@@ -154,7 +153,7 @@ public class StructureChooserTest
 
     }
     // report items when this fails - seems to be a race condition
-    assertEquals(optionsSize,2,items.toString()); 
+    Assert.assertEquals(items.toString(),optionsSize,2); 
 
     sc.populateFilterComboBox(true, false);
     optionsSize = sc.getCmbFilterOption().getItemCount();
@@ -171,6 +170,20 @@ public class StructureChooserTest
 
   }
 
+  @Test(groups = { "Functional" })
+  public void displayTDBQueryTest() throws InterruptedException
+  {
+    TDBeaconsFTSRestClientTest.setMock();
+    PDBFTSRestClientTest.setMock();
+
+    SequenceI[] selectedSeqs = new SequenceI[] { upSeq_nocanonical };
+    StructureChooser sc = new StructureChooser(selectedSeqs, upSeq_nocanonical, null);
+    // mock so should be quick. Exceptions from mocked PDBFTS are expected too
+    ThreadwaitFor(500, sc);
+    
+    assertTrue(sc.isCanQueryTDB() && sc.isNotQueriedTDBYet());
+  }
+
   @Test(groups = { "Network" })
   public void fetchStructuresInfoTest()
   {
@@ -178,6 +191,9 @@ public class StructureChooserTest
     PDBFTSRestClient.unMock((FTSRestClient) PDBFTSRestClient.getInstance());
     SequenceI[] selectedSeqs = new SequenceI[] { seq };
     StructureChooser sc = new StructureChooser(selectedSeqs, seq, null);
+    // not mocked, wait for 2s 
+    ThreadwaitFor(2000, sc);
+    
     sc.fetchStructuresMetaData();
     Collection<FTSData> ss = (Collection<FTSData>) PA.getValue(sc,
             "discoveredStructuresSet");
@@ -192,6 +208,8 @@ public class StructureChooserTest
     PDBFTSRestClientTest.setMock();
     SequenceI[] selectedSeqs = new SequenceI[] { upSeq };
     StructureChooser sc = new StructureChooser(selectedSeqs, seq, null);
+    ThreadwaitFor(500, sc);
+    
     sc.fetchStructuresMetaData();
     Collection<FTSData> ss = (Collection<FTSData>) PA.getValue(sc,
             "discoveredStructuresSet");
@@ -199,6 +217,22 @@ public class StructureChooserTest
     assertTrue(ss.size() > 0);
   }
 
+  private void ThreadwaitFor(int i, StructureChooser sc)
+  {
+    long timeout = i+System.currentTimeMillis();
+    while (!sc.isDialogVisible() && timeout > System.currentTimeMillis())
+    {
+      try {
+        Thread.sleep(50);
+      } catch (InterruptedException x)
+      {
+        
+      }
+    }
+    
+  }
+
+
   @Test(groups = { "Functional" })
   public void sanitizeSeqNameTest()
   {