info.events = [ TestLogEvent.FAILED ]
}
+ if (OperatingSystem.current().isMacOsX()) {
+ testTask.systemProperty "apple.awt.UIElement", "true"
+ testTask.environment "JAVA_TOOL_OPTIONS", "-Dapple.awt.UIElement=true"
+ }
ignoreFailures = true // Always try to run all tests for all modules
def stdout
def stderr
doFirst {
- def timeoutms = Integer.valueOf(jalviewjs_chromium_timeout) * 1000
+ def timeoutms = Integer.valueOf(jalviewjs_chromium_overall_timeout) * 1000
def binary = file(chromiumBinary)
if (!binary.exists()) {
errorOutput = execStderr
executable(chromiumBinary)
args(execArgs)
+ println "COMMAND: '"+commandLine.join(" ")+"'"
}
executor.shutdownNow()
}
executor.shutdownNow()
}
// if no change in stderr for 10s then also end
- if (noChangeIterations >= 10) {
+ if (noChangeIterations >= jalviewjs_chromium_idle_timeout) {
executor.shutdownNow()
}
if (stderrString.length() == noChangeBytes) {
--paematrix=[label=pAE R4-M5]./examples/test_fab41.result/test_fab41_unrelaxed_rank_4_model_5_scores.json
--structure=./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1.pdb
--paematrix=[label=pAE R5-M1]./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1_scores.json
---image=output1.html
+--image=[textrenderer=text]output1.html
--- /dev/null
+--open=./examples/test_fab41.result/sample.a2m
+--colour=gecos:flower
+--gui
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3.pdb
+--paematrix=[label=pAE R1-M3]./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_2_model_4.pdb
+--paematrix=[label=pAE R2-M4]./examples/test_fab41.result/test_fab41_unrelaxed_rank_2_model_4_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_3_model_2.pdb
+--paematrix=[label=pAE R3-M2]./examples/test_fab41.result/test_fab41_unrelaxed_rank_3_model_2_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_4_model_5.pdb
+--paematrix=[label=pAE R4-M5]./examples/test_fab41.result/test_fab41_unrelaxed_rank_4_model_5_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1.pdb
+--paematrix=[label=pAE R5-M1]./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1_scores.json
+--image=[textrenderer=text]output1.html
--- /dev/null
+<?xml version="1.0"?>
+<!DOCTYPE rnaml SYSTEM "rnaml.dtd">
+
+<rnaml version="1.0">
+
+ <molecule id="1">
+ <sequence>
+ <numbering-system id="1" used-in-file="false">
+ <numbering-range>
+ <start>1</start>
+ <end>20</end>
+ </numbering-range>
+ </numbering-system>
+ <numbering-table length="20" comment="sequence number in pdb file">
+ 1 2 3 4 5 6 7 8 9 10
+ 11 12 13 14 15 16 17 18 19 20
+
+ </numbering-table>
+ <seq-data>
+ GUUAGCAGCC GCAUAGGCUG
+ </seq-data>
+ <seq-annotation comment="?">
+ <segment>
+ <seg-name>LOOP1</seg-name>
+ <base-id-5p><base-id><position>12</position></base-id></base-id-5p>
+ <base-id-3p><base-id><position>14</position></base-id></base-id-3p>
+ </segment>
+ </seq-annotation>
+ </sequence>
+ <structure>
+ <model id="?">
+ <model-info>
+ <method>Crystallography ?</method>
+ <resolution>? Angstroms</resolution>
+ </model-info>
+ <base>
+ <position>1</position>
+ <base-type>G</base-type>
+ <atom serial="1">
+ <atom-type> P </atom-type>
+ <coordinates>7.232 28.529 -12.305</coordinates>
+ </atom>
+ <atom serial="9">
+ <atom-type> O3'</atom-type>
+ <coordinates>4.752 23.963 -11.820</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>2</position>
+ <base-type>U</base-type>
+ <atom serial="24">
+ <atom-type> P </atom-type>
+ <coordinates>3.868 23.252 -12.962</coordinates>
+ </atom>
+ <atom serial="32">
+ <atom-type> O3'</atom-type>
+ <coordinates>0.983 18.432 -13.409</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>3</position>
+ <base-type>U</base-type>
+ <atom serial="44">
+ <atom-type> P </atom-type>
+ <coordinates>1.438 17.540 -14.670</coordinates>
+ </atom>
+ <atom serial="52">
+ <atom-type> O3'</atom-type>
+ <coordinates>-1.417 16.962 -19.633</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>4</position>
+ <base-type>A</base-type>
+ <atom serial="64">
+ <atom-type> P </atom-type>
+ <coordinates>-2.710 16.020 -19.430</coordinates>
+ </atom>
+ <atom serial="72">
+ <atom-type> O3'</atom-type>
+ <coordinates>-7.138 19.555 -19.112</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>5</position>
+ <base-type>G</base-type>
+ <atom serial="86">
+ <atom-type> P </atom-type>
+ <coordinates>-7.829 20.393 -20.298</coordinates>
+ </atom>
+ <atom serial="94">
+ <atom-type> O3'</atom-type>
+ <coordinates>-11.316 24.166 -18.659</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>6</position>
+ <base-type>C</base-type>
+ <atom serial="109">
+ <atom-type> P </atom-type>
+ <coordinates>-12.021 24.790 -19.958</coordinates>
+ </atom>
+ <atom serial="117">
+ <atom-type> O3'</atom-type>
+ <coordinates>-14.686 21.023 -22.223</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>7</position>
+ <base-type>A</base-type>
+ <atom serial="129">
+ <atom-type> P </atom-type>
+ <coordinates>-16.102 21.690 -22.577</coordinates>
+ </atom>
+ <atom serial="137">
+ <atom-type> O3'</atom-type>
+ <coordinates>-20.284 18.901 -22.582</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>8</position>
+ <base-type>G</base-type>
+ <atom serial="151">
+ <atom-type> P </atom-type>
+ <coordinates>-21.555 19.844 -22.854</coordinates>
+ </atom>
+ <atom serial="159">
+ <atom-type> O3'</atom-type>
+ <coordinates>-26.285 20.028 -19.599</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>9</position>
+ <base-type>C</base-type>
+ <atom serial="174">
+ <atom-type> P </atom-type>
+ <coordinates>-27.355 21.190 -19.880</coordinates>
+ </atom>
+ <atom serial="182">
+ <atom-type> O3'</atom-type>
+ <coordinates>-30.900 21.877 -16.104</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>10</position>
+ <base-type>C</base-type>
+ <atom serial="194">
+ <atom-type> P </atom-type>
+ <coordinates>-31.737 23.147 -16.621</coordinates>
+ </atom>
+ <atom serial="202">
+ <atom-type> O3'</atom-type>
+ <coordinates>-33.685 26.755 -13.690</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>11</position>
+ <base-type>G</base-type>
+ <atom serial="214">
+ <atom-type> P </atom-type>
+ <coordinates>-34.360 27.602 -14.877</coordinates>
+ </atom>
+ <atom serial="222">
+ <atom-type> O3'</atom-type>
+ <coordinates>-34.025 32.801 -15.050</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>12</position>
+ <base-type>C</base-type>
+ <atom serial="237">
+ <atom-type> P </atom-type>
+ <coordinates>-35.037 32.875 -16.296</coordinates>
+ </atom>
+ <atom serial="245">
+ <atom-type> O3'</atom-type>
+ <coordinates>-31.850 33.486 -20.341</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>13</position>
+ <base-type>A</base-type>
+ <atom serial="257">
+ <atom-type> P </atom-type>
+ <coordinates>-30.767 32.411 -19.837</coordinates>
+ </atom>
+ <atom serial="265">
+ <atom-type> O3'</atom-type>
+ <coordinates>-25.756 33.919 -20.714</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>14</position>
+ <base-type>U</base-type>
+ <atom serial="279">
+ <atom-type> P </atom-type>
+ <coordinates>-24.465 33.135 -20.171</coordinates>
+ </atom>
+ <atom serial="287">
+ <atom-type> O3'</atom-type>
+ <coordinates>-21.219 37.107 -19.013</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>15</position>
+ <base-type>A</base-type>
+ <atom serial="299">
+ <atom-type> P </atom-type>
+ <coordinates>-22.129 38.268 -18.376</coordinates>
+ </atom>
+ <atom serial="307">
+ <atom-type> O3'</atom-type>
+ <coordinates>-20.542 37.656 -12.798</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>16</position>
+ <base-type>G</base-type>
+ <atom serial="321">
+ <atom-type> P </atom-type>
+ <coordinates>-19.666 36.373 -12.391</coordinates>
+ </atom>
+ <atom serial="329">
+ <atom-type> O3'</atom-type>
+ <coordinates>-21.101 34.091 -7.803</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>17</position>
+ <base-type>G</base-type>
+ <atom serial="344">
+ <atom-type> P </atom-type>
+ <coordinates>-20.251 32.728 -7.687</coordinates>
+ </atom>
+ <atom serial="352">
+ <atom-type> O3'</atom-type>
+ <coordinates>-22.951 28.722 -5.266</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>18</position>
+ <base-type>C</base-type>
+ <atom serial="367">
+ <atom-type> P </atom-type>
+ <coordinates>-21.797 27.634 -5.014</coordinates>
+ </atom>
+ <atom serial="375">
+ <atom-type> O3'</atom-type>
+ <coordinates>-23.692 22.611 -5.084</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>19</position>
+ <base-type>U</base-type>
+ <atom serial="387">
+ <atom-type> P </atom-type>
+ <coordinates>-22.583 21.449 -4.989</coordinates>
+ </atom>
+ <atom serial="395">
+ <atom-type> O3'</atom-type>
+ <coordinates>-22.919 16.822 -7.040</coordinates>
+ </atom>
+ </base>
+ <base>
+ <position>20</position>
+ <base-type>G</base-type>
+ <atom serial="407">
+ <atom-type> P </atom-type>
+ <coordinates>-21.585 16.199 -6.397</coordinates>
+ </atom>
+ <atom serial="415">
+ <atom-type> O3'</atom-type>
+ <coordinates>-18.522 13.024 -10.277</coordinates>
+ </atom>
+ </base>
+ <str-annotation>
+ <base-pair comment="?">
+ <base-id-5p>
+ <base-id><position>1</position></base-id>
+ </base-id-5p>
+ <base-id-3p>
+ <base-id><position>2</position></base-id>
+ </base-id-3p>
+ <edge-5p>S</edge-5p>
+ <edge-3p>H</edge-3p>
+ <bond-orientation>c</bond-orientation>
+ </base-pair>
+ <base-pair comment="?">
+ <base-id-5p>
+ <base-id><position>6</position></base-id>
+ </base-id-5p>
+ <base-id-3p>
+ <base-id><position>20</position></base-id>
+ </base-id-3p>
+ <edge-5p>+</edge-5p>
+ <edge-3p>+</edge-3p>
+ <bond-orientation>c</bond-orientation>
+ </base-pair>
+ <base-pair comment="?">
+ <base-id-5p>
+ <base-id><position>7</position></base-id>
+ </base-id-5p>
+ <base-id-3p>
+ <base-id><position>19</position></base-id>
+ </base-id-3p>
+ <edge-5p>-</edge-5p>
+ <edge-3p>-</edge-3p>
+ <bond-orientation>c</bond-orientation>
+ </base-pair>
+ <base-pair comment="?">
+ <base-id-5p>
+ <base-id><position>8</position></base-id>
+ </base-id-5p>
+ <base-id-3p>
+ <base-id><position>18</position></base-id>
+ </base-id-3p>
+ <edge-5p>+</edge-5p>
+ <edge-3p>+</edge-3p>
+ <bond-orientation>c</bond-orientation>
+ </base-pair>
+ <base-pair comment="?">
+ <base-id-5p>
+ <base-id><position>9</position></base-id>
+ </base-id-5p>
+ <base-id-3p>
+ <base-id><position>17</position></base-id>
+ </base-id-3p>
+ <edge-5p>+</edge-5p>
+ <edge-3p>+</edge-3p>
+ <bond-orientation>c</bond-orientation>
+ </base-pair>
+ <base-pair comment="?">
+ <base-id-5p>
+ <base-id><position>10</position></base-id>
+ </base-id-5p>
+ <base-id-3p>
+ <base-id><position>16</position></base-id>
+ </base-id-3p>
+ <edge-5p>+</edge-5p>
+ <edge-3p>+</edge-3p>
+ <bond-orientation>c</bond-orientation>
+ </base-pair>
+ <base-pair comment="?">
+ <base-id-5p>
+ <base-id><position>11</position></base-id>
+ </base-id-5p>
+ <base-id-3p>
+ <base-id><position>15</position></base-id>
+ </base-id-3p>
+ <edge-5p>S</edge-5p>
+ <edge-3p>H</edge-3p>
+ <bond-orientation>t</bond-orientation>
+ </base-pair>
+ <base-pair comment="?">
+ <base-id-5p>
+ <base-id><position>3</position></base-id>
+ </base-id-5p>
+ <base-id-3p>
+ <base-id><position>4</position></base-id>
+ </base-id-3p>
+ <edge-5p>!</edge-5p>
+ <edge-3p>!</edge-3p>
+ <bond-orientation>!</bond-orientation>
+ </base-pair>
+ <base-pair comment="?">
+ <base-id-5p>
+ <base-id><position>14</position></base-id>
+ </base-id-5p>
+ <base-id-3p>
+ <base-id><position>15</position></base-id>
+ </base-id-3p>
+ <edge-5p>!</edge-5p>
+ <edge-3p>!</edge-3p>
+ <bond-orientation>!</bond-orientation>
+ </base-pair>
+ <helix id="H1">
+ <base-id-5p>
+ <base-id><position>6</position></base-id>
+ </base-id-5p>
+ <base-id-3p>
+ <base-id><position>20</position></base-id>
+ </base-id-3p>
+ <length>6</length>
+ </helix>
+ <single-strand>
+ <segment>
+ <seg-name>SG1</seg-name>
+ <base-id-5p><base-id><position>1</position></base-id></base-id-5p>
+ <base-id-3p><base-id><position>5</position></base-id></base-id-3p>
+ </segment>
+ </single-strand>
+ <single-strand>
+ <segment>
+ <seg-name>SG2</seg-name>
+ <base-id-5p><base-id><position>12</position></base-id></base-id-5p>
+ <base-id-3p><base-id><position>14</position></base-id></base-id-3p>
+ </segment>
+ </single-strand>
+ </str-annotation>
+ <secondary-structure-display comment="x,y coodinates">
+ <ss-base-coord>
+ <base-id><position>1</position></base-id>
+ <coordinates>133.930 0.000</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>2</position></base-id>
+ <coordinates>133.930 33.482</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>3</position></base-id>
+ <coordinates>133.930 66.965</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>4</position></base-id>
+ <coordinates>133.930 100.447</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>5</position></base-id>
+ <coordinates>133.930 133.930</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>6</position></base-id>
+ <coordinates>133.930 167.412</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>7</position></base-id>
+ <coordinates>133.930 223.216</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>8</position></base-id>
+ <coordinates>133.930 279.021</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>9</position></base-id>
+ <coordinates>133.930 334.825</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>10</position></base-id>
+ <coordinates>133.930 390.629</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>11</position></base-id>
+ <coordinates>133.930 446.433</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>12</position></base-id>
+ <coordinates>128.630 516.439</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>13</position></base-id>
+ <coordinates>66.965 550.000</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>14</position></base-id>
+ <coordinates>5.300 516.439</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>15</position></base-id>
+ <coordinates>0.000 446.433</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>16</position></base-id>
+ <coordinates>0.000 390.629</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>17</position></base-id>
+ <coordinates>0.000 334.825</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>18</position></base-id>
+ <coordinates>0.000 279.021</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>19</position></base-id>
+ <coordinates>0.000 223.216</coordinates>
+ </ss-base-coord>
+ <ss-base-coord>
+ <base-id><position>20</position></base-id>
+ <coordinates>0.000 167.412</coordinates>
+ </ss-base-coord>
+ </secondary-structure-display>
+ </model>
+ </structure>
+ </molecule>
+
+
+ <interactions>
+ <str-annotation>
+ </str-annotation>
+ </interactions>
+</rnaml>
-1.8.3-1.2.14_FJVL
+1.8.3-1.3.0_FJVL
-1.8.3-1.2.14_JVL
+1.8.3-1.3.0_JVL
<parent>
<groupId>com.threerings.getdown</groupId>
<artifactId>getdown</artifactId>
- <version>1.8.3-1.2.14_FJVL</version>
+ <version>1.8.3-1.3.0_FJVL</version>
</parent>
<artifactId>getdown-ant</artifactId>
<parent>
<groupId>com.threerings.getdown</groupId>
<artifactId>getdown</artifactId>
- <version>1.8.3-1.2.14_FJVL</version>
+ <version>1.8.3-1.3.0_FJVL</version>
</parent>
<artifactId>getdown-core</artifactId>
import java.security.MessageDigest;
+import jalview.util.LaunchUtils;
+
import static com.threerings.getdown.Log.log;
/**
return getJVMPath(appdir, false);
}
+ private static String jvmPath = null;
/**
* Reconstructs the path to the JVM used to launch this process.
*
*/
public static String getJVMPath (File appdir, boolean windebug)
{
- // first look in our application directory for an installed VM
- String vmpath = checkJVMPath(new File(appdir, LOCAL_JAVA_DIR).getAbsolutePath(), windebug);
- if (vmpath == null && isMacOS()) {
- vmpath = checkJVMPath(new File(appdir, LOCAL_JAVA_DIR + "/Contents/Home").getAbsolutePath(), windebug);
+ if (jvmPath != null) {
+ return jvmPath;
}
+
+ // first look in our application directory for an installed VM
+ final String appDir = isMacOS() ?
