import jalview.datamodel.DBRefSource;
import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceI;
-import jalview.io.AppletFormatAdapter;
+import jalview.gui.JvOptionPane;
+import jalview.io.DataSourceType;
import jalview.structure.StructureMapping;
import jalview.xml.binding.sifts.Entry.Entity;
import org.testng.Assert;
import org.testng.FileAssert;
import org.testng.annotations.AfterTest;
+import org.testng.annotations.BeforeClass;
import org.testng.annotations.BeforeTest;
import org.testng.annotations.Test;
public class SiftsClientTest
{
+ @BeforeClass(alwaysRun = true)
+ public void setUpJvOptionPane()
+ {
+ JvOptionPane.setInteractiveMode(false);
+ JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
+ }
+
public static final String DEFAULT_SIFTS_DOWNLOAD_DIR = System
.getProperty("user.home")
+ File.separatorChar
try
{
pdbFile = new PDBfile(false, false, false, "test/jalview/io/"
- + testPDBId + ".pdb", AppletFormatAdapter.FILE);
+ + testPDBId + ".pdb", DataSourceType.FILE);
siftsClient = new SiftsClient(pdbFile);
} catch (Exception e)
{
testSeq, testPDBId, "A");
String expectedMappingOutput = "\nSequence ⟷ Structure mapping details\n"
+ "Method: SIFTS\n\n"
- + "P00221 : 1 - 97 Maps to \n"
- + "1A70|A : 51 - 147\n\n"
+ + "P00221 : 51 - 147 Maps to \n"
+ + "1A70|A : 1 - 97\n\n"
+ "P00221 AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLD\n"
+ " |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||\n"
+ "1A70|A AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLD\n\n"
}
@Test(groups = { "Functional" })
- public void getEntityByMostOptimalMatchedIdTest()
+ public void getEntityByMostOptimalMatchedIdTest1()
{
SiftsClient siftsClientX = null;
PDBfile pdbFile;
try
{
pdbFile = new PDBfile(false, false, false, "test/jalview/io/2nq2"
- + ".pdb", AppletFormatAdapter.FILE);
+ + ".pdb", DataSourceType.FILE);
siftsClientX = new SiftsClient(pdbFile);
} catch (Exception e)
{
Assert.assertEquals(entityD.getEntityId(), "D");
}
+
+ @Test(groups = { "Functional" })
+ public void getEntityByMostOptimalMatchedIdTest2()
+ {
+ // This test is for a SIFTS file in which entity A should map to chain P for
+ // the given PDB Id. All the other chains shouldn't be mapped as there are
+ // no SIFTS entity records for them.
+ SiftsClient siftsClientX = null;
+ PDBfile pdbFile;
+ try
+ {
+ pdbFile = new PDBfile(false, false, false,
+ "test/jalview/io/3ucu.cif", DataSourceType.FILE);
+ siftsClientX = new SiftsClient(pdbFile);
+ } catch (Exception e)
+ {
+ e.printStackTrace();
+ }
+ Entity entityA = siftsClientX.getEntityByMostOptimalMatchedId("P");
+ Entity entityP = siftsClientX.getEntityByMostOptimalMatchedId("A");
+ Entity entityR = siftsClientX.getEntityByMostOptimalMatchedId("R");
+ Assert.assertEquals(entityA.getEntityId(), "A");
+ Assert.assertNotEquals(entityR, "A");
+ Assert.assertNotEquals(entityP, "A");
+ Assert.assertNotEquals(entityR, "R");
+ Assert.assertNotEquals(entityP, "P");
+ Assert.assertNull(entityR);
+ Assert.assertNull(entityP);
+
+ }
}