+ (new File(appdir, LOCAL_JAVA_DIR).getAbsolutePath()) + "/Contents/Home"
+ : new File(appdir, LOCAL_JAVA_DIR).getAbsolutePath();
+
+ String javaBin = LaunchUtils.findJavaBin(appDir, windebug, false);
// then fall back to the VM in which we're already running
- if (vmpath == null) {
- vmpath = checkJVMPath(System.getProperty("java.home"), windebug);
+ if (javaBin == null) {
+ javaBin = LaunchUtils.findJavaBin(System.getProperty("java.home"), windebug, false);
}
// then throw up our hands and hope for the best
- if (vmpath == null) {
+ if (javaBin == null) {
+ javaBin = LaunchUtils.findJavaBin(null, windebug, true);
log.warning("Unable to find java [appdir=" + appdir +
", java.home=" + System.getProperty("java.home") + "]!");
- vmpath = "java";
}
// Oddly, the Mac OS X specific java flag -Xdock:name will only work if java is launched
if (isMacOS()) {
try {
File localVM = new File("/usr/bin/java").getCanonicalFile();
- if (localVM.equals(new File(vmpath).getCanonicalFile())) {
- vmpath = "/usr/bin/java";
+ if (localVM.equals(new File(javaBin).getCanonicalFile())) {
+ javaBin = "/usr/bin/java";
}
} catch (IOException ioe) {
log.warning("Failed to check Mac OS canonical VM path.", ioe);
}
}
- return vmpath;
+ jvmPath = javaBin;
+ return jvmPath;
}
private static String _getMD5FileChecksum (File file) {
public class LaunchUtils
{
+ // setting these is LaunchUtils so don't need to import Platform
+ public final static boolean isMac = System.getProperty("os.name")
+ .indexOf("Mac") > -1;
+
+ public final static boolean isWindows = System.getProperty("os.name")
+ .indexOf("Win") > -1;
+
+ private static boolean isJS = /** @j2sNative true || */
+ false;
+
public static void loadChannelProps(File dir)
{
ChannelProperties.loadProps(dir);
public static int getJavaCompileVersion()
{
- if (JAVA_COMPILE_VERSION > 0)
+ if (LaunchUtils.isJS)
+ {
+ return -1;
+ }
+ else if (JAVA_COMPILE_VERSION > 0)
{
return JAVA_COMPILE_VERSION;
}
public static int getJavaVersion()
{
- if (JAVA_VERSION > 0)
+ if (LaunchUtils.isJS)
+ {
+ return -1;
+ }
+ else if (JAVA_VERSION > 0)
{
return JAVA_VERSION;
}
public static boolean checkJavaVersion()
{
+ if (LaunchUtils.isJS)
+ {
+ return true;
+ }
String buildDetails = "jar:".concat(LaunchUtils.class
.getProtectionDomain().getCodeSource().getLocation().toString()
.concat("!" + "/.build_properties"));
return true;
}
+
+ public static String findJavaBin(boolean winConsole)
+ {
+ return findJavaBin(System.getProperty("java.home"), winConsole, true);
+ }
+
+ /*
+ * Returns a string path to the most likely java binary wanted to run this
+ * installation of Jalview.
+ *
+ * @param winConsole whether to use java.exe (console) in preference to javaw.exe
+ * (only affects Windows).
+ * @param javaHome Try this javaHome dir (defaults to the running java.home).
+ * @param generic Return a generic java command if not found.
+ */
+ public static String findJavaBin(String javaHome, boolean winConsole,
+ boolean generic)
+ {
+ String javaBin = null;
+ final String javaExe = winConsole ? "java.exe" : "javaw.exe";
+ final String java = "java";
+
+ if (javaHome != null)
+ {
+ // property "channel.app_name" is set by install4j when launching getdown
+ String propertyAppName = System.getProperty("channel.app_name");
+ final String appName = (propertyAppName != null
+ && propertyAppName.length() > 0) ? propertyAppName
+ : ChannelProperties.getProperty("app_name");
+
+ final String javaBinDir = javaHome + File.separator + "bin"
+ + File.separator;
+
+ // appName and "Jalview" will not point to javaw.exe or java.exe but in
+ // this case that's okay because the taskbar display name problem doesn't
+ // manifest in Windows. See JAL-3820, JAL-4189.
+ for (String name : new String[] { appName, "Jalview", java, javaExe })
+ {
+ if (LaunchUtils.checkJVMSymlink(javaBinDir + name, winConsole))
+ {
+ javaBin = javaBinDir + name;
+ break;
+ }
+ }
+ }
+
+ if (javaBin == null && generic)
+ {
+ javaBin = LaunchUtils.isWindows ? javaExe : java;
+ }
+
+ return javaBin;
+ }
+
+ /*
+ * checkJVMSymlink returns true if the path in testBin *is* a java binary, or
+ * points to a java binary.
+ * @param testBin The binary or symbolic link to check
+ * @param winConsole whether we are in/want a Windows console (only relevant for Windows,
+ * determines whether we use java.exe or javaw.exe)
+ */
+ private static boolean checkJVMSymlink(String testBin, boolean winConsole)
+ {
+ File testBinFile = new File(testBin);
+ if (!testBinFile.exists())
+ {
+ return false;
+ }
+ File targetFile = null;
+ try
+ {
+ targetFile = testBinFile.getCanonicalFile();
+ } catch (IOException e)
+ {
+ return false;
+ }
+ final String javaExe = winConsole ? "java.exe" : "javaw.exe";
+ if (targetFile != null && ("java".equals(targetFile.getName())
+ || javaExe.equals(targetFile.getName())))
+ {
+ return true;
+ }
+ return false;
+ }
}
<parent>
<groupId>com.threerings.getdown</groupId>
<artifactId>getdown</artifactId>
- <version>1.8.3-1.2.14_FJVL</version>
+ <version>1.8.3-1.3.0_FJVL</version>
</parent>
<artifactId>getdown-launcher</artifactId>
if [ x$JVLVERSION != x ]; then
export VERSION=$JVLVERSION
else
- export VERSION=1.8.3-1.2.14_JVL
+ export VERSION=1.8.3-1.3.0_JVL
fi
if [ x${VERSION%_JVL} = x$VERSION ]; then
<groupId>com.threerings.getdown</groupId>
<artifactId>getdown</artifactId>
<packaging>pom</packaging>
- <version>1.8.3-1.2.14_FJVL</version>
+ <version>1.8.3-1.3.0_FJVL</version>
<name>getdown</name>
<description>An application installer and updater.</description>
# for developing in Eclipse as IDE, set this to automatically copy current swingjs/net.sf.j2s.core.jar to your dropins dir
jalviewjs_eclipseIDE_auto_copy_j2s_plugin = false
# Override this in a local.properties file
-jalviewjs_eclipse_root = ~/buildtools/eclipse/jee-2019-09
+jalviewjs_eclipse_root = ~/buildtools/eclipse/latest
jalviewjs_eclipse_dropins_dir = utils/jalviewjs/eclipse/dropins
jalviewjs_swingjs_zip = swingjs/SwingJS-site.zip
jalviewjs_chromium_binary = ~/buildtools/chromium/chrome
jalviewjs_macos_chromium_binary = /Applications/Chromium.app/Contents/MacOS/Chromium
jalviewjs_chromium_user_dir = chromium
-jalviewjs_chromium_timeout = 30
+jalviewjs_chromium_idle_timeout = 10
+jalviewjs_chromium_overall_timeout = 40
jalviewjs_chromium_profile_name = BUILD
jalviewjs_stderr_launch = utils/jalviewjs/chromium_test/jalview_bin_Jalview-stderr.html
jalviewjs_desktop_init_string = JALVIEWJS: CREATED DESKTOP
<code>phylip</code> (<code>phy</code>),
<br/>
<code>jalview</code> (<code>jvp, jar</code>).
+ </p>
<p>
For example, to open a FASTA file, append another FASTA file and then save the concatenation as a Stockholm file, do
<pre>
</p>
<p>
- <em>Important!</em> If you use <code>--output</code> or any other argument that outputs a file, then it will be assumed you want to run Jalview in headless mode (as if you had specified <code>--headless</code>). To use Jalview with <code>--output</code> and not assume headless mode, use the <code>--gui</code> or <code>--noheadless</code> argument (the order doesn't matter).
+ <em>Important!</em> If you use <code>--output</code> or any other argument that outputs a file, then it will be assumed you want to run Jalview in headless mode (as if you had specified <code>--headless</code>). To use Jalview with <code>--output</code> and not assume headless mode, use the <code>--gui</code> argument (the order doesn't matter).
+ </p>
+
+ <p>
+ If you would like to output an alignment file directly to standard output (often referred to as STDOUT), then use the filename <code>-</code> (a single hyphen). In this case any messages that would normally appear on STDOUT will be diverted to STDERR to avoid invalidating the output file.
+ </p>
+ <p>
+ For example, to open a Stockholm file and pipe it to another command as a Block file, do
+ <pre>
+ jalview --open alignment1.stk --output - --format blc | another_command
+ </pre>
+ or equivalently
+ <pre>
+ jalview alignment1.stk --output=[format=blc]- | another_command
+ </pre>
</p>
<h3><a name="format"></a><code>--format</code></h3>
<tr valign="top"><td><code>‑‑help‑all</code></td><td>Help for all arguments</td></tr>
<tr valign="top">
- <td><code>‑‑headless / ‑‑noheadless</code></td>
- <td>Run Jalview in headless (/ or not in headless) mode. In headless mode, no GUI interface will be created and Jalview will quit after all arguments have been processed.
+ <td><code>‑‑headless</code></td>
+ <td>Run Jalview in headless mode. In headless mode, no GUI interface will be created and Jalview will quit after all arguments have been processed.
<br/>
- If you use a command line argument to specify an output file of some kind (<code>--output</code>, <code>--image</code> or <code>--structureimage</code>) then <strong>headless mode will be assumed</strong>. If you don't want this behaviour use <code>--noheadless</code> or <code>--gui</code>.
+ If you use a command line argument to specify an output file of some kind (<code>--output</code>, <code>--image</code> or <code>--structureimage</code>) then <strong>headless mode will be assumed</strong>. If you don't want this behaviour use <code>--gui</code>.
</td>
</tr>
<code>phylip</code> (<code>phy</code>),
<br/>
<code>jalview</code> (<code>jvp, jar</code>).
+ <br/>
+ To output directly to STDOUT (console output) use the filename <code>-</code> (a single hyphen). In this case all STDOUT messages will instead go to STDERR. If no <code>format</code> is supplied then Fasta will be assumed.
</td>
<td><code>format=<em>name</em></code></td>
<td align="center">✓</td>
<strong>If you specify an argument for an output file</strong> (one or more of <code>--output</code>, <code>--image</code> or <code>--structureimage</code>) then it will be assumed that you wish to <strong>run in headless mode</strong>.
</p>
<p>
- You can force Jalview to run in graphical mode using the <code>--gui</code> or <code>--noheadless</code> arguments.
+ You can force Jalview to run in graphical mode using the <code>--gui</code> argument.
</p>
<p>
<p>Usage data is collected from the logs of various web services
that the Jalview Desktop contacts through its normal operation.
These are described below:</p>
- <ul>
- <li><em>HTTP logs on the Jalview website</em><br> We
- record IP addresses of machines which access the web site, either
- via the browser when downloading the application, or when the
- Jalview Desktop user interface is launched.<br> <br>
- <ul>
- <li><i>The Jalview Getdown Launcher</i> (Since 2.11.0) examines release
- channels every time Jalview launches to determine if a new
- release is available.</li>
- <li><i>The questionnaire web service at
- www.jalview.org/cgi-bin/questionnaire.pl is checked and a
- unique cookie for the current questionnaire is stored in the
- Jalview properties file.</i></li>
- <li><i>The Jalview web services stack is contacted to
- retrieve the currently available web services. All
- interactions with the public Jalview web services are
- logged, but we delete all job data (input data and results)
- after about two weeks.</i></li>
- </ul> <br></li>
- <li><em>Google Analytics</em><br> Since Jalview 2.4.0b2,
- the Jalview Desktop records usage data with Google Analytics via
- the <a href="http://code.google.com/p/jgoogleanalytics/">JGoogleAnalytics</a>
- class.<br> The Google Analytics logs for Jalview version 2.4
- only record the fact that the application was started, but in the
- future, we will use this mechanism to improve the Desktop user
- interface, by tracking which parts of the user interface are being
- used most often.</li>
- </ul>
- </p>
+ <ul>
+ <li><em>HTTP logs on the Jalview website</em><br> We record
+ IP addresses of machines which access the web site, either via the
+ browser when downloading the application, or when the Jalview Desktop
+ user interface is launched.<br> <br>
+ <ul>
+ <li><i>The Jalview Getdown Launcher</i> (Since 2.11.0) examines
+ release channels every time Jalview launches to determine if a new
+ release is available.</li>
+ <li><i>The questionnaire web service at
+ www.jalview.org/cgi-bin/questionnaire.pl is checked and a unique
+ cookie for the current questionnaire is stored in the Jalview
+ properties file.</i></li>
+ <li><i>The Jalview web services stack is contacted to
+ retrieve the currently available web services. All interactions
+ with the public Jalview web services are logged, but we delete all
+ job data (input data and results) after about two weeks.</i></li>
+ </ul> <br></li>
+ <li><em>Usage Analytics</em><br> Since Jalview 2.11.2.7, the
+ Jalview Desktop records usage data with a self-hosted instance of the
+ analytics stack <a href="https://plausible.io">Plausible.io</a> via a
+ custom GPLv3 client developed by Ben Soares. Prior to this, Jalview
+ versions as far back as 2.4 recorded application launches via <a
+ href="http://code.google.com/p/jgoogleanalytics/">JGoogleAnalytics</a>
+ .<br> Usage logs for Jalview record the fact that the
+ application was started, and details about the OS, installed Jalview
+ launcher (if any) and java version used. In the future, we will use
+ this mechanism to improve the Desktop user interface, by tracking
+ which parts of the user interface are being used most often.</li>
+ </ul>
<p>
<strong>Stopping Jalview from calling home</strong><br> If you
run Jalview in 'headless mode' via the command line, then the
--- /dev/null
+---
+version: 2.11.2.7
+date: 2023-06-30
+channel: "release"
+---
+
+## New Features
+- <!-- JAL-4001 --> Jalview now reports usage statistics via Plausible.io
+
+## Issues Resolved
+- <!-- JAL-4116 --> PDB structures slow to view when Jalview Java console is open
+- <!-- JAL-4216 --> chains in PDB or mmCIF files with negative RESNUMs not correctly parsed
---
version: 2.11.3.0
-date: 2023-06-07
+date: 2023-07-19
channel: "release"
---
- <!-- JAL-4089 --> Use selected columns for superposition
- <!-- JAL-4086 --> Highlight aligned positions on all associated structures when mousing over a column
+- <!-- JAL-4221 --> sequence descriptions are updated from database reference sources if not already defined
+
+
### Improved support for working with computationally determined models
- <!-- JAL-3895 --> Alphafold red/orange/yellow/green colourscheme for structures
- <!-- JAL-3858 --> Import and display alphafold alignment uncertainty matrices from JSON
- <!-- JAL-4134,JAL-4158 --> Column-wise alignment groups and selections and interactive tree viewer for PAE matrices
- <!-- JAL-4124 --> Store/Restore PAE data and visualisation settings from Jalview Project
+- <!-- JAL-4083 --> Multiple residue sidechain highlighting in structure viewers from PAE mouseovers
+
### Jalview on the command line
### Other improvements
- <!-- JAL-3119 --> Name of alignment and view included in overview window's title
+- <!-- JAL-4213 --> "add reference annotation" add all positions in reference annotation tracks, not just positions in the currently highlighted columns/selection range
+- <!-- JAL-4119 --> EMBL-EBI SIFTS file downloads now use split directories
+
+- <!-- JAL-4195,JAL-4194,JAL-4193 --> sensible responses from the CLI when things go wrong during image export
+Add a command line option to set Jalview properties for this session only
+Add a command line option to suppress opening the startup file for this session
+
+
+JAL-4187 Powershell launcher script fails when given no arguments with the old ArgsParser
+
+known issue ? <!-- JAL-4127 --> 'Reload' for a jalview project results in all windows being duplicated
+
+
+- <!-- JAL-3830 --> Command-line wrapper script for macOS bundle, linux and Windows installations (bash, powershell and .bat wrappers)
+- <!-- JAL-3820 --> In Linux desktops' task-managers, the grouped Jalview windows get a generic name
## Still in progress (delete on release)
- <!-- JAL-4167 --> Create separate gradle test task for some tests
- <!-- JAL-4111 --> Allow gradle build to create suffixed DEVELOP-... builds with channel appbase
+- <!-- JAL-4243 --> Jalview bio.tools description maintained under jalview's git repo and bundled with source release
## Issues Resolved
- <!-- JAL-2961 --> Jmol view not always centred on structures when multiple structures are viewed
- <!-- JAL-4150 --> Sequences copied to clipboard from within Jalview cannot be pasted via the desktop's popup menu to a new alignment window
- <!-- JAL-2528, JAL-1713 --> Overview window is saved in project file, and state of 'show hidden regions' is preserved.
- <!-- JAL-4153 --> JvCacheableInputBoxTest flaky on build server
+
+## New Known defects
+- <!-- JAL-4178 --> Cannot cancel structure view open action once it has been started via the structure chooser dialog
+- <!-- JAL-4142 --> Example project's multiple views do not open in distinct locations when eXpand views is used to show them all separately
+- <!-- JAL-4165 --> Missing last letter when copying consensus sequence from alignment if first column is hidden
+
+
+
+
--- /dev/null
+Jalview 2.11.2.7 is a minor patch release - it includes patches affecting efficiency when importing structures and a small revision to the import processing of structures with negative residue numbering.
+
+With this release, Jalview usage statistics are now collected by a jalview.org hosted instance of the open source privacy-preserving analytics stack, Plausible.io.
+
+
The 2.11.3 series includes support for in-depth exploration of predicted alignment error matrices from AlphaFold in the context of multiple alignments, along with support for standard colourschemes for shading models according to their pLDDT.
+We're launching this release at ISMB 2023 - come find us !
+
It also introduces new support for native ARM-based OSX architectures, and a few other goodies!
label.successfully_loaded_file = Successfully loaded file {0}
label.successfully_loaded_matrix = Successfully loaded score matrix {0}
label.successfully_saved_to_file_in_format = Successfully saved to file: {0} in {1} format.
+label.successfully_printed_to_stdout_in_format = Successfully printed to STDOUT in {0} format.
label.copied_sequences_to_clipboard = Copied {0} sequences to clipboard.
label.check_file_matches_sequence_ids_alignment = Check that the file matches sequence IDs in the alignment.
label.problem_reading_tcoffee_score_file = Problem reading T-COFFEE score file
label.interpret_tempfac_as = Interpret Temperature Factor as
label.add_pae_matrix_file = Add PAE matrix file
label.nothing_selected = Nothing selected
-prompt.google_analytics_title = Jalview Usage Statistics
-prompt.google_analytics = Do you want to help make Jalview better by enabling the collection of usage statistics with Google Analytics?\nYou can enable or disable usage tracking in the preferences.
+prompt.analytics_title = Jalview Usage Statistics
+prompt.analytics = Do you want to help make Jalview better by enabling the collection of usage statistics with Plausible analytics?\nYou can enable or disable usage tracking in the preferences.
label.working_ellipsis = Working ...
action.show_groups_on_matrix = Show groups on matrix
action.show_groups_on_matrix_tooltip = When enabled, clusters defined on the matrix's associated tree or below the assigned threshold are shown as different colours on the matrix annotation row
action.cluster_matrix = Cluster matrix
action.clustering_matrix_for = Calculating tree for matrix {0} and clustering at {1}
action.cluster_matrix_tooltip = Computes an average distance tree for the matrix and displays it
-
+label.all_known_alignment_files = All known alignment files
label.successfully_loaded_file = Fichero cargado exitosamente {0}
label.successfully_loaded_matrix = Matriz cargada exitosamente {0}
label.successfully_saved_to_file_in_format = Guardado exitosamente en el fichero: {0} en formato {1}.
+label.successfully_printed_to_stdout_in_format = Impresso exitosamente al STDOUT en formato {0}.
label.copied_sequences_to_clipboard = Copiadas {0} secuencias en el portapapeles.
label.check_file_matches_sequence_ids_alignment = Comprobar que el fichero coincide con el ID de la secuencia en el alineamiento.
label.problem_reading_tcoffee_score_file = Problema de lectura del fichero de puntuaciones T-COFFEE
label.tftype_plddt = pLDDT
label.add_pae_matrix_file = Añadir un fichero de matriz PAE
label.nothing_selected = Nada seleccionado
-prompt.google_analytics_title = Jalview Estadísticas de Uso
-prompt.google_analytics = ¿Quiere ayudar a mejorar Jalview habilitando la recopilación de estadísticas de uso con Google Analytics?\nPuede habilitar o deshabilitar el seguimiento de uso en las preferencias.
+prompt.analytics_title = Jalview Estadísticas de Uso
+prompt.analytics = ¿Quiere ayudar a mejorar Jalview habilitando la recopilación de estadísticas de uso con análisis Plausible?\nPuede habilitar o deshabilitar el seguimiento de uso en las preferencias.
+label.all_known_alignment_files = Todos los archivos de alineación conocidos
{
if (sequences[row] == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"WARNING: Consensus skipping null sequence - possible race condition.");
continue;
}
}
return new Profiles(result);
// long elapsed = System.currentTimeMillis() - now;
- // System.out.println(elapsed);
+ // jalview.bin.Console.outPrintln(elapsed);
}
/**
' ', value);
}
// long elapsed = System.currentTimeMillis() - now;
- // System.out.println(-elapsed);
+ // jalview.bin.Console.outPrintln(-elapsed);
}
/**
}
}
- System.out.println(max + " " + min);
+ jalview.bin.Console.outPrintln(max + " " + min);
for (int i = 0; i < n; i++)
{
int x = psize * i;
int y = psize * j;
- // System.out.println(mat[i][j]);
+ // jalview.bin.Console.outPrintln(mat[i][j]);
float score = (float) (mat[i][j] - min) / (float) (max - min);
g.setColor(new Color(score, 0, 0));
g.fillRect(x, y, psize, psize);
- // System.out.println(x + " " + y + " " + score);
+ // jalview.bin.Console.outPrintln(x + " " + y + " " + score);
}
}
}
pdbpos++;
}
- if (allowmismatch || c1 == c2)
+ // ignore case differences
+ if (allowmismatch || (c1 == c2) || (Math.abs(c2-c1)==('a'-'A')))
{
// extend mapping interval
if (lp1 + 1 != alignpos || lp2 + 1 != pdbpos)
bestm = msq;
}
}
- // System.out.println("Best Score for " + (matches.size() + 1) + " :"
+ // jalview.bin.Console.outPrintln("Best Score for " + (matches.size() + 1) + " :"
// + bestscore);
matches.add(bestm);
aligns.add(bestaseq);
if (tmp.size() != nSeq)
{
- System.err.println("WARNING: tmp.size()=" + tmp.size() + " != nseq="
+ jalview.bin.Console.errPrintln("WARNING: tmp.size()=" + tmp.size() + " != nseq="
+ nSeq
+ " in getOrderByTree - tree contains sequences not in alignment");
}
String msg = String.format(
"Implementation Error - sortByFeature method must be either '%s' or '%s'",
FEATURE_SCORE, FEATURE_DENSITY);
- System.err.println(msg);
+ jalview.bin.Console.errPrintln(msg);
return;
}
{
// int nf = (feats[i] == null) ? 0
// : ((SequenceFeature[]) feats[i]).length;
- // // System.err.println("Sorting on Score: seq " +
+ // // jalview.bin.Console.errPrintln("Sorting on Score: seq " +
// seqs[i].getName()
// + " Feats: " + nf + " Score : " + scores[i]);
}
int featureCount = feats[i] == null ? 0
: ((SequenceFeature[]) feats[i]).length;
scores[i] = featureCount;
- // System.err.println("Sorting on Density: seq "+seqs[i].getName()+
+ // jalview.bin.Console.errPrintln("Sorting on Density: seq "+seqs[i].getName()+
// " Feats: "+featureCount+" Score : "+scores[i]);
}
QuickSort.sortByDouble(scores, seqs, sortByFeatureAscending);
if (translated == null || !(aaRes == translated.charAt(0)))
{
// debug
- // System.out.println(("Mismatch at " + i + "/" + aaResidue + ": "
+ // jalview.bin.Console.outPrintln(("Mismatch at " + i + "/" + aaResidue + ": "
// + codon + "(" + translated + ") != " + aaRes));
return false;
}
* unmapped position; treat like a gap
*/
sourceGapMappedLength += ratio;
- // System.err.println("Can't align: no codon mapping to residue "
+ // jalview.bin.Console.errPrintln("Can't align: no codon mapping to residue "
// + sourceDsPos + "(" + sourceChar + ")");
// return;
continue;
{
if (protein.isNucleotide() || !dna.isNucleotide())
{
- System.err.println("Wrong alignment type in alignProteinAsDna");
+ jalview.bin.Console.errPrintln("Wrong alignment type in alignProteinAsDna");
return 0;
}
List<SequenceI> unmappedProtein = new ArrayList<>();
{
if (protein.isNucleotide() || !dna.isNucleotide())
{
- System.err.println("Wrong alignment type in alignProteinAsDna");
+ jalview.bin.Console.errPrintln("Wrong alignment type in alignProteinAsDna");
return 0;
}
// todo: implement this
.getLength() == mappedFromLength - 1);
if (cdsLength != mappedToLength && !addStopCodon)
{
- System.err.println(String.format(
+ jalview.bin.Console.errPrintln(String.format(
"Can't align cds as protein (length mismatch %d/%d): %s",
cdsLength, mappedToLength, cdsSeq.getName()));
}
AlignedCodon codon = sequenceCodon.getValue();
if (codon.peptideCol > 1)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Problem mapping protein with >1 unmapped start positions: "
+ seq.getName());
}
* @param alignment
* the alignment to add them to
* @param selectionGroup
- * current selection group (or null if none)
+ * current selection group - may be null, if provided then any added annotation will be trimmed to just those columns in the selection group
*/
public static void addReferenceAnnotations(
Map<SequenceI, List<AlignmentAnnotation>> annotations,
* @param seq
* @param ann
* @param selectionGroup
- * - may be null
+ * current selection group - may be null, if provided then any added annotation will be trimmed to just those columns in the selection group
* @return annotation added to {@code seq and {@code alignment}
*/
public static AlignmentAnnotation addReferenceAnnotationTo(
fromRange[i + 1]);
if (range == null)
{
- System.err.println("Error in mapping " + seqMap + " from "
+ jalview.bin.Console.errPrintln("Error in mapping " + seqMap + " from "
+ fromSeq.getName());
return false;
}
AlignmentAnnotation aa;
+ // 0 - normalised dot product
+ // 1 - L1 - ie (abs(v_1-v_2)/dim(v))
+ // L1 is more rational - since can reason about value of difference,
+ // normalised dot product might give cleaner clusters, but more difficult to
+ // understand.
+
+ int mode = 1;
+
/**
* compute cosine distance matrix for a given contact matrix and create a
* UPGMA tree
- *
* @param cm
+ * @param cosineOrDifference false - dot product : true - L1
*/
public AverageDistanceEngine(AlignmentViewport av, AlignmentAnnotation aa,
- ContactMatrixI cm)
+ ContactMatrixI cm, boolean cosineOrDifference)
{
this.av = av;
this.aa = aa;
this.cm = cm;
+ mode = (cosineOrDifference) ? 1 :0;
calculate(cm);
}
- // 0 - normalised dot product
- // 1 - L1 - ie (abs(v_1-v_2)/dim(v))
- // L1 is more rational - since can reason about value of difference,
- // normalised dot product might give cleaner clusters, but more difficult to
- // understand.
-
- int mode = 1;
public void calculate(ContactMatrixI cm)
{
}
else
{
- System.out.println("SEQUENCE HAS BEEN DELETED!!!");
+ jalview.bin.Console.outPrintln("SEQUENCE HAS BEEN DELETED!!!");
}
}
else
{
// JBPNote INFO level debug
- System.err.println(
+ jalview.bin.Console.errPrintln(
"ERROR: calcSeqNum called with out of range sequence index for Alignment\n");
}
}
// tmp = ((max - tmp) * (size - cons2[j][23])) / size;
tmp = ((max - tmp) * (size - cons2GapCounts[j])) / size;
- // System.out.println(tmp+ " " + j);
+ // jalview.bin.Console.outPrintln(tmp+ " " + j);
quality.setElementAt(Double.valueOf(tmp), j);
if (tmp > newmax)
if (matchInDataset != null && xref.getMap().getTo() != null
&& matchInDataset != xref.getMap().getTo())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Implementation problem (reopen JAL-2154): CrossRef.findInDataset seems to have recovered a different sequence than the one explicitly mapped for xref."
+ "Found:" + matchInDataset + "\nExpected:"
+ xref.getMap().getTo() + "\nFor xref:"
retrieved = sftch.getSequences(sourceRefs, !fromDna);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Problem whilst retrieving cross references for Sequence : "
+ seq.getName());
e.printStackTrace();
String msg = "Mapping updated from " + ms.getName()
+ " to retrieved crossreference "
+ matched.getName();
- System.out.println(msg);
+ jalview.bin.Console.outPrintln(msg);
List<DBRefEntry> toRefs = map.getTo().getDBRefs();
if (toRefs != null)
cf.addMap(retrievedSequence, map.getTo(), map.getMap());
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exception when consolidating Mapped sequence set...");
e.printStackTrace(System.err);
}
}
if (dataset.getSequences() == null)
{
- System.err.println("Empty dataset sequence set - NO VECTOR");
+ jalview.bin.Console.errPrintln("Empty dataset sequence set - NO VECTOR");
return false;
}
List<SequenceI> ds = dataset.getSequences();
{
if (nxt.getDatasetSequence() != null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Implementation warning: CrossRef initialised with a dataset alignment with non-dataset sequences in it! ("
+ nxt.getDisplayId(true) + " has ds reference "
+ nxt.getDatasetSequence().getDisplayId(true)
if (rf != 0)
{
final String errMsg = "trimming contigs for incomplete terminal codon.";
- System.err.println(errMsg);
+ jalview.bin.Console.errPrintln(errMsg);
// map and trim contigs to ORF region
vc = scontigs.length - 1;
lastnpos = vismapping.shift(lastnpos); // place npos in context of
InputStream is = getClass().getResourceAsStream(fileName);
if (is == null)
{
- System.err.println("Resource file not found: " + fileName);
+ jalview.bin.Console.errPrintln("Resource file not found: " + fileName);
return;
}
BufferedReader dataIn = new BufferedReader(new InputStreamReader(is));
}
if (codeTables.isEmpty())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"No genetic code tables loaded, check format of file "
+ fileName);
}
InputStream is = getClass().getResourceAsStream(fileName);
if (is == null)
{
- System.err.println("Resource file not found: " + fileName);
+ jalview.bin.Console.errPrintln("Resource file not found: " + fileName);
return;
}
BufferedReader dataIn = new BufferedReader(new InputStreamReader(is));
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected data in " + fileName + ": " + line);
}
}
* seqs.length) { for (int i = 0; i < seqs.length; i++) { if (!hasScore[i])
* { scores[i] = (max + i); } else { int nf=(feats[i]==null) ? 0
* :((SequenceFeature[]) feats[i]).length;
- * System.err.println("Sorting on Score: seq "+seqs[i].getName()+
+ * jalview.bin.Console.errPrintln("Sorting on Score: seq "+seqs[i].getName()+
* " Feats: "+nf+" Score : "+scores[i]); } } }
*
* jalview.util.QuickSort.sort(scores, seqs); } else if
* (int i=0;i<seqs.length; i++) { double nf; scores[i] =
* (0.05+fr*i)+(nf=((feats[i]==null) ? 0.0 :1.0*((SequenceFeature[])
* feats[i]).length));
- * System.err.println("Sorting on Density: seq "+seqs[i].getName()+
+ * jalview.bin.Console.errPrintln("Sorting on Density: seq "+seqs[i].getName()+
* " Feats: "+nf+" Score : "+scores[i]); }
* jalview.util.QuickSort.sort(scores, seqs); } else { if
* (method==FEATURE_LABEL) { throw new Error("Not yet implemented."); } } if
ScoreNames[cols] + ((reps > 0) ? "_" + reps : ""),
ScoreDescriptions[cols], null);
an.setScore(score);
- System.out.println(seqs[i].getName() + " score: '"
+ jalview.bin.Console.outPrintln(seqs[i].getName() + " score: '"
+ ScoreNames[cols] + "' = " + score); // DEBUG
an.setSequenceRef(seqs[i]);
seqs[i].addAlignmentAnnotation(an);
final int open = basePair.getBP5();
final int close = basePair.getBP3();
- // System.out.println("open " + open + " close " + close);
- // System.out.println("lastclose " + lastclose + " lastopen " + lastopen);
+ // jalview.bin.Console.outPrintln("open " + open + " close " + close);
+ // jalview.bin.Console.outPrintln("lastclose " + lastclose + " lastopen " + lastopen);
// we're moving from right to left based on closing pair
/*
{
int popen = bps.get(j).getBP5();
- // System.out.println("j " + j + " popen " + popen + " lastopen "
+ // jalview.bin.Console.outPrintln("j " + j + " popen " + popen + " lastopen "
// +lastopen + " open " + open);
if ((popen < lastopen) && (popen > open))
{
{
if (sfeatures != null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Implementation error: setting dataset sequence for a sequence which has sequence features.\n\tDataset sequence features will not be visible.");
}
sq.setDatasetSequence(seqds);
{
if (!quiet)
{
- System.err.println("Can't find '" + ((String) key)
+ jalview.bin.Console.errPrintln("Can't find '" + ((String) key)
+ "' in uniquified alignment");
}
}
}
if (unmatched.size() > 0 && !quiet)
{
- System.err.println("Did not find matches for :");
+ jalview.bin.Console.errPrintln("Did not find matches for :");
for (Enumeration i = unmatched.elements(); i
.hasMoreElements(); System.out
.println(((SequenceI) i.nextElement()).getName()))
{
if (sequences[j] == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"WARNING: Consensus skipping null sequence - possible race condition.");
continue;
}
{
// if (_lycount<_lylimit)
// {
- // System.err.println("Warning: depth of _recount greater than number of
+ // jalview.bin.Console.errPrintln("Warning: depth of _recount greater than number of
// nodes.");
// }
if (nd == null)
if ((nd.left() == null) && (nd.right() == null))
{
- System.out.println("Leaf = " + ((SequenceI) nd.element()).getName());
- System.out.println("Dist " + nd.dist);
- System.out.println("Boot " + nd.getBootstrap());
+ jalview.bin.Console.outPrintln("Leaf = " + ((SequenceI) nd.element()).getName());
+ jalview.bin.Console.outPrintln("Dist " + nd.dist);
+ jalview.bin.Console.outPrintln("Boot " + nd.getBootstrap());
}
else
{
- System.out.println("Dist " + nd.dist);
+ jalview.bin.Console.outPrintln("Dist " + nd.dist);
printNode((BinaryNode) nd.left());
printNode((BinaryNode) nd.right());
}
}
else
{
- System.out.println(" name = " + ((SequenceI) nd.element()).getName());
+ jalview.bin.Console.outPrintln(" name = " + ((SequenceI) nd.element()).getName());
}
- System.out.println(
+ jalview.bin.Console.outPrintln(
" dist = " + nd.dist + " " + nd.count + " " + nd.height);
}
{
// if (_lycount<_lylimit)
// {
- // System.err.println("Warning: depth of _recount greater than number of
+ // jalview.bin.Console.errPrintln("Warning: depth of _recount greater than number of
// nodes.");
// }
if (nd == null)
return instance;
} catch (InstantiationException | IllegalAccessException e)
{
- System.err.println("Error in " + getClass().getName()
+ jalview.bin.Console.errPrintln("Error in " + getClass().getName()
+ ".getInstance(): " + e.getMessage());
return null;
} catch (ReflectiveOperationException roe)
{
if (c >= symbolIndex.length)
{
- System.err.println(String.format(BAD_ASCII_ERROR, c));
+ jalview.bin.Console.errPrintln(String.format(BAD_ASCII_ERROR, c));
return 0;
}
if (d >= symbolIndex.length)
{
- System.err.println(String.format(BAD_ASCII_ERROR, d));
+ jalview.bin.Console.errPrintln(String.format(BAD_ASCII_ERROR, d));
return 0;
}
return sm;
} catch (IOException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error reading " + resourcePath + ": " + e.getMessage());
}
return null;
ScoreModelI sm2 = models.get(sm.getName());
if (sm2 != null)
{
- System.err.println("Warning: replacing score model " + sm2.getName());
+ jalview.bin.Console.errPrintln("Warning: replacing score model " + sm2.getName());
}
models.put(sm.getName(), sm);
}
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
package jalview.analytics;
+import java.io.BufferedReader;
import java.io.IOException;
+import java.io.InputStreamReader;
import java.io.OutputStream;
import java.io.UnsupportedEncodingException;
+import java.lang.invoke.MethodHandles;
import java.net.HttpURLConnection;
import java.net.MalformedURLException;
import java.net.URL;
import java.util.List;
import java.util.Map;
import java.util.Random;
-import java.util.UUID;
import jalview.bin.Cache;
import jalview.bin.Console;
import jalview.util.ChannelProperties;
+import jalview.util.HttpUtils;
-public class GoogleAnalytics4
+public class Plausible
{
+ private static final String USER_AGENT;
+
private static final String JALVIEW_ID = "Jalview Desktop";
- private static final String SESSION_ID = new Random().toString();
+ private static final String DOMAIN = "jalview.org";
- private static final String MEASUREMENT_ID = "G-6TMPHMXEQ0";
+ private static final String CONFIG_API_BASE_URL = "https://www.jalview.org/services/config/analytics/url";
- private static final String API_SECRET = "Qb9NSbqkRDqizG6j2BBJ2g";
+ private static final String DEFAULT_API_BASE_URL = "https://analytics.jalview.org/api/event";
- // This will generate a different CLIENT_ID each time the application is
- // launched. Do we want to store it in .jalview_properties?
- private static final String CLIENT_ID = UUID.randomUUID().toString();
+ private static final String API_BASE_URL;
- private static final String BASE_URL = "https://www.google-analytics.com/mp/collect";
+ private static final String clientId;
- private static final String DESKTOP_EVENT = "desktop_event";
+ public static final String APPLICATION_BASE_URL = "desktop://localhost";
private List<Map.Entry<String, String>> queryStringValues;
private List<Map.Entry<String, Object>> jsonObject;
- private List<Event> events;
-
private List<Map.Entry<String, String>> cookieValues;
private static boolean ENABLED = false;
- private static GoogleAnalytics4 instance = null;
+ private static boolean DEBUG = true;
- private static final Map<String, String> defaultParams;
+ private static Plausible instance = null;
+
+ private static final Map<String, String> defaultProps;
static
{
- defaultParams = new HashMap<>();
- defaultParams.put("app_name",
+ defaultProps = new HashMap<>();
+ defaultProps.put("app_name",
ChannelProperties.getProperty("app_name") + " Desktop");
- defaultParams.put("version", Cache.getProperty("VERSION"));
- defaultParams.put("build_date",
+ defaultProps.put("version", Cache.getProperty("VERSION"));
+ defaultProps.put("build_date",
Cache.getDefault("BUILD_DATE", "unknown"));
- defaultParams.put("java_version", System.getProperty("java.version"));
+ defaultProps.put("java_version", System.getProperty("java.version"));
String val = System.getProperty("sys.install4jVersion");
if (val != null)
{
- defaultParams.put("install4j_version", val);
+ defaultProps.put("install4j_version", val);
}
val = System.getProperty("installer_template_version");
if (val != null)
{
- defaultParams.put("install4j_template_version", val);
+ defaultProps.put("install4j_template_version", val);
}
val = System.getProperty("launcher_version");
if (val != null)
{
- defaultParams.put("launcher_version", val);
+ defaultProps.put("launcher_version", val);
}
- defaultParams.put("java_arch",
+ defaultProps.put("java_arch",
System.getProperty("os.arch") + " "
+ System.getProperty("os.name") + " "
+ System.getProperty("os.version"));
+ defaultProps.put("os", System.getProperty("os.name"));
+ defaultProps.put("os_version", System.getProperty("os.version"));
+ defaultProps.put("os_arch", System.getProperty("os.arch"));
+ String installation = Cache.applicationProperties
+ .getProperty("INSTALLATION");
+ if (installation != null)
+ {
+ defaultProps.put("installation", installation);
+ }
+
+ // ascertain the API_BASE_URL
+ API_BASE_URL = getAPIBaseURL();
+
+ // random clientId to make User-Agent unique (to register analytic)
+ clientId = String.format("%08x", new Random().nextInt());
+
+ USER_AGENT = HttpUtils.getUserAgent(
+ MethodHandles.lookup().lookupClass().getCanonicalName() + " "
+ + clientId);
}
- private GoogleAnalytics4()
+ private Plausible()
{
this.resetLists();
}
ENABLED = b;
}
- public void sendAnalytics(String eventName, String... paramsStrings)
+ public void sendEvent(String eventName, String urlString,
+ String... propsStrings)
{
- sendAnalytics(eventName, false, paramsStrings);
+ sendEvent(eventName, urlString, false, propsStrings);
}
/**
* The simplest way to send an analytic event.
*
* @param eventName
- * The event name. To emulate a webpage view use "page_view" and set
- * a "page_location" parameter. See
- * https://developers.google.com/analytics/devguides/collection/ga4/events?client_type=gtag
- * @param sendDefaultParams
- * Flag whether to add the default params about the application.
- * @param paramsStrings
+ * The event name. To emulate a webpage view use "pageview" and set a
+ * "url" key/value. See https://plausible.io/docs/events-api
+ * @param sendDefaultProps
+ * Flag whether to add the default props about the application.
+ * @param propsStrings
* Optional multiple Strings in key, value pairs (there should be an
- * even number of paramsStrings) to be set as parameters of the
- * event. To emulate a webpage view use "page_location" as the URL in
- * a "page_view" event.
+ * even number of propsStrings) to be set as property of the event.
+ * To emulate a webpage view set "url" as the URL in a "pageview"
+ * event.
*/
- public void sendAnalytics(String eventName, boolean sendDefaultParams,
- String... paramsStrings)
+ public void sendEvent(String eventName, String urlString,
+ boolean sendDefaultProps, String... propsStrings)
{
// clear out old lists
this.resetLists();
if (!ENABLED)
{
- Console.debug("GoogleAnalytics4 not enabled.");
+ Console.debug("Plausible not enabled.");
return;
}
- Map<String, String> params = new HashMap<>();
- params.put("event_category", DESKTOP_EVENT);
- params.put("event_label", eventName);
+ Map<String, String> props = new HashMap<>();
// add these to all events from this application instance
- if (sendDefaultParams)
+ if (sendDefaultProps)
{
- params.putAll(defaultParams);
+ props.putAll(defaultProps);
}
- // add (and overwrite with) the passed in params
- if (paramsStrings != null && paramsStrings.length > 0)
+ // add (and overwrite with) the passed in props
+ if (propsStrings != null && propsStrings.length > 0)
{
- if (paramsStrings.length % 2 != 0)
+ if (propsStrings.length % 2 != 0)
{
Console.warn(
- "Cannot addEvent with odd number of paramsStrings. Ignoring the last one.");
+ "Cannot addEvent with odd number of propsStrings. Ignoring the last one.");
}
- for (int i = 0; i < paramsStrings.length - 1; i += 2)
+ for (int i = 0; i < propsStrings.length - 1; i += 2)
{
- String key = paramsStrings[i];
- String value = paramsStrings[i + 1];
- params.put(key, value);
+ String key = propsStrings[i];
+ String value = propsStrings[i + 1];
+ props.put(key, value);
}
}
- addEvent(eventName, params);
- addQueryStringValue("measurement_id", MEASUREMENT_ID);
- addQueryStringValue("api_secret", API_SECRET);
- addJsonValue("client_id", CLIENT_ID);
- addJsonValues("events", Event.toObjectList(events));
+ addJsonValue("domain", DOMAIN);
+ addJsonValue("name", eventName);
+ StringBuilder eventUrlSb = new StringBuilder(APPLICATION_BASE_URL);
+ if (!APPLICATION_BASE_URL.endsWith("/") && !urlString.startsWith("/"))
+ {
+ eventUrlSb.append("/");
+ }
+ eventUrlSb.append(urlString);
+ addJsonValue("url", eventUrlSb.toString());
+ addJsonObject("props", props);
StringBuilder urlSb = new StringBuilder();
- urlSb.append(BASE_URL);
- urlSb.append('?');
- urlSb.append(buildQueryString());
+ urlSb.append(API_BASE_URL);
+ String qs = buildQueryString();
+ if (qs != null && qs.length() > 0)
+ {
+ urlSb.append('?');
+ urlSb.append(qs);
+ }
try
{
URL url = new URL(urlSb.toString());
String jsonString = buildJson();
- Console.debug("GA4: HTTP Request is: '" + urlSb.toString() + "'");
- Console.debug("GA4: POSTed JSON is:\n" + jsonString);
+ Console.debug(
+ "Plausible: HTTP Request is: '" + urlSb.toString() + "'");
+ if (DEBUG)
+ {
+ Console.debug("Plausible: User-Agent is: '" + USER_AGENT + "'");
+ }
+ Console.debug("Plausible: POSTed JSON is:\n" + jsonString);
byte[] jsonBytes = jsonString.getBytes(StandardCharsets.UTF_8);
int jsonLength = jsonBytes.length;
httpURLConnection.setFixedLengthStreamingMode(jsonLength);
httpURLConnection.setRequestProperty("Content-Type",
- "application/json; charset=UTF-8");
+ "application/json");
+ httpURLConnection.setRequestProperty("User-Agent", USER_AGENT);
httpURLConnection.connect();
try (OutputStream os = httpURLConnection.getOutputStream())
{
}
int responseCode = httpURLConnection.getResponseCode();
String responseMessage = httpURLConnection.getResponseMessage();
+
if (responseCode < 200 || responseCode > 299)
{
- Console.warn("GoogleAnalytics4 connection failed: '" + responseCode
- + " " + responseMessage + "'");
+ Console.warn("Plausible connection failed: '" + responseCode + " "
+ + responseMessage + "'");
}
else
{
- Console.debug("GoogleAnalytics4 connection succeeded: '"
- + responseCode + " " + responseMessage + "'");
+ Console.debug("Plausible connection succeeded: '" + responseCode
+ + " " + responseMessage + "'");
+ }
+
+ if (DEBUG)
+ {
+ BufferedReader br = new BufferedReader(new InputStreamReader(
+ (httpURLConnection.getInputStream())));
+ StringBuilder sb = new StringBuilder();
+ String response;
+ while ((response = br.readLine()) != null)
+ {
+ sb.append(response);
+ }
+ String body = sb.toString();
+ Console.debug("Plausible response content:\n" + body);
}
} catch (MalformedURLException e)
{
Console.debug(
- "Somehow the GoogleAnalytics4 BASE_URL and queryString is malformed.",
+ "Somehow the Plausible BASE_URL and queryString is malformed: '"
+ + urlSb.toString() + "'",
e);
return;
} catch (IOException e)
{
- Console.debug("Connection to GoogleAnalytics4 BASE_URL '" + BASE_URL
+ Console.debug("Connection to Plausible BASE_URL '" + API_BASE_URL
+ "' failed.", e);
} catch (ClassCastException e)
{
Console.debug(
- "Couldn't cast URLConnection to HttpURLConnection in GoogleAnalytics4.",
+ "Couldn't cast URLConnection to HttpURLConnection in Plausible.",
e);
}
}
- public void addEvent(String name, Map<String, String> params)
+ private void addJsonObject(String key, Map<String, String> map)
{
- Event event = new Event(name);
- if (params != null && params.size() > 0)
+ List<Map.Entry<String, ? extends Object>> list = new ArrayList<>();
+ for (String k : map.keySet())
{
- for (String key : params.keySet())
- {
- String value = params.get(key);
- event.addParam(key, value);
- }
+ list.add(stringEntry(k, map.get(k)));
}
- events.add(event);
+ addJsonObject(key, list);
+
}
private void addJsonObject(String key,
- List<Map.Entry<String, Object>> object)
+ List<Map.Entry<String, ? extends Object>> object)
{
jsonObject.add(objectEntry(key, object));
}
private void resetLists()
{
jsonObject = new ArrayList<>();
- events = new ArrayList<Event>();
queryStringValues = new ArrayList<>();
cookieValues = new ArrayList<>();
}
- public static GoogleAnalytics4 getInstance()
+ public static Plausible getInstance()
{
if (instance == null)
{
- instance = new GoogleAnalytics4();
+ instance = new Plausible();
}
return instance;
}
{
return new AbstractMap.SimpleEntry<String, String>(s, v);
}
-}
-
-class Event
-{
- private String name;
- private List<Map.Entry<String, String>> params;
-
- @SafeVarargs
- public Event(String name, Map.Entry<String, String>... paramEntries)
+ private static String getAPIBaseURL()
{
- this.name = name;
- this.params = new ArrayList<Map.Entry<String, String>>();
- for (Map.Entry<String, String> paramEntry : paramEntries)
+ try
{
- if (paramEntry == null)
+ URL url = new URL(CONFIG_API_BASE_URL);
+ URLConnection urlConnection = url.openConnection();
+ HttpURLConnection httpURLConnection = (HttpURLConnection) urlConnection;
+ httpURLConnection.setRequestMethod("GET");
+ httpURLConnection.setRequestProperty("User-Agent", USER_AGENT);
+ httpURLConnection.setConnectTimeout(5000);
+ httpURLConnection.setReadTimeout(3000);
+ httpURLConnection.connect();
+ int responseCode = httpURLConnection.getResponseCode();
+ String responseMessage = httpURLConnection.getResponseMessage();
+
+ if (responseCode < 200 || responseCode > 299)
{
- continue;
+ Console.warn("Config URL connection to '" + CONFIG_API_BASE_URL
+ + "' failed: '" + responseCode + " " + responseMessage
+ + "'");
}
- params.add(paramEntry);
- }
- }
- public void addParam(String param, String value)
- {
- params.add(GoogleAnalytics4.stringEntry(param, value));
- }
+ BufferedReader br = new BufferedReader(
+ new InputStreamReader((httpURLConnection.getInputStream())));
+ StringBuilder sb = new StringBuilder();
+ String response;
+ while ((response = br.readLine()) != null)
+ {
+ sb.append(response);
+ }
+ if (sb.length() > 7 && sb.substring(0, 5).equals("https"))
+ {
+ return sb.toString();
+ }
- protected List<Map.Entry<String, Object>> toObject()
- {
- List<Map.Entry<String, Object>> object = new ArrayList<>();
- object.add(GoogleAnalytics4.objectEntry("name", (Object) name));
- if (params.size() > 0)
+ } catch (MalformedURLException e)
{
- object.add(GoogleAnalytics4.objectEntry("params", (Object) params));
- }
- return object;
- }
-
- protected static List<Object> toObjectList(List<Event> events)
- {
- List<Object> eventObjectList = new ArrayList<>();
- for (Event event : events)
+ Console.debug("Somehow the config URL is malformed: '"
+ + CONFIG_API_BASE_URL + "'", e);
+ } catch (IOException e)
{
- eventObjectList.add((Object) event.toObject());
+ Console.debug("Connection to Plausible BASE_URL '" + API_BASE_URL
+ + "' failed.", e);
+ } catch (ClassCastException e)
+ {
+ Console.debug(
+ "Couldn't cast URLConnection to HttpURLConnection in Plausible.",
+ e);
}
- return eventObjectList;
+ return DEFAULT_API_BASE_URL;
}
}
/*
- * Jalview - A Sequence Alignment Editor and Viewer (Version 2.8.2b1)
- * Copyright (C) 2014 The Jalview Authors
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
*
* This file is part of Jalview.
*
urlLink = new UrlLink(link);
} catch (Exception foo)
{
- System.err.println("Exception for URLLink '" + link + "': "
+ jalview.bin.Console.errPrintln("Exception for URLLink '" + link + "': "
+ foo.getMessage());
continue;
}
if (!urlLink.isValid())
{
- System.err.println(urlLink.getInvalidMessage());
+ jalview.bin.Console.errPrintln(urlLink.getInvalidMessage());
continue;
}
/*
* When we finally deprecate 1.1 compatibility, we can start to use
* URLEncoder.encode(url,"UTF-8") and then we'll need this catch: catch
- * (UnsupportedEncodingException ex) { System.err.println("WARNING -
+ * (UnsupportedEncodingException ex) { jalview.bin.Console.errPrintln("WARNING -
* IMPLEMENTATION ERROR - UNSUPPORTED ENCODING EXCEPTION FOR "+url);
* ex.printStackTrace(); }
*/
url = viewport.applet.getCodeBase() + url;
} catch (UnsupportedEncodingException ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"WARNING = IMPLEMENTATION ERROR - UNSUPPORTED ENCODING EXCEPTION FOR "
+ url);
ex.printStackTrace();
SequenceI[] oldOrder = viewport.getAlignment().getSequencesArray();
if (viewport.applet.debug)
{
- System.err.println("Sorting " + alorder.getOrder().size()
+ jalview.bin.Console.errPrintln("Sorting " + alorder.getOrder().size()
+ " in alignment '" + getTitle() + "'");
}
AlignmentSorter.sortBy(viewport.getAlignment(), alorder);
{
if (viewport.applet == null)
{
- System.out.println("Not running as applet - no browser available.");
+ jalview.bin.Console.outPrintln("Not running as applet - no browser available.");
}
else
{
viewer = (Viewer) jmolviewer;
} catch (ClassCastException ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unsupported viewer object :" + jmolviewer.getClass());
}
if (viewer == null)
{
- System.err.println("Can't use this object as a structure viewer:"
+ jalview.bin.Console.errPrintln("Can't use this object as a structure viewer:"
+ jmolviewer.getClass());
return null;
}
chains = (String[]) sqch[1];
if (seqs == null || seqs.length == 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"JalviewLite.AlignFrame:newStructureView: No sequence to bind structure to.");
}
if (protocol == null)
}
if (protocol == null)
{
- System.err.println("Couldn't work out protocol to open structure: "
+ jalview.bin.Console.errPrintln("Couldn't work out protocol to open structure: "
+ pdb.getId());
return;
}
.setMapping(seqs, chains, pdb.getFile(), protocol,
null) == null)
{
- System.err.println("Failed to map " + pdb.getFile() + " ("
+ jalview.bin.Console.errPrintln("Failed to map " + pdb.getFile() + " ("
+ protocol + ") to any sequences");
}
return;
}
if (ajm != null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Incremental adding and aligning structure to existing Jmol view not yet implemented.");
// try and add the pdb structure
// ajm.addS
SequenceI[][] seqs, String[][] chains, String[] protocols)
{
// TODO Auto-generated method stub
- System.err.println("Aligned Structure View: Not yet implemented.");
+ jalview.bin.Console.errPrintln("Aligned Structure View: Not yet implemented.");
}
/**
if (!file.isValid())
{
// TODO: raise dialog for gui
- System.err.println("Problems parsing T-Coffee scores: "
+ jalview.bin.Console.errPrintln("Problems parsing T-Coffee scores: "
+ file.getWarningMessage());
- System.err.println("Origin was:\n" + source);
+ jalview.bin.Console.errPrintln("Origin was:\n" + source);
return false;
}
|| aln.getWidth() != file.getWidth()))
{
// TODO: raise a dialog box here rather than bomb out.
- System.err.println(
+ jalview.bin.Console.errPrintln(
"The scores matrix does not match the alignment dimensions");
}
}
else
{
- System.err.println("Problems resolving T-Coffee scores:");
+ jalview.bin.Console.errPrintln("Problems resolving T-Coffee scores:");
if (file.getWarningMessage() != null)
{
- System.err.println(file.getWarningMessage());
+ jalview.bin.Console.errPrintln(file.getWarningMessage());
}
}
return false;
}
if (widthScale <= 1.0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Invalid alignment character width scaling factor ("
+ widthScale + "). Ignoring.");
widthScale = 1;
}
if (JalviewLite.debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Alignment character width scaling factor is now "
+ widthScale);
}
}
if (heightScale <= 1.0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Invalid alignment character height scaling factor ("
+ heightScale + "). Ignoring.");
heightScale = 1;
}
if (JalviewLite.debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Alignment character height scaling factor is now "
+ heightScale);
}
{
if (JalviewLite.debug)
{// DEBUG
- System.out.println(
+ jalview.bin.Console.outPrintln(
"DEBUG: scroll didn't happen - results not within alignment : "
+ seq.getStart() + "," + seq.getEnd());
}
{
// DEBUG
/*
- * System.out.println("DEBUG: scroll: start=" + r[0] +
+ * jalview.bin.Console.outPrintln("DEBUG: scroll: start=" + r[0] +
* " av.getStartRes()=" + av.getStartRes() + " end=" + r[1] +
* " seq.end=" + seq.getEnd() + " av.getEndRes()=" + av.getEndRes() +
* " hextent=" + hextent);
// this is called after loading new annotation onto alignment
if (alignFrame.getSize().height == 0)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"adjustAnnotationHeight frame size zero NEEDS FIXING");
}
fontChanged();
if ((hextent + x) > width)
{
- System.err.println("hextent was " + hextent + " and x was " + x);
+ jalview.bin.Console.errPrintln("hextent was " + hextent + " and x was " + x);
x = width - hextent;
}
if (x < 0)
{
- System.err.println("x was " + x);
+ jalview.bin.Console.errPrintln("x was " + x);
x = 0;
}
public void raiseOOMWarning(String string, OutOfMemoryError error)
{
// TODO: JAL-960
- System.err.println("Out of memory whilst '" + string + "'");
+ jalview.bin.Console.errPrintln("Out of memory whilst '" + string + "'");
error.printStackTrace();
}
"-applet", scriptWindow, null);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't create a jmol viewer. Args to allocate viewer were:\nDocumentBase="
+ ap.av.applet.getDocumentBase() + "\nCodebase="
+ ap.av.applet.getCodeBase());
{
if (jalview.bin.JalviewLite.debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"AppletJmol:Trying to reuse existing PDBfile IO parser.");
}
// re-use the one we opened earlier
{
if (jalview.bin.JalviewLite.debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"AppletJmol:Creating new PDBfile IO parser.");
}
FileParse fp = new FileParse(pdbentry.getFile(), protocol);
} catch (Exception e)
{
// give up!
- System.err.println("Couldn't access pdbentry id="
+ jalview.bin.Console.errPrintln("Couldn't access pdbentry id="
+ pdbentry.getId() + " and file=" + pdbentry.getFile()
+ " using protocol=" + protocol);
e.printStackTrace();
} catch (OutOfMemoryError ex)
{
frame.dispose();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Out of memory when trying to create dialog box with sequence-structure mapping.");
return;
}
{
// This never gets called because we haven't overriden the associated Jmol's
// console
- System.err.println(
+ jalview.bin.Console.errPrintln(
"WARNING: unexpected call to ExtJmol's showConsole method. (showConsole="
+ show);
}
top = pcaModel.getTop();
} catch (OutOfMemoryError x)
{
- System.err.println("Out of memory when calculating PCA.");
+ jalview.bin.Console.errPrintln("Out of memory when calculating PCA.");
return;
}
calcSettings.setEnabled(true);
if (count > 2)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Pairwise alignment scaled similarity score matrix\n");
for (int i = 0; i < count; i++)
("" + i) + " " + seqs[i].getName());
}
- System.out.println("\n");
+ jalview.bin.Console.outPrintln("\n");
for (int i = 0; i < count; i++)
{
}
}
- System.out.println("\n");
+ jalview.bin.Console.outPrintln("\n");
}
}
validate();
sliderValueChanged();
- // System.out.println("blob done "+ (System.currentTimeMillis()-start));
+ // jalview.bin.Console.outPrintln("blob done "+ (System.currentTimeMillis()-start));
}
void sliderValueChanged()
scale = findScale();
- // System.out.println("Scale factor = " + scale);
+ // jalview.bin.Console.outPrintln("Scale factor = " + scale);
addMouseListener(this);
addKeyListener(this);
scale = findScale();
- // System.out.println("New scale = " + scale);
+ // jalview.bin.Console.outPrintln("New scale = " + scale);
img = createImage(getSize().width, getSize().height);
ig = img.getGraphics();
}
else if (evt.getKeyChar() == 's')
{
- System.err.println("DEBUG: Rectangle selection"); // log.debug
+ jalview.bin.Console.errPrintln("DEBUG: Rectangle selection"); // log.debug
if (rectx2 != -1 && recty2 != -1)
{
rectSelect(rectx1, recty1, rectx2, recty2);
@Override
public void updateColours(SequenceI seq, int index)
{
- System.out.println("update the seqPanel colours");
+ jalview.bin.Console.outPrintln("update the seqPanel colours");
// repaint();
}
{
if (av.getAlignment() == null)
{
- System.out.println("Selection message: alignviewport av SeqSetId="
+ jalview.bin.Console.outPrintln("Selection message: alignviewport av SeqSetId="
+ av.getSequenceSetId() + " ViewId=" + av.getViewId()
+ " 's alignment is NULL! returning immediatly.");
return;
if (copycolsel && av.hasHiddenColumns()
&& (av.getColumnSelection() == null))
{
- System.err.println("Bad things");
+ jalview.bin.Console.errPrintln("Bad things");
}
if (repaint)
{
}
else
{
- System.out.println("Original Tree Data not available");
+ jalview.bin.Console.outPrintln("Original Tree Data not available");
}
}
import java.util.Date;
import java.util.Enumeration;
import java.util.HashMap;
+import java.util.List;
import java.util.Locale;
import java.util.Map;
import java.util.Properties;
import javax.swing.LookAndFeel;
import javax.swing.UIManager;
-import jalview.analytics.GoogleAnalytics4;
+import jalview.analytics.Plausible;
import jalview.datamodel.PDBEntry;
import jalview.gui.Preferences;
import jalview.gui.UserDefinedColours;
* service</li>
* <li>QUESTIONNAIRE last questionnaire:responder id string from questionnaire
* service</li>
- * <li>USAGESTATS (false - user prompted) Enable google analytics tracker for
+ * <li>USAGESTATS (false - user prompted) Enable analytics tracker for
* collecting usage statistics</li>
* <li>SHOW_OVERVIEW boolean for overview window display</li>
* <li>ANTI_ALIAS boolean for smooth fonts</li>
fis = new URL(propertiesFile).openStream();
if (!Jalview.quiet())
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Loading jalview properties from : " + propertiesFile);
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Disabling Jalview writing to user's local properties file.");
}
propsAreReadOnly = true;
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println("Error reading properties file: " + ex);
+ jalview.bin.Console
+ .outPrintln("Error reading properties file: " + ex);
}
}
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println("Error reading author details: " + ex);
+ jalview.bin.Console
+ .outPrintln("Error reading author details: " + ex);
authorDetails = null;
}
if (authorDetails == null)
{
if (!Jalview.quiet())
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Non-fatal exception when checking version at "
+ remoteBuildPropertiesUrl + ":");
- System.out.println(ex);
+ jalview.bin.Console.printStackTrace(ex);
}
remoteVersion = getProperty("VERSION");
}
url = Cache.class.getResource(resourcePath).toString();
} catch (Exception ex)
{
- System.err.println("Failed to resolve resource " + resourcePath
+ jalview.bin.Console.errPrintln("Failed to resolve resource " + resourcePath
+ ": " + ex.getMessage());
}
}
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println("Error reading build details: " + ex);
+ jalview.bin.Console
+ .outPrintln("Error reading build details: " + ex);
applicationProperties.remove("VERSION");
}
String codeVersion = getProperty("VERSION");
new BuildDetails(codeVersion, null, codeInstallation);
if (printVersion && reportVersion)
{
- System.out.println(ChannelProperties.getProperty("app_name")
- + " version: " + codeVersion + codeInstallation);
+ jalview.bin.Console
+ .outPrintln(ChannelProperties.getProperty("app_name")
+ + " version: " + codeVersion + codeInstallation);
}
}
} catch (NumberFormatException e)
{
if (!Jalview.quiet())
- System.out.println("Error parsing int property '" + property
- + "' with value '" + string + "'");
+ jalview.bin.Console.outPrintln("Error parsing int property '"
+ + property + "' with value '" + string + "'");
}
}
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Error setting property: " + key + " " + obj + "\n" + ex);
}
return oldValue;
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println("Error saving properties: " + ex);
+ jalview.bin.Console.outPrintln("Error saving properties: " + ex);
}
}
}
}
/**
- * GA tracker object - actually JGoogleAnalyticsTracker null if tracking not
- * enabled.
+ * Initialise the tracker if it is not done already.
*/
- protected static Object tracker = null;
-
- protected static Class trackerfocus = null;
-
- protected static Class jgoogleanalyticstracker = null;
-
- private static boolean useGA4 = true;
-
- /**
- * Initialise the google tracker if it is not done already.
- */
- public static void initGoogleTracker()
+ public static void initAnalytics()
{
- if (useGA4)
- {
- GoogleAnalytics4.setEnabled(true);
+ Plausible.setEnabled(true);
- String appName = ChannelProperties.getProperty("app_name")
- + " Desktop";
- String version = Cache.getProperty("VERSION") + "_"
- + Cache.getDefault("BUILD_DATE", "unknown");
- String path;
- /* we don't want to encode ':' as "%3A" for backward compatibility with the UA setup
- try
- {
- path = "/" + String.join("/", URLEncoder.encode(appName, "UTF-8"),
- URLEncoder.encode(version, "UTF-8"),
- URLEncoder.encode(APPLICATION_STARTED, "UTF-8"));
- } catch (UnsupportedEncodingException e)
- {
- */
- path = ("/" + String.join("/", appName, version, APPLICATION_STARTED))
- .replace(' ', '+');
- /*
- }
- */
- GoogleAnalytics4 ga4 = GoogleAnalytics4.getInstance();
-
- // This will add a page_view similar to the old UA analytics.
- // We probably want to get rid of this once the application_launch event
- // is being processed properly.
- ga4.sendAnalytics("page_view", "page_location", path, "page_title",
- APPLICATION_STARTED);
-
- // This will send a new "application_launch" event with parameters
- // including the old-style "path", the channel name and version
- ga4.sendAnalytics("application_launch", true, "page_location", path);
- }
- else
+ String appName = ChannelProperties.getProperty("app_name") + " Desktop";
+ String version = Cache.getProperty("VERSION") + "_"
+ + Cache.getDefault("BUILD_DATE", "unknown");
+ String path;
+ /* we don't want to encode ':' as "%3A" for backward compatibility with the UA setup
+ try
{
- if (tracker == null)
- {
- if (jgoogleanalyticstracker == null)
- {
- // try to get the tracker class
- try
- {
- jgoogleanalyticstracker = Cache.class.getClassLoader()
- .loadClass(
- "com.boxysystems.jgoogleanalytics.JGoogleAnalyticsTracker");
- trackerfocus = Cache.class.getClassLoader().loadClass(
- "com.boxysystems.jgoogleanalytics.FocusPoint");
- } catch (Exception e)
- {
- Console.debug(
- "com.boxysystems.jgoogleanalytics package is not present - tracking not enabled.");
- tracker = null;
- jgoogleanalyticstracker = null;
- trackerfocus = null;
- return;
- }
- }
- // now initialise tracker
- Exception re = null, ex = null;
- Error err = null;
- String vrs = "No Version Accessible";
- try
- {
- // Google analytics tracking code for Library Finder
- tracker = jgoogleanalyticstracker
- .getConstructor(new Class[]
- { String.class, String.class, String.class })
- .newInstance(new Object[]
- { ChannelProperties.getProperty("app_name") + " Desktop",
- (vrs = Cache.getProperty("VERSION") + "_"
- + Cache.getDefault("BUILD_DATE", "unknown")),
- "UA-9060947-1" });
- jgoogleanalyticstracker
- .getMethod("trackAsynchronously", new Class[]
- { trackerfocus })
- .invoke(tracker, new Object[]
- { trackerfocus
- .getConstructor(new Class[]
- { String.class })
- .newInstance(new Object[]
- { APPLICATION_STARTED }) });
- } catch (RuntimeException e)
- {
- re = e;
- } catch (Exception e)
- {
- ex = e;
- } catch (Error e)
- {
- err = e;
- }
- if (re != null || ex != null || err != null)
- {
- if (re != null)
- {
- Console.debug("Caught runtime exception in googletracker init:",
- re);
- }
- if (ex != null)
- {
- Console.warn(
- "Failed to initialise GoogleTracker for Jalview Desktop with version "
- + vrs,
- ex);
- }
- if (err != null)
- {
- Console.error(
- "Whilst initing GoogleTracker for Jalview Desktop version "
- + vrs,
- err);
- }
- }
- else
- {
- Console.debug("Successfully initialised tracker.");
- }
- }
+ path = "/" + String.join("/", URLEncoder.encode(appName, "UTF-8"),
+ URLEncoder.encode(version, "UTF-8"),
+ URLEncoder.encode(APPLICATION_STARTED, "UTF-8"));
+ } catch (UnsupportedEncodingException e)
+ {
+ */
+ List<String> pathParts = new ArrayList<>();
+ pathParts.add(appName);
+ pathParts.add(version);
+ pathParts.add(APPLICATION_STARTED);
+ path = ("/" + String.join("/", pathParts)).replace(' ', '+');
+ /*
}
+ */
+ Plausible plausible = Plausible.getInstance();
+
+ // This will send a new "application_launch" event with parameters
+ // including the old-style "path", the channel name and version
+ plausible.sendEvent("application_launch", path, true);
}
- private static final String APPLICATION_STARTED = "Application Started.";
+ private static final String APPLICATION_STARTED = "Application Started";
/**
* get the user's default colour if available
return date_format.parse(val);
} catch (Exception ex)
{
- System.err.println("Invalid or corrupt date in property '"
+ jalview.bin.Console.errPrintln("Invalid or corrupt date in property '"
+ propertyName + "' : value was '" + val + "'");
}
}
return Integer.valueOf(val);
} catch (NumberFormatException x)
{
- System.err.println("Invalid integer in property '" + property
+ jalview.bin.Console.errPrintln("Invalid integer in property '" + property
+ "' (value was '" + val + "')");
}
}
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println("Error loading User ColourFile\n" + ex);
+ jalview.bin.Console
+ .outPrintln("Error loading User ColourFile\n" + ex);
}
}
if (!files.equals(coloursFound.toString()))
return null;
if (!file.exists())
{
- System.err.println("Could not load bootstrap preferences file '"
+ jalview.bin.Console.errPrintln("Could not load bootstrap preferences file '"
+ filename + "'");
return null;
}
}
} catch (FileNotFoundException e)
{
- System.err.println("Could not find bootstrap preferences file '"
+ jalview.bin.Console.errPrintln("Could not find bootstrap preferences file '"
+ file.getAbsolutePath() + "'");
} catch (IOException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IOException when loading bootstrap preferences file '"
+ file.getAbsolutePath() + "'");
}
import java.util.ArrayList;
import java.util.Arrays;
import java.util.Collections;
-import java.util.EnumSet;
import java.util.HashMap;
import java.util.Iterator;
import java.util.List;
theseArgsWereParsed &= processLinked(id);
processGroovyScript(id);
boolean processLinkedOkay = theseArgsWereParsed;
-
+
// wait around until alignFrame isn't busy
- AlignFrame af=afMap.get(id);
- while (af!=null && af.getViewport().isCalcInProgress())
+ AlignFrame af = afMap.get(id);
+ while (af != null && af.getViewport().isCalcInProgress())
{
- try {
+ try
+ {
Thread.sleep(25);
- } catch (Exception q) {};
+ } catch (Exception q)
+ {
+ }
+ ;
}
-
+
theseArgsWereParsed &= processImages(id);
if (processLinkedOkay)
theseArgsWereParsed &= processOutput(id);
if (avm == null)
return true;
- /*
- * // script to execute after all loading is completed one way or another String
- * groovyscript = m.get(Arg.GROOVY) == null ? null :
- * m.get(Arg.GROOVY).getValue(); String file = m.get(Arg.OPEN) == null ? null :
- * m.get(Arg.OPEN).getValue(); String data = null; FileFormatI format = null;
- * DataSourceType protocol = null;
- */
+ // set wrap scope here so it can be applied after structures are opened
+ boolean wrap = false;
+
if (avm.containsArg(Arg.APPEND) || avm.containsArg(Arg.OPEN))
{
commandArgsProvided = true;
af = fileLoader.LoadFileWaitTillLoaded(openFile, protocol,
format);
- // wrap alignment?
- boolean wrap = ArgParser.getFromSubValArgOrPref(avm, Arg.WRAP, sv,
- null, "WRAP_ALIGNMENT", false);
- af.getCurrentView().setWrapAlignment(wrap);
-
// colour alignment?
String colour = ArgParser.getFromSubValArgOrPref(avm, av,
Arg.COLOUR, sv, null, "DEFAULT_COLOUR_PROT", "");
if ("" != colour)
{
ColourSchemeI cs = ColourSchemeProperty.getColourScheme(
- af.getViewport(), af.getViewport().getAlignment(), colour);
-
- if (cs==null && !"None".equals(colour))
+ af.getViewport(), af.getViewport().getAlignment(),
+ colour);
+
+ if (cs == null && !"None".equals(colour))
+ {
+ Console.warn(
+ "Couldn't parse '" + colour + "' as a colourscheme.");
+ }
+ else
{
- Console.warn("Couldn't parse '"+colour+"' as a colourscheme.");
- } else {
af.changeColour(cs);
}
Jalview.testoutput(argParser, Arg.COLOUR, "zappo", colour);
false, false);
}
+ // wrap alignment? do this last for formatting reasons
+ wrap = ArgParser.getFromSubValArgOrPref(avm, Arg.WRAP, sv, null,
+ "WRAP_ALIGNMENT", false);
+ // af.setWrapFormat(wrap) is applied after structures are opened for
+ // annotation reasons
+
// store the AlignFrame for this id
afMap.put(id, af);
String sViewer = ArgParser.getFromSubValArgOrPref(avm,
Arg.STRUCTUREVIEWER, Position.AFTER, av, subVals, null,
null, "jmol");
- ViewerType viewerType = null;
- if (!"none".equals(sViewer))
- {
- for (ViewerType v : EnumSet.allOf(ViewerType.class))
- {
- String name = v.name().toLowerCase(Locale.ROOT)
- .replaceAll(" ", "");
- if (sViewer.equals(name))
- {
- viewerType = v;
- break;
- }
- }
- }
+ ViewerType viewerType = ViewerType.getFromString(sViewer);
// TODO use ssFromStructure
StructureViewer sv = StructureChooser
structureFilepath, tft, paeFilepath, false,
ssFromStructure, false, viewerType);
- if (sv==null)
+ if (sv == null)
{
Console.error("Failed to import and open structure view.");
continue;
}
- while (sv.isBusy())
+ try
{
- try {
+ long tries = 1000;
+ while (sv.isBusy() && tries > 0)
+ {
Thread.sleep(25);
+ if (sv.isBusy())
+ {
+ tries--;
+ Console.debug(
+ "Waiting for viewer for " + structureFilepath);
+ }
}
- catch (Exception x)
+ if (tries == 0 && sv.isBusy())
{
-
+ Console.warn(
+ "Gave up waiting for structure viewer to load. Something may have gone wrong.");
}
+ } catch (Exception x)
+ {
+ Console.warn("Exception whilst waiting for structure viewer "
+ + structureFilepath, x);
}
-
+ Console.debug(
+ "Successfully opened viewer for " + structureFilepath);
String structureImageFilename = ArgParser.getValueFromSubValOrArg(
avm, av, Arg.STRUCTUREIMAGE, subVals);
if (sv != null && structureImageFilename != null)
}
BitmapImageSizing userBis = ImageMaker
.parseScaleWidthHeightStrings(scale, width, height);
+ // TODO MAKE THIS VIEWER INDEPENDENT!!
switch (StructureViewer.getViewerType())
{
case JMOL:
try
{
- Thread.sleep(1000);
+ Thread.sleep(1000); // WHY ???
} catch (InterruptedException e)
{
// TODO Auto-generated catch block
if (sview instanceof AppJmol)
{
AppJmol jmol = (AppJmol) sview;
- try {
+ try
+ {
+ Console.debug("Rendering image to " + structureImageFile);
jmol.makePDBImage(structureImageFile, imageType, renderer,
- userBis);
- }
- catch (ImageOutputException ioexc)
+ userBis);
+ Console.debug("Finished Rendering image to "
+ + structureImageFile);
+
+ } catch (ImageOutputException ioexc)
{
- Console.warn("Unexpected error whilst exporting image to "+structureImageFile,ioexc);
+ Console.warn("Unexpected error whilst exporting image to "
+ + structureImageFile, ioexc);
}
}
}
}
+ if (wrap)
+ {
+ AlignFrame af = afMap.get(id);
+ if (af != null)
+ {
+ af.setWrapFormat(wrap, true);
+ }
+ }
+
/*
boolean doShading = avm.getBoolean(Arg.TEMPFAC_SHADING);
if (doShading)
Cache.setProperty("EXPORT_EMBBED_BIOJSON", "false");
Console.info("Writing " + file);
- try {
- switch (type)
+ try
{
-
- case "svg":
- Console.debug("Outputting type '" + type + "' to " + fileName);
- af.createSVG(file, renderer);
- break;
-
- case "png":
- Console.debug("Outputting type '" + type + "' to " + fileName);
- af.createPNG(file, null, userBis);
- break;
-
- case "html":
- Console.debug("Outputting type '" + type + "' to " + fileName);
- HtmlSvgOutput htmlSVG = new HtmlSvgOutput(af.alignPanel);
- htmlSVG.exportHTML(fileName, renderer);
- break;
-
- case "biojs":
- Console.debug("Creating BioJS MSA Viwer HTML file: " + fileName);
- try
- {
- BioJsHTMLOutput.refreshVersionInfo(
- BioJsHTMLOutput.BJS_TEMPLATES_LOCAL_DIRECTORY);
- } catch (URISyntaxException e)
+ switch (type)
{
- e.printStackTrace();
+
+ case "svg":
+ Console.debug("Outputting type '" + type + "' to " + fileName);
+ af.createSVG(file, renderer);
+ break;
+
+ case "png":
+ Console.debug("Outputting type '" + type + "' to " + fileName);
+ af.createPNG(file, null, userBis);
+ break;
+
+ case "html":
+ Console.debug("Outputting type '" + type + "' to " + fileName);
+ HtmlSvgOutput htmlSVG = new HtmlSvgOutput(af.alignPanel);
+ htmlSVG.exportHTML(fileName, renderer);
+ break;
+
+ case "biojs":
+ Console.debug(
+ "Outputting BioJS MSA Viwer HTML file: " + fileName);
+ try
+ {
+ BioJsHTMLOutput.refreshVersionInfo(
+ BioJsHTMLOutput.BJS_TEMPLATES_LOCAL_DIRECTORY);
+ } catch (URISyntaxException e)
+ {
+ e.printStackTrace();
+ }
+ BioJsHTMLOutput bjs = new BioJsHTMLOutput(af.alignPanel);
+ bjs.exportHTML(fileName);
+ break;
+
+ case "eps":
+ Console.debug("Outputting EPS file: " + fileName);
+ af.createEPS(file, renderer);
+ break;
+
+ case "imagemap":
+ Console.debug("Outputting ImageMap file: " + fileName);
+ af.createImageMap(file, name);
+ break;
+
+ default:
+ Console.warn(Arg.IMAGE.argString() + " type '" + type
+ + "' not known. Ignoring");
+ break;
}
- BioJsHTMLOutput bjs = new BioJsHTMLOutput(af.alignPanel);
- bjs.exportHTML(fileName);
- break;
-
- case "eps":
- Console.debug("Creating EPS file: " + fileName);
- af.createEPS(file, name);
- break;
-
- case "imagemap":
- Console.debug("Creating ImageMap file: " + fileName);
- af.createImageMap(file, name);
- break;
-
- default:
- Console.warn(Arg.IMAGE.argString() + " type '" + type
- + "' not known. Ignoring");
- break;
- }
- } catch (Exception ioex) {
- Console.warn("Unexpected error during export",ioex);
+ } catch (Exception ioex)
+ {
+ Console.warn("Unexpected error during export", ioex);
}
}
}
String val = av.getValue();
SubVals subVals = av.getSubVals();
String fileName = subVals.getContent();
+ boolean stdout = ArgParser.STDOUTFILENAME.equals(fileName);
File file = new File(fileName);
boolean overwrite = ArgParser.getFromSubValArgOrPref(avm,
Arg.OVERWRITE, subVals, null, "OVERWRITE_OUTPUT", false);
!Platform.isHeadless());
// if backups is not true then --overwrite must be specified
- if (file.exists() && !(overwrite || backups))
+ if (file.exists() && !(overwrite || backups || stdout))
{
Console.error("Won't overwrite file '" + fileName + "' without "
+ Arg.OVERWRITE.argString() + " or "
}
if (ff == null)
{
- StringBuilder validSB = new StringBuilder();
- for (String f : validFormats)
- {
- if (validSB.length() > 0)
- validSB.append(", ");
- validSB.append(f);
- FileFormatI tff = ffs.forName(f);
- validSB.append(" (");
- validSB.append(tff.getExtensions());
- validSB.append(")");
+ if (stdout)
+ {
+ ff = FileFormat.Fasta;
}
+ else
+ {
+ StringBuilder validSB = new StringBuilder();
+ for (String f : validFormats)
+ {
+ if (validSB.length() > 0)
+ validSB.append(", ");
+ validSB.append(f);
+ FileFormatI tff = ffs.forName(f);
+ validSB.append(" (");
+ validSB.append(tff.getExtensions());
+ validSB.append(")");
+ }
- Jalview.exit("No valid format specified for "
- + Arg.OUTPUT.argString() + ". Valid formats are "
- + validSB.toString() + ".", 1);
- // this return really shouldn't happen
- return false;
+ Jalview.exit("No valid format specified for "
+ + Arg.OUTPUT.argString() + ". Valid formats are "
+ + validSB.toString() + ".", 1);
+ // this return really shouldn't happen
+ return false;
+ }
}
String savedBackupsPreference = Cache
Console.info("Writing " + fileName);
- af.saveAlignment(fileName, ff);
+ af.saveAlignment(fileName, ff, stdout);
Console.debug("Returning backups to " + savedBackupsPreference);
if (savedBackupsPreference != null)
Cache.applicationProperties.put(BackupFiles.ENABLED,
*/
package jalview.bin;
+import java.io.PrintStream;
import java.util.Locale;
import jalview.log.JLogger;
}
else
{
- System.out.println(message);
- t.printStackTrace();
+ outPrintln(message);
+ Console.printStackTrace(t);
}
}
}
else
{
- System.out.println(message);
+ outPrintln(message);
}
}
}
else
{
- System.out.println(message);
- t.printStackTrace();
+ outPrintln(message);
+ Console.printStackTrace(t);
}
}
}
else
{
- System.out.println(message);
+ outPrintln(message);
}
}
}
else
{
- System.out.println(message);
- t.printStackTrace();
+ outPrintln(message);
+ Console.printStackTrace(t);
}
}
}
else
{
- System.out.println(message);
+ outPrintln(message);
}
}
}
else
{
- System.out.println(message);
+ outPrintln(message);
}
}
}
else
{
- System.out.println(message);
- t.printStackTrace();
+ outPrintln(message);
+ Console.printStackTrace(t);
}
}
}
else
{
- System.err.println(message);
+ jalview.bin.Console.errPrintln(message);
}
}
}
else
{
- System.err.println(message);
- t.printStackTrace(System.err);
+ jalview.bin.Console.errPrintln(message);
+ Console.printStackTrace(t);
}
}
}
else
{
- System.err.println(message);
+ jalview.bin.Console.errPrintln(message);
}
}
}
else
{
- System.err.println(message);
- t.printStackTrace(System.err);
+ jalview.bin.Console.errPrintln(message);
+ Console.printStackTrace(t);
}
}
{
if (!Jalview.quiet())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Setting initial log level to " + logLevel.name());
}
Log4j.init(logLevel);
log = JLoggerLog4j.getLogger(Cache.JALVIEW_LOGGER_NAME, logLevel);
} catch (NoClassDefFoundError e)
{
- System.err.println("Could not initialise the logger framework");
- e.printStackTrace();
+ jalview.bin.Console
+ .errPrintln("Could not initialise the logger framework");
+ Console.printStackTrace(e);
}
// Test message
}
}
+ public static void outPrint()
+ {
+ outPrint("");
+ }
+
+ public static void outPrintln()
+ {
+ outPrintln("");
+ }
+
+ public static void outPrint(Object message)
+ {
+ outPrintMessage(message, false, false);
+ }
+
+ public static void outPrint(Object message, boolean forceStdout)
+ {
+ outPrintMessage(message, false, forceStdout);
+ }
+
+ public static void outPrintln(Object message)
+ {
+ outPrintMessage(message, true, false);
+ }
+
+ public static PrintStream outputStream(boolean forceStdout)
+ {
+ // send message to stderr if an output file to stdout is expected
+ if (!forceStdout && Jalview.getInstance() != null
+ && Jalview.getInstance().bootstrapArgs != null
+ && Jalview.getInstance().bootstrapArgs.outputToStdout())
+ {
+ return System.err;
+ }
+ else
+ {
+ return System.out;
+ }
+ }
+
+ public static void outPrintMessage(Object message, boolean newline,
+ boolean forceStdout)
+ {
+ PrintStream ps = outputStream(forceStdout);
+ if (newline)
+ {
+ ps.println(message);
+ }
+ else
+ {
+ ps.print(message);
+ }
+ }
+
+ public static void errPrint()
+ {
+ errPrint("");
+ }
+
+ public static void errPrintln()
+ {
+ errPrintln("");
+ }
+
+ public static void errPrint(Object message)
+ {
+ System.err.print(message);
+ }
+
+ public static void errPrintln(Object message)
+ {
+ System.err.println(message);
+ }
+
+ public static void printStackTrace(Throwable t)
+ {
+ // send message to stderr if output to stdout is expected
+ t.printStackTrace(System.err);
+ }
+
public final static String LOGGING_TEST_MESSAGE = "Logging to STDERR";
-}
+}
\ No newline at end of file
} catch (NoClassDefFoundError e)
{
// com.sun.management.OperatingSystemMXBean doesn't exist in this JVM
- System.err.println(
+ jalview.bin.Console.errPrintln(
"No com.sun.management.OperatingSystemMXBean: cannot get total physical memory size");
}
*/
package jalview.bin;
-import java.util.Locale;
-
import java.awt.HeadlessException;
+import java.util.Locale;
public class HiDPISetting
{
}
} catch (NumberFormatException e)
{
- System.err.println(setHiDPIScalePropertyName + " property give ("
- + setHiDPIScaleProperty + ") but not parseable as integer");
+ jalview.bin.Console.errPrintln(setHiDPIScalePropertyName
+ + " property give (" + setHiDPIScaleProperty
+ + ") but not parseable as integer");
}
}
if (setHiDPI && setHiDPIScale > 0)
try
{
int existingPropertyVal = Integer.parseInt(existingProperty);
- System.out.println("Existing " + scalePropertyName + " is "
- + existingPropertyVal);
+ jalview.bin.Console.outPrintln("Existing " + scalePropertyName
+ + " is " + existingPropertyVal);
if (existingPropertyVal > 1)
{
setHiDPIScale(existingPropertyVal);
}
} catch (NumberFormatException e)
{
- System.out.println("Could not convert property " + scalePropertyName
- + " vale '" + existingProperty + "' to number");
+ jalview.bin.Console.outPrintln(
+ "Could not convert property " + scalePropertyName
+ + " vale '" + existingProperty + "' to number");
}
}
dpi = screenInfo.getScreenResolution();
} catch (HeadlessException e)
{
- System.err.println("Cannot get screen resolution: " + e.getMessage());
+ if (isLinux)
+ {
+ jalview.bin.Console.errPrintln(
+ "Cannot get screen resolution: " + e.getMessage());
+ }
}
// try and get screen size height and width
mindimension = Math.min(height, width);
} catch (HeadlessException e)
{
- System.err.println(
- "Cannot get screen size height and width:" + e.getMessage());
+ if (isLinux)
+ {
+ jalview.bin.Console
+ .errPrintln("Cannot get screen size height and width:"
+ + e.getMessage());
+ }
}
// attempt at a formula for scaling based on screen dpi and mindimension.
*
*/
{
- System.out.println("not in js");
+ Console.outPrintln("not in js");
}
// BH - for event debugging in JavaScript (Java mode only)
}.start();
}
- if (!quiet() || bootstrapArgs.contains(Arg.VERSION))
+ if (!quiet() || !bootstrapArgs.outputToStdout()
+ || bootstrapArgs.contains(Arg.VERSION))
{
- System.out.println(
+ Console.outPrintln(
"Java version: " + System.getProperty("java.version"));
- System.out.println("Java home: " + System.getProperty("java.home"));
- System.out.println("Java arch: " + System.getProperty("os.arch") + " "
+ Console.outPrintln("Java home: " + System.getProperty("java.home"));
+ Console.outPrintln("Java arch: " + System.getProperty("os.arch") + " "
+ System.getProperty("os.name") + " "
+ System.getProperty("os.version"));
String val = System.getProperty("sys.install4jVersion");
if (val != null)
{
- System.out.println("Install4j version: " + val);
+ Console.outPrintln("Install4j version: " + val);
}
val = System.getProperty("installer_template_version");
if (val != null)
{
- System.out.println("Install4j template version: " + val);
+ Console.outPrintln("Install4j template version: " + val);
}
val = System.getProperty("launcher_version");
if (val != null)
{
- System.out.println("Launcher version: " + val);
+ Console.outPrintln("Launcher version: " + val);
}
}
// register SIGTERM listener
Runtime.getRuntime().addShutdownHook(new Thread()
{
+ @Override
public void run()
{
Console.debug("Running shutdown hook");
Cache.loadProperties(usrPropsFile);
if (usrPropsFile != null)
{
- System.out.println(
+ Console.outPrintln(
"CMD [-props " + usrPropsFile + "] executed successfully!");
testoutput(bootstrapArgs, Arg.PROPS,
"test/jalview/bin/testProps.jvprops", usrPropsFile);
{
List<Map.Entry<Type, String>> helpArgs = bootstrapArgs
.getList(Arg.HELP);
- System.out.println(Arg.usage(helpArgs.stream().map(e -> e.getKey())
+ Console.outPrintln(Arg.usage(helpArgs.stream().map(e -> e.getKey())
.collect(Collectors.toList())));
Jalview.exit(null, 0);
}
* Now using new usage statement.
showUsage();
*/
- System.out.println(Arg.usage());
+ Console.outPrintln(Arg.usage());
Jalview.exit(null, 0);
}
try
{
Jws2Discoverer.getDiscoverer().setPreferredUrl(jabawsUrl);
- System.out.println(
+ Console.outPrintln(
"CMD [-jabaws " + jabawsUrl + "] executed successfully!");
testoutput(bootstrapArgs, Arg.JABAWS,
"http://www.compbio.dundee.ac.uk/jabaws", jabawsUrl);
} catch (MalformedURLException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Invalid jabaws parameter: " + jabawsUrl + " ignored");
}
}
}
else
{
- System.out.println("Executing setprop argument: " + setprop);
+ jalview.bin.Console
+ .errPrintln("Executing setprop argument: " + setprop);
if (Platform.isJS())
{
Cache.setProperty(setprop.substring(0, p),
{
headless = true;
}
- System.setProperty("http.agent",
- "Jalview Desktop/" + Cache.getDefault("VERSION", "Unknown"));
+ System.setProperty("http.agent", HttpUtils.getUserAgent());
try
{
}
else
{
- System.out.println("CMD [-nousagestats] executed successfully!");
+ Console.outPrintln("CMD [-nousagestats] executed successfully!");
testoutput(argparser, Arg.NOUSAGESTATS);
}
// questionnaire
Console.debug("Starting questionnaire url at " + url);
desktop.checkForQuestionnaire(url);
- System.out.println("CMD questionnaire[-" + url
+ Console.outPrintln("CMD questionnaire[-" + url
+ "] executed successfully!");
}
else
}
else
{
- System.out
- .println("CMD [-noquestionnaire] executed successfully!");
+ Console.outPrintln(
+ "CMD [-noquestionnaire] executed successfully!");
testoutput(argparser, Arg.QUESTIONNAIRE);
}
// Run Commands from cli
cmds = new Commands(argparser, headlessArg);
boolean commandsSuccess = cmds.argsWereParsed();
+
if (commandsSuccess)
{
if (headlessArg)
.getString("status.processing_commandline_args"),
progress = System.currentTimeMillis());
}
- System.out.println("CMD [-open " + file + "] executed successfully!");
+ Console.outPrintln("CMD [-open " + file + "] executed successfully!");
if (!Platform.isJS())
/**
format);
if (af == null)
{
- System.out.println("error");
+ Console.outPrintln("error");
}
else
{
if (cs != null)
{
- System.out.println(
+ Console.outPrintln(
"CMD [-colour " + data + "] executed successfully!");
}
af.changeColour(cs);
{
af.parseFeaturesFile(data,
AppletFormatAdapter.checkProtocol(data));
- // System.out.println("Added " + data);
- System.out.println(
+ // Console.outPrintln("Added " + data);
+ Console.outPrintln(
"CMD groups[-" + data + "] executed successfully!");
}
data = aparser.getValue("features", true);
{
af.parseFeaturesFile(data,
AppletFormatAdapter.checkProtocol(data));
- // System.out.println("Added " + data);
- System.out.println(
+ // Console.outPrintln("Added " + data);
+ Console.outPrintln(
"CMD [-features " + data + "] executed successfully!");
}
if (data != null)
{
af.loadJalviewDataFile(data, null, null, null);
- // System.out.println("Added " + data);
- System.out.println(
+ // Console.outPrintln("Added " + data);
+ Console.outPrintln(
"CMD [-annotations " + data + "] executed successfully!");
}
// set or clear the sortbytree flag.
af.getViewport().setSortByTree(true);
if (af.getViewport().getSortByTree())
{
- System.out.println("CMD [-sortbytree] executed successfully!");
+ Console.outPrintln("CMD [-sortbytree] executed successfully!");
}
}
if (aparser.contains("no-annotation"))
af.getViewport().setShowAnnotation(false);
if (!af.getViewport().isShowAnnotation())
{
- System.out.println("CMD no-annotation executed successfully!");
+ Console.outPrintln("CMD no-annotation executed successfully!");
}
}
if (aparser.contains("nosortbytree"))
af.getViewport().setSortByTree(false);
if (!af.getViewport().getSortByTree())
{
- System.out
- .println("CMD [-nosortbytree] executed successfully!");
+ Console.outPrintln(
+ "CMD [-nosortbytree] executed successfully!");
}
}
data = aparser.getValue("tree", true);
{
try
{
- System.out.println(
+ Console.outPrintln(
"CMD [-tree " + data + "] executed successfully!");
NewickFile nf = new NewickFile(data,
AppletFormatAdapter.checkProtocol(data));
.setCurrentTree(af.showNewickTree(nf, data).getTree());
} catch (IOException ex)
{
- System.err.println("Couldn't add tree " + data);
+ jalview.bin.Console.errPrintln("Couldn't add tree " + data);
ex.printStackTrace(System.err);
}
}
{
// Execute the groovy script after we've done all the rendering stuff
// and before any images or figures are generated.
- System.out.println("Executing script " + groovyscript);
+ Console.outPrintln("Executing script " + groovyscript);
executeGroovyScript(groovyscript, af);
- System.out.println("CMD groovy[" + groovyscript
+ Console.outPrintln("CMD groovy[" + groovyscript
+ "] executed successfully!");
groovyscript = null;
}
if (outputFormat.equalsIgnoreCase("png"))
{
- System.out.println("Creating PNG image: " + file);
+ Console.outPrintln("Creating PNG image: " + file);
af.createPNG(new File(file));
imageName = (new File(file)).getName();
continue;
}
else if (outputFormat.equalsIgnoreCase("svg"))
{
- System.out.println("Creating SVG image: " + file);
+ Console.outPrintln("Creating SVG image: " + file);
File imageFile = new File(file);
imageName = imageFile.getName();
af.createSVG(imageFile);
imageName = imageFile.getName();
HtmlSvgOutput htmlSVG = new HtmlSvgOutput(af.alignPanel);
- System.out.println("Creating HTML image: " + file);
+ Console.outPrintln("Creating HTML image: " + file);
htmlSVG.exportHTML(file);
continue;
}
{
if (file == null)
{
- System.err.println("The output html file must not be null");
+ jalview.bin.Console.errPrintln(
+ "The output html file must not be null");
return;
}
try
e.printStackTrace();
}
BioJsHTMLOutput bjs = new BioJsHTMLOutput(af.alignPanel);
- System.out.println(
+ Console.outPrintln(
"Creating BioJS MSA Viwer HTML file: " + file);
bjs.exportHTML(file);
continue;
}
else if (outputFormat.equalsIgnoreCase("imgMap"))
{
- System.out.println("Creating image map: " + file);
+ Console.outPrintln("Creating image map: " + file);
af.createImageMap(new File(file), imageName);
continue;
}
else if (outputFormat.equalsIgnoreCase("eps"))
{
File outputFile = new File(file);
- System.out.println(
+ Console.outPrintln(
"Creating EPS file: " + outputFile.getAbsolutePath());
af.createEPS(outputFile);
continue;
outFormat = FileFormats.getInstance().forName(outputFormat);
} catch (Exception formatP)
{
- System.out.println("Couldn't parse " + outFormat
+ Console.outPrintln("Couldn't parse " + outFormat
+ " as a valid Jalview format string.");
}
if (outFormat != null)
{
if (!outFormat.isWritable())
{
- System.out.println(
+ Console.outPrintln(
"This version of Jalview does not support alignment export as "
+ outputFormat);
}
af.saveAlignment(file, outFormat);
if (af.isSaveAlignmentSuccessful())
{
- System.out.println("Written alignment in "
+ Console.outPrintln("Written alignment in "
+ outFormat.getName() + " format to " + file);
}
else
{
- System.out.println("Error writing file " + file + " in "
+ Console.outPrintln("Error writing file " + file + " in "
+ outFormat.getName() + " format!!");
}
}
}
} catch (ImageOutputException ioexc)
{
- System.out.println(
+ Console.outPrintln(
"Unexpected error whilst exporting image to " + file);
ioexc.printStackTrace();
}
while (aparser.getSize() > 0)
{
- System.out.println("Unknown arg: " + aparser.nextValue());
+ Console.outPrintln("Unknown arg: " + aparser.nextValue());
}
}
}
{
if (Cache.groovyJarsPresent())
{
- System.out.println("Executing script " + groovyscript);
+ Console.outPrintln("Executing script " + groovyscript);
executeGroovyScript(groovyscript, startUpAlframe);
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Sorry. Groovy Support is not available, so ignoring the provided groovy script "
+ groovyscript);
}
UIManager.put("TabbedPane.tabType", "card");
UIManager.put("TabbedPane.showTabSeparators", true);
UIManager.put("TabbedPane.showContentSeparator", true);
- UIManager.put("TabbedPane.tabSeparatorsFullHeight", true);
+ // UIManager.put("TabbedPane.tabSeparatorsFullHeight", true);
UIManager.put("TabbedPane.tabsOverlapBorder", true);
UIManager.put("TabbedPane.hasFullBorder", true);
UIManager.put("TabbedPane.tabLayoutPolicy", "scroll");
/*
private static void showUsage()
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Usage: jalview -open [FILE] [OUTPUT_FORMAT] [OUTPUT_FILE]\n\n"
+ "-nodisplay\tRun Jalview without User Interface.\n"
+ "-props FILE\tUse the given Jalview properties file instead of users default.\n"
+ "-questionnaire URL\tQueries the given URL for information about any Jalview user questionnaires.\n"
+ "-noquestionnaire\tTurn off questionnaire check.\n"
+ "-nonews\tTurn off check for Jalview news.\n"
- + "-nousagestats\tTurn off google analytics tracking for this session.\n"
+ + "-nousagestats\tTurn off analytics tracking for this session.\n"
+ "-sortbytree OR -nosortbytree\tEnable or disable sorting of the given alignment by the given tree\n"
// +
// "-setprop PROPERTY=VALUE\tSet the given Jalview property,
*/
PromptUserConfig prompter = new PromptUserConfig(Desktop.desktop,
"USAGESTATS",
- MessageManager.getString("prompt.google_analytics_title"),
- MessageManager.getString("prompt.google_analytics"),
+ MessageManager.getString("prompt.plausible_analytics_title"),
+ MessageManager.getString("prompt.plausible_analytics"),
new Runnable()
{
@Override
public void run()
{
- Console.debug(
- "Initialising googletracker for usage stats.");
- Cache.initGoogleTracker();
+ Console.debug("Initialising analytics for usage stats.");
+ Cache.initAnalytics();
Console.debug("Tracking enabled.");
}
}, new Runnable()
@Override
public void run()
{
- Console.debug("Not enabling Google Tracking.");
+ Console.debug("Not enabling analytics.");
}
}, null, true);
desktop.addDialogThread(prompter);
} catch (Exception ex)
{
- System.err.println("Failed to read from STDIN into tempfile "
- + ((tfile == null) ? "(tempfile wasn't created)"
- : tfile.toString()));
+ jalview.bin.Console
+ .errPrintln("Failed to read from STDIN into tempfile "
+ + ((tfile == null) ? "(tempfile wasn't created)"
+ : tfile.toString()));
ex.printStackTrace();
return;
}
sfile = tfile.toURI().toURL();
} catch (Exception x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected Malformed URL Exception for temporary file created from STDIN: "
+ tfile.toURI());
x.printStackTrace();
tfile = new File(groovyscript);
if (!tfile.exists())
{
- System.err.println("File '" + groovyscript + "' does not exist.");
+ jalview.bin.Console.errPrintln(
+ "File '" + groovyscript + "' does not exist.");
return;
}
if (!tfile.canRead())
{
- System.err.println("File '" + groovyscript + "' cannot be read.");
+ jalview.bin.Console.errPrintln(
+ "File '" + groovyscript + "' cannot be read.");
return;
}
if (tfile.length() < 1)
{
- System.err.println("File '" + groovyscript + "' is empty.");
+ jalview.bin.Console
+ .errPrintln("File '" + groovyscript + "' is empty.");
return;
}
try
sfile = tfile.getAbsoluteFile().toURI().toURL();
} catch (Exception ex)
{
- System.err.println("Failed to create a file URL for "
+ jalview.bin.Console.errPrintln("Failed to create a file URL for "
+ tfile.getAbsoluteFile());
return;
}
}
} catch (Exception e)
{
- System.err.println("Exception Whilst trying to execute file " + sfile
- + " as a groovy script.");
+ jalview.bin.Console
+ .errPrintln("Exception Whilst trying to execute file " + sfile
+ + " as a groovy script.");
e.printStackTrace(System.err);
}
{
if (exitcode == 0)
{
- System.out.println(message);
+ Console.outPrintln(message);
}
else
{
- System.err.println(message);
+ jalview.bin.Console.errPrintln(message);
}
}
}
if (yes && ((s1 == null && s2 == null)
|| (s1 != null && s1.equals(s2))))
{
- System.out.println("[TESTOUTPUT] arg " + a.argString() + "='" + s1
+ Console.outPrintln("[TESTOUTPUT] arg " + a.argString() + "='" + s1
+ "' was set");
}
}
{
message = a.argString() + (yes ? " was set" : " was not set");
}
- System.out.println("[TESTOUTPUT] arg " + message);
+ Console.outPrintln("[TESTOUTPUT] arg " + message);
}
}
{
if (debug)
{
- System.err.println("Selecting region using separator string '"
+ jalview.bin.Console.errPrintln("Selecting region using separator string '"
+ separator + "'");
}
}
from--;
} catch (NumberFormatException ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"ERROR: Couldn't parse first integer in range element column selection string '"
+ cl + "' - format is 'from-to'");
return;
to--;
} catch (NumberFormatException ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"ERROR: Couldn't parse second integer in range element column selection string '"
+ cl + "' - format is 'from-to'");
return;
}
if (debug)
{
- System.err.println("Range '" + cl + "' deparsed as [" + from
+ jalview.bin.Console.errPrintln("Range '" + cl + "' deparsed as [" + from
+ "," + to + "]");
}
}
else
{
- System.err.println("ERROR: Invalid Range '" + cl
+ jalview.bin.Console.errPrintln("ERROR: Invalid Range '" + cl
+ "' deparsed as [" + from + "," + to + "]");
}
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"ERROR: Couldn't parse integer from point selection element of column selection string '"
+ cl + "'");
return;
csel.addElement(r);
if (debug)
{
- System.err.println("Point selection '" + cl
+ jalview.bin.Console.errPrintln("Point selection '" + cl
+ "' deparsed as [" + r + "]");
}
}
else
{
- System.err.println("ERROR: Invalid Point selection '" + cl
+ jalview.bin.Console.errPrintln("ERROR: Invalid Point selection '" + cl
+ "' deparsed as [" + r + "]");
}
}
listener = listener.trim();
if (listener.length() == 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"jalview Javascript error: Ignoring empty function for mouseover listener.");
return;
}
.addStructureViewerListener(mol);
if (debug)
{
- System.err.println("Added a mouseover listener for "
+ jalview.bin.Console.errPrintln("Added a mouseover listener for "
+ ((af == null) ? "All frames"
: "Just views for "
+ af.getAlignViewport().getSequenceSetId()));
- System.err.println("There are now " + javascriptListeners.size()
+ jalview.bin.Console.errPrintln("There are now " + javascriptListeners.size()
+ " listeners in total.");
}
}
listener = listener.trim();
if (listener.length() == 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"jalview Javascript error: Ignoring empty function for selection listener.");
return;
}
.addSelectionListener(mol);
if (debug)
{
- System.err.println("Added a selection listener for "
+ jalview.bin.Console.errPrintln("Added a selection listener for "
+ ((af == null) ? "All frames"
: "Just views for "
+ af.getAlignViewport().getSequenceSetId()));
- System.err.println("There are now " + javascriptListeners.size()
+ jalview.bin.Console.errPrintln("There are now " + javascriptListeners.size()
+ " listeners in total.");
}
}
listener = listener.trim();
if (listener.length() == 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"jalview Javascript error: Ignoring empty function for selection listener.");
return;
}
.addStructureViewerListener(mol);
if (debug)
{
- System.err.println("Added a javascript structure viewer listener '"
+ jalview.bin.Console.errPrintln("Added a javascript structure viewer listener '"
+ listener + "'");
- System.err.println("There are now " + javascriptListeners.size()
+ jalview.bin.Console.errPrintln("There are now " + javascriptListeners.size()
+ " listeners in total.");
}
}
rprt = debug;
if (debug)
{
- System.err.println("Removed listener '" + listener + "'");
+ jalview.bin.Console.errPrintln("Removed listener '" + listener + "'");
}
}
else
}
if (rprt)
{
- System.err.println("There are now " + javascriptListeners.size()
+ jalview.bin.Console.errPrintln("There are now " + javascriptListeners.size()
+ " listeners in total.");
}
}
@Override
public void stop()
{
- System.err.println("Applet " + getName() + " stop().");
+ jalview.bin.Console.errPrintln("Applet " + getName() + " stop().");
tidyUp();
}
@Override
public void destroy()
{
- System.err.println("Applet " + getName() + " destroy().");
+ jalview.bin.Console.errPrintln("Applet " + getName() + " destroy().");
tidyUp();
}
}
} catch (NumberFormatException e)
{
- System.err.println("Ignoring invalid residue number string '"
+ jalview.bin.Console.errPrintln("Ignoring invalid residue number string '"
+ pdbResNum + "'");
}
} catch (Exception ex)
{
- System.err.println("Couldn't parse integer arguments (topRow='"
+ jalview.bin.Console.errPrintln("Couldn't parse integer arguments (topRow='"
+ topRow + "' and leftHandColumn='" + leftHandColumn
+ "')");
ex.printStackTrace();
} catch (Exception ex)
{
- System.err.println("Couldn't parse integer arguments (topRow='"
+ jalview.bin.Console.errPrintln("Couldn't parse integer arguments (topRow='"
+ topRow + "')");
ex.printStackTrace();
}
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't parse integer arguments (leftHandColumn='"
+ leftHandColumn + "')");
ex.printStackTrace();
{
if (debug)
{
- System.err.println("Applet context is '"
+ jalview.bin.Console.errPrintln("Applet context is '"
+ getAppletContext().getClass().toString() + "'");
}
JSObject scriptObject = JSObject.getWindow(this);
if (debug && scriptObject != null)
{
- System.err.println("Applet has Javascript callback support.");
+ jalview.bin.Console.errPrintln("Applet has Javascript callback support.");
}
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning: No JalviewLite javascript callbacks available.");
if (debug)
{
if (debug)
{
- System.err.println("JalviewLite Version " + getVersion());
- System.err.println("Build Date : " + getBuildDate());
- System.err.println("Installation : " + getInstallation());
+ jalview.bin.Console.errPrintln("JalviewLite Version " + getVersion());
+ jalview.bin.Console.errPrintln("Build Date : " + getBuildDate());
+ jalview.bin.Console.errPrintln("Installation : " + getInstallation());
}
String externalsviewer = getParameter("externalstructureviewer");
if (externalsviewer != null)
separator = sep;
if (debug)
{
- System.err.println("Separator set to '" + separator + "'");
+ jalview.bin.Console.errPrintln("Separator set to '" + separator + "'");
}
}
else
{
if (tries > 0)
{
- System.err.println("LiveConnect request thread going to sleep.");
+ jalview.bin.Console.errPrintln("LiveConnect request thread going to sleep.");
}
try
{
;
if (tries++ > 0)
{
- System.err.println("LiveConnect request thread woken up.");
+ jalview.bin.Console.errPrintln("LiveConnect request thread woken up.");
}
try
{
}
} catch (Exception jsex)
{
- System.err.println("Attempt " + tries
+ jalview.bin.Console.errPrintln("Attempt " + tries
+ " to access LiveConnect javascript failed.");
}
}
"Calling oninit callback '" + initjscallback + "'.");
} catch (Exception e)
{
- System.err.println("Exception when executing _oninit callback '"
+ jalview.bin.Console.errPrintln("Exception when executing _oninit callback '"
+ initjscallback + "'.");
e.printStackTrace();
}
}
else
{
- System.err.println("Not executing _oninit callback '"
+ jalview.bin.Console.errPrintln("Not executing _oninit callback '"
+ initjscallback + "' - no scripting allowed.");
}
}
((AlignFrame) frame).viewport.applet.currentAlignFrame = (AlignFrame) frame;
if (debug)
{
- System.err.println("Activated window " + frame);
+ jalview.bin.Console.errPrintln("Activated window " + frame);
}
}
// be good.
*
* public void windowDeactivated(WindowEvent e) { if (currentAlignFrame ==
* frame) { currentAlignFrame = null; if (debug) {
- * System.err.println("Deactivated window "+frame); } }
+ * jalview.bin.Console.errPrintln("Deactivated window "+frame); } }
* super.windowDeactivated(e); }
*/
});
}
if (!jmolAvailable)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Jmol not available - Using mc_view for structures");
}
} catch (java.lang.ClassNotFoundException ex)
jmolAvailable = false;
if (debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Skipping Jmol check. Will use mc_view (probably)");
}
}
{
if (JalviewLite.debug)
{
- System.err.println(msg);
+ jalview.bin.Console.errPrintln(msg);
}
}
{
if (debug)
{
- System.err.println("Prepended document base '" + documentBase
+ jalview.bin.Console.errPrintln("Prepended document base '" + documentBase
+ "' to make: '" + withDocBase + "'");
}
protocol = DataSourceType.URL;
protocol = DataSourceType.URL;
if (debug)
{
- System.err.println("Prepended codebase '" + codeBase
+ jalview.bin.Console.errPrintln("Prepended codebase '" + codeBase
+ "' to make: '" + withCodeBase + "'");
}
return withCodeBase;
+ " as "
+ (al1.isNucleotide() ? "protein product" : "cDNA")
+ " for " + af.getTitle();
- System.err.println(msg);
+ jalview.bin.Console.errPrintln(msg);
}
}
dbgMsg(">>>Dump finished.");
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exception when trying to dump the content of the file parameter.");
e.printStackTrace();
}
{
// this may not really be a problem but we give a warning
// anyway
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning: Possible input parsing error: Null sequence for attachment of PDB (sequence "
+ i + ")");
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Annotations were not added from annotation file '"
+ param + "'");
}
{
if (debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Attempting to load T-COFFEE score file from the scoreFile parameter");
}
result = alignFrame.loadScoreFile(sScoreFile);
if (!result)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to parse T-COFFEE parameter as a valid score file ('"
+ sScoreFile + "')");
}
boolean rtn = (getClass().getResourceAsStream("/" + f) != null);
if (debug)
{
- System.err.println("Resource '" + f + "' was "
+ jalview.bin.Console.errPrintln("Resource '" + f + "' was "
+ (rtn ? "" : "not ") + "located by classloader.");
}
return rtn;
} catch (Exception ex)
{
- System.out.println("Exception checking resources: " + f + " " + ex);
+ jalview.bin.Console.outPrintln("Exception checking resources: " + f + " " + ex);
return false;
}
}
{
return initialAlignFrame;
}
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Implementation error: Jalview Applet API cannot work out which AlignFrame to use.");
return null;
}
jv.removeAllElements();
if (debug)
{
- System.err.println("Array from '" + separator
+ jalview.bin.Console.errPrintln("Array from '" + separator
+ "' separated List:\n" + v.length);
for (int i = 0; i < v.length; i++)
{
- System.err.println("item " + i + " '" + v[i] + "'");
+ jalview.bin.Console.errPrintln("item " + i + " '" + v[i] + "'");
}
}
return v;
}
if (debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Empty Array from '" + separator + "' separated List");
}
return null;
{
System.err
.println("Returning '" + separator + "' separated List:\n");
- System.err.println(v);
+ jalview.bin.Console.errPrintln(v);
}
return v.toString();
}
if (debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Returning empty '" + separator + "' separated List\n");
}
return "" + separator;
this.separator = separator;
if (debug)
{
- System.err.println("Default Separator now: '" + separator + "'");
+ jalview.bin.Console.errPrintln("Default Separator now: '" + separator + "'");
}
}
Color col = ColorUtils.parseColourString(colprop);
if (col == null)
{
- System.err.println("Couldn't parse '" + colprop + "' as a colour for "
+ jalview.bin.Console.errPrintln("Couldn't parse '" + colprop + "' as a colour for "
+ colparam);
}
return (col == null) ? defcolour : col;
}
if (debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"resolveUrlForLocalOrAbsolute returning " + resolvedPath);
}
return resolvedPath;
: getDocumentBase());
if (debug)
{
- System.err.println("Show url (prepended " + prepend
+ jalview.bin.Console.errPrintln("Show url (prepended " + prepend
+ " - toggle resolvetocodebase if code/docbase resolution is wrong): "
+ url);
}
{
if (debug)
{
- System.err.println("Show url: " + url);
+ jalview.bin.Console.errPrintln("Show url: " + url);
}
}
if (url.indexOf("javascript:") == 0)
DataSourceType protocol = null;
try
{
- System.out.println("Loading thread started with:\n>>file\n" + file
+ jalview.bin.Console.outPrintln("Loading thread started with:\n>>file\n" + file
+ ">>endfile");
// This might throw a security exception in certain browsers
// Netscape Communicator for instance.
rtn = true;
is.close();
}
- System.err.println("Resource '" + file + "' was "
+ jalview.bin.Console.errPrintln("Resource '" + file + "' was "
+ (rtn ? "" : "not") + " located by classloader.");
if (rtn)
{
} catch (Exception ex)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Exception checking resources: " + file + " " + ex);
}
if (file.indexOf("://") > -1)
protocol = DataSourceType.FILE;
}
- System.out.println("Trying to get contents of resource:");
+ jalview.bin.Console.outPrintln("Trying to get contents of resource:");
FileParse fp = new FileParse(file, protocol);
if (fp.isValid())
{
}
else
{
- System.out.println("Resource at " + file
+ jalview.bin.Console.outPrintln("Resource at " + file
+ " cannot be read with protocol==" + protocol);
return;
}
if (format == null)
{
format = new IdentifyFile().identify(file, protocol);
- System.out.println("Format is " + format);
+ jalview.bin.Console.outPrintln("Format is " + format);
}
else
{
- System.out.println("User specified Format is " + format);
+ jalview.bin.Console.outPrintln("User specified Format is " + format);
}
AlignmentI al = null;
try
al = new AppletFormatAdapter().readFile(file, protocol, format);
} catch (java.io.IOException ex)
{
- System.err.println("Failed to open the file.");
+ jalview.bin.Console.errPrintln("Failed to open the file.");
ex.printStackTrace();
}
if (al != null)
{
- System.out.println(new AppletFormatAdapter()
+ jalview.bin.Console.outPrintln(new AppletFormatAdapter()
.formatSequences(FileFormat.Fasta, al, false));
}
} catch (Exception e)
{
- System.err.println("bailing out : Unexpected exception:");
+ jalview.bin.Console.errPrintln("bailing out : Unexpected exception:");
e.printStackTrace();
}
}
}
else
{
- System.out.println("Unable to setIconImage()");
+ Console.outPrintln("Unable to setIconImage()");
}
}
}
{
private final static String startClass = "jalview.bin.Jalview";
- private static boolean checkJVMSymlink(String testBin)
- {
- File testBinFile = new File(testBin);
- if (!testBinFile.exists())
- {
- return false;
- }
- File targetFile = null;
- try
- {
- targetFile = testBinFile.getCanonicalFile();
- } catch (IOException e)
- {
- return false;
- }
- if (targetFile != null && ("java".equals(targetFile.getName())
- || "java.exe".equals(targetFile.getName())))
- {
- return true;
- }
- return false;
- }
+ private final static String headlessProperty = "java.awt.headless";
/**
* main method for jalview.bin.Launcher. This restarts the same JRE's JVM with
{
if (!LaunchUtils.checkJavaVersion())
{
- System.err.println("WARNING - The Java version being used (Java "
- + LaunchUtils.getJavaVersion()
- + ") may lead to problems. This installation of Jalview should be used with Java "
- + LaunchUtils.getJavaCompileVersion() + ".");
- }
- final String appName = ChannelProperties.getProperty("app_name");
- final String javaBinDir = System.getProperty("java.home")
- + File.separator + "bin" + File.separator;
- String javaBin = null;
- if (javaBin == null && checkJVMSymlink(javaBinDir + appName))
- {
- javaBin = javaBinDir + appName;
- }
- if (javaBin == null && checkJVMSymlink(javaBinDir + "Jalview"))
- {
- javaBin = javaBinDir + "Jalview";
- }
- if (javaBin == null && checkJVMSymlink(javaBinDir + "java"))
- {
- javaBin = javaBinDir + "java";
- }
- if (javaBin == null)
- {
- javaBin = "java";
- }
-
- List<String> command = new ArrayList<>();
- command.add(javaBin);
-
- String memSetting = null;
-
- boolean isAMac = System.getProperty("os.name").indexOf("Mac") > -1;
-
- for (String jvmArg : ManagementFactory.getRuntimeMXBean()
- .getInputArguments())
- {
- command.add(jvmArg);
+ jalview.bin.Console
+ .errPrintln("WARNING - The Java version being used (Java "
+ + LaunchUtils.getJavaVersion()
+ + ") may lead to problems. This installation of Jalview should be used with Java "
+ + LaunchUtils.getJavaCompileVersion() + ".");
}
- command.add("-cp");
- command.add(ManagementFactory.getRuntimeMXBean().getClassPath());
String jvmmempc = null;
String jvmmemmax = null;
boolean debug = false;
boolean wait = true;
boolean quiet = false;
+ boolean headless = false;
+ boolean gui = false;
+ boolean stdout = false;
// must set --debug before --launcher...
boolean launcherstop = false;
boolean launcherprint = false;
boolean launcherwait = false;
ArrayList<String> arguments = new ArrayList<>();
+ String previousArg = null;
for (String arg : args)
{
if (arg.equals("--debug"))
{
quiet = true;
}
+ if (arg.equals("--headless"))
+ {
+ headless = true;
+ }
+ if (arg.equals("--gui"))
+ {
+ gui = true;
+ }
+ if (arg.equals("--output=-")
+ || (arg.equals("-") && "--output".equals(previousArg)))
+ {
+ stdout = true;
+ }
if (debug && arg.equals("--launcherprint"))
{
launcherprint = true;
{
wait = false;
}
+ previousArg = arg;
// Don't add the --launcher... args to Jalview launch
if (arg.startsWith("--launcher"))
{
arguments.add(arg);
}
}
+ if (gui)
+ {
+ // --gui takes precedence over --headless
+ headless = false;
+ }
+
+ final String appName = ChannelProperties.getProperty("app_name");
+
+ // if we're using jalview.bin.Launcher we always assume a console is in use
+ final String javaBin = LaunchUtils.findJavaBin(true);
+
+ List<String> command = new ArrayList<>();
+ command.add(javaBin);
+
+ String memSetting = null;
+
+ for (String jvmArg : ManagementFactory.getRuntimeMXBean()
+ .getInputArguments())
+ {
+ command.add(jvmArg);
+ }
+ command.add("-cp");
+ command.add(ManagementFactory.getRuntimeMXBean().getClassPath());
// use saved preferences if no cmdline args
boolean useCustomisedSettings = LaunchUtils
boolean memSet = false;
boolean dockIcon = false;
boolean dockName = false;
+ boolean headlessProp = false;
for (int i = 0; i < command.size(); i++)
{
String arg = command.get(i);
{
dockName = true;
}
+ else if (arg.startsWith("-D" + headlessProperty + "="))
+ {
+ headlessProp = true;
+ }
}
if (!memSet)
}
}
- if (isAMac)
+ if (LaunchUtils.isMac)
{
if (!dockIcon)
{
+ appName);
}
}
+ if (headless && !headlessProp)
+ {
+ System.setProperty(headlessProperty, "true");
+ command.add("-D" + headlessProperty + "=true");
+ }
String scalePropertyArg = HiDPISetting.getScalePropertyArg();
if (scalePropertyArg != null)
{
- sysout(debug, quiet, "Running " + startClass + " with scale setting "
+ syserr(debug, quiet, "Running " + startClass + " with scale setting "
+ scalePropertyArg);
command.add(scalePropertyArg);
}
if ((Boolean.parseBoolean(System.getProperty("launcherprint", "false"))
|| launcherprint))
{
- sysout(debug, quiet,
+ syserr(debug, quiet,
"LAUNCHER COMMAND: " + String.join(" ", builder.command()));
}
- sysout(debug, quiet,
+ syserr(debug, quiet,
"Running " + startClass + " with "
+ (memSetting == null ? "no memory setting"
: ("memory setting " + memSetting)));
if (Boolean.parseBoolean(System.getProperty("launcherstop", "false"))
|| (debug && launcherstop))
{
- sysout(debug, quiet,
+ syserr(debug, quiet,
"System property 'launcherstop' is set and not 'false'. Exiting.");
System.exit(0);
}
Process process = builder.start();
if (wait || launcherwait)
{
- sysout(debug, quiet, "Launching application process");
+ syserr(debug, quiet, "Launching application process");
process.waitFor();
}
else
{
int waitInt = 0;
- sysout(debug, quiet,
+ syserr(debug, quiet,
"Wait time for application process is " + waitInt + "ms");
process.waitFor(waitInt, TimeUnit.MILLISECONDS);
}
- sysout(debug, quiet, "Launcher process ending");
+ syserr(debug, quiet, "Launcher process ending");
} catch (IOException e)
{
if (e.getMessage().toLowerCase(Locale.ROOT).contains("memory"))
{
- System.err.println("Caught a memory exception: " + e.getMessage());
+ jalview.bin.Console
+ .errPrintln("Caught a memory exception: " + e.getMessage());
// Probably the "Cannot allocate memory" error, try without the memory
// setting
ArrayList<String> commandNoMem = new ArrayList<>();
}
final ProcessBuilder builderNoMem = new ProcessBuilder(
commandNoMem);
- System.err.println("Command without memory setting: "
+ jalview.bin.Console.errPrintln("Command without memory setting: "
+ String.join(" ", builderNoMem.command()));
try
{
}
}
- private static void sysout(boolean debug, boolean quiet, String message)
+ private static void syserr(boolean debug, boolean quiet, String message)
{
if (debug && !quiet)
{
- System.out.println("LAUNCHERDEBUG - " + message);
+ jalview.bin.Console.errPrintln("LAUNCHERDEBUG - " + message);
}
}
else
{
// number too big for a Long. Limit to Long.MAX_VALUE
- System.out.println("Memory parsing of '" + memString
+ jalview.bin.Console.outPrintln("Memory parsing of '" + memString
+ "' produces number too big. Limiting to Long.MAX_VALUE="
+ Long.MAX_VALUE);
return Long.MAX_VALUE;
ADJUSTMENT_MESSAGE = reason;
if (!quiet)
{
- System.out.println(reason);
+ jalview.bin.Console.outPrintln(reason);
}
}
Opt.UNARY, Opt.BOOTSTRAP),
HEADLESS(Type.CONFIG,
"Run Jalview in headless mode. No GUI interface will be created and Jalview will quit after all arguments have been processed. "
- + "Headless mode is assumed if an output file is to be generated, this can be overridden with --noheadless or --gui.",
- Opt.BOOLEAN, Opt.BOOTSTRAP),
+ + "Headless mode is assumed if an output file is to be generated, this can be overridden with --gui.",
+ Opt.UNARY, Opt.BOOTSTRAP),
GUI(Type.CONFIG,
"Do not run Jalview in headless mode. This overrides the assumption of headless mode when an output file is to be generated.",
Opt.UNARY, Opt.BOOTSTRAP),
+ "turn-propensity,\n" + "buried-index,\n"
+ "nucleotide,\n" + "nucleotide-ambiguity,\n"
+ "purine-pyrimidine,\n" + "rna-helices,\n"
- + "t-coffee-scores,\n" + "sequence-id.\n"
- +"\n"
+ + "t-coffee-scores,\n" + "sequence-id.\n" + "\n"
+ "Names of user defined colourschemes will also work,\n"
- +"and jalview colourscheme specifications like\n"
- +"--colour=\"D,E=red; K,R,H=0022FF; C,c=yellow\"",
+ + "and jalview colourscheme specifications like\n"
+ + "--colour=\"D,E=red; K,R,H=0022FF; C,c=yellow\"",
Opt.STRING, Opt.LINKED, Opt.ALLOWALL),
FEATURES(Type.OPENING, "Add a feature file or URL to the open alignment.",
Opt.STRING, Opt.LINKED, Opt.MULTI, Opt.ALLOWSUBSTITUTIONS),
+ "clustal (aln),\n" + "phylip (phy),\n"
+ "jalview (jvp, jar).",
Opt.STRING, Opt.LINKED, Opt.ALLOWSUBSTITUTIONS, Opt.ALLOWALL,
- Opt.REQUIREINPUT, Opt.OUTPUTFILE, Opt.PRIMARY),
+ Opt.REQUIREINPUT, Opt.OUTPUTFILE, Opt.STDOUT, Opt.PRIMARY),
FORMAT(Type.OUTPUT,
"Sets the format for the preceding --output file. Valid formats are:\n"
+ "fasta,\n" + "pfam,\n" + "stockholm,\n" + "pir,\n"
*/
OUTPUTFILE("output file --headless will be assumed unless --gui used"),
/*
+ * A STDOUT Arg can take an output filename that can be '-' to mean print to STDOUT.
+ */
+ STDOUT("allows the output filename '" + ArgParser.STDOUTFILENAME
+ + "' to mean output to STDOUT"),
+ /*
* A STORED Arg resets and creates a new set of "opened" linkedIds
*/
STORED(null),
public static final char EQUALS = '=';
+ public static final String STDOUTFILENAME = "-";
+
protected static final String NEGATESTRING = "no";
/**
public ArgParser(String[] args, boolean initsubstitutions,
BootstrapArgs bsa)
{
- // Make a mutable new ArrayList so that shell globbing parser works.
- // (When shell file globbing is used, there are a sequence of non-Arg
- // arguments (which are the expanded globbed filenames) that need to be
- // consumed by the --append/--argfile/etc Arg which is most easily done by
- // removing these filenames from the list one at a time. This can't be done
- // with an ArrayList made with only Arrays.asList(String[] args). )
+ /*
+ * Make a mutable new ArrayList so that shell globbing parser works.
+ * (When shell file globbing is used, there are a sequence of non-Arg
+ * arguments (which are the expanded globbed filenames) that need to be
+ * consumed by the --append/--argfile/etc Arg which is most easily done
+ * by removing these filenames from the list one at a time. This can't be
+ * done with an ArrayList made with only Arrays.asList(String[] args) as
+ * that is not mutable. )
+ */
this(new ArrayList<>(Arrays.asList(args)), initsubstitutions, false,
bsa);
}
boolean allowPrivate)
{
this.substitutions = initsubstitutions;
- boolean openEachInitialFilenames = true;
- for (int i = 0; i < args.size(); i++)
- {
- String arg = args.get(i);
- // If the first arguments do not start with "--" or "-" or is not "open"
- // and` is a filename that exists it is probably a file/list of files to
- // open so we fake an Arg.OPEN argument and when adding files only add the
- // single arg[i] and increment the defaultLinkedIdCounter so that each of
- // these files is opened separately.
- if (openEachInitialFilenames && !arg.startsWith(DOUBLEDASH)
- && !arg.startsWith("-") && !arg.equals("open")
- && (new File(arg).exists()
- || HttpUtils.startsWithHttpOrHttps(arg)))
- {
- arg = Arg.OPEN.argString();
- }
- else
+ /*
+ * If the first argument does not start with "--" or "-" or is not "open",
+ * and is a filename that exists or a URL, it is probably a file/list of
+ * files to open so we insert an Arg.OPEN argument before it. This will
+ * mean the list of files at the start of the arguments are all opened
+ * separately.
+ */
+ if (args.size() > 0)
+ {
+ String arg0 = args.get(0);
+ if (arg0 != null
+ && (!arg0.startsWith(DOUBLEDASH) && !arg0.startsWith("-")
+ && !arg0.equals("open") && (new File(arg0).exists()
+ || HttpUtils.startsWithHttpOrHttps(arg0))))
{
- openEachInitialFilenames = false;
+ // insert "--open" at the start
+ args.add(0, Arg.OPEN.argString());
}
+ }
+
+ for (int i = 0; i < args.size(); i++)
+ {
+ String arg = args.get(i);
// look for double-dash, e.g. --arg
if (arg.startsWith(DOUBLEDASH))
{
// There is no "=" so value is next arg or args (possibly shell
// glob-expanded)
- if ((openEachInitialFilenames ? i : i + 1) >= args.size())
+ if (i + 1 >= args.size())
{
// no value to take for arg, which wants a value
Console.error("Argument '" + a.getName()
{
// if this is the first argument with a file list at the start of
// the args we add filenames from index i instead of i+1
- globVals = getShellGlobbedFilenameValues(a, args,
- openEachInitialFilenames ? i : i + 1);
+ globVals = getShellGlobbedFilenameValues(a, args, i + 1);
}
else
{
private Set<Type> argsTypes = new HashSet<>();
+ private boolean outputToStdout = false;
+
public static BootstrapArgs getBootstrapArgs(String[] args)
{
List<String> argList = new ArrayList<>(Arrays.asList(args));
{
if (argFiles.contains(inArgFile))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Looped argfiles detected: '" + inArgFile.getPath() + "'");
return;
}
}
}
- if (ArgParser.argMap.containsKey(argName) && val == null)
- {
- val = "true";
- }
-
Arg a = ArgParser.argMap.get(argName);
if (a != null)
if (a == null || !a.hasOption(Opt.BOOTSTRAP))
{
- // not a valid bootstrap arg
+ // not a bootstrap arg
+
+ // make a check for an output going to stdout
+ if (a != null && a.hasOption(Opt.OUTPUTFILE)
+ && a.hasOption(Opt.STDOUT))
+ {
+ if (val == null && i + 1 < args.size())
+ {
+ val = args.get(i + 1);
+ }
+ if (val.startsWith("[") && val.indexOf(']') > 0)
+ {
+ val = val.substring(val.indexOf(']') + 1);
+ }
+
+ if (ArgParser.STDOUTFILENAME.equals(val))
+ {
+ this.outputToStdout = true;
+ }
+ }
+
continue;
}
}
else
{
+ if (val == null)
+ {
+ val = "true";
+ }
+
add(a, type, val);
}
}
}
else if (this.contains(Arg.HEADLESS))
{
- // --headless, --noheadless specified => use value
+ // --headless has been specified on the command line => headless
isHeadless = this.getBoolean(Arg.HEADLESS);
}
else if (this.argsHaveOption(Opt.OUTPUTFILE))
}
return isHeadless;
}
+
+ public boolean outputToStdout()
+ {
+ return this.outputToStdout;
+ }
}
{
command.seqs[s].insertCharAt(command.position, command.number,
command.gapChar);
- // System.out.println("pos: "+command.position+" number:
+ // jalview.bin.Console.outPrintln("pos: "+command.position+" number:
// "+command.number);
}
//
// for (int s = 0; s < command.seqs.length; s++)
// {
- // System.out.println("pos: "+command.position+" number: "+command.number);
+ // jalview.bin.Console.outPrintln("pos: "+command.position+" number: "+command.number);
// command.seqs[s].insertCharAt(command.position, command.number,'A');
// }
//
}
else
{
- System.err.println("Can't undo edit action " + action);
+ jalview.bin.Console.errPrintln("Can't undo edit action " + action);
// throw new IllegalStateException("Can't undo edit action " +
// action);
}
ds.setSequenceFeatures(dna.getSequenceFeatures());
// dnaSeqs[i] = ds;
ssm.fromSeq = ds;
- System.out.println("Realised mapped sequence " + ds.getName());
+ jalview.bin.Console.outPrintln("Realised mapped sequence " + ds.getName());
}
}
}
invalidrnastruc = -1;
} catch (WUSSParseException px)
{
- // DEBUG System.out.println(px);
+ // DEBUG jalview.bin.Console.outPrintln(px);
invalidrnastruc = px.getProblemPos();
}
if (invalidrnastruc > -1)
scaleColLabel = true;
_markRnaHelices();
}
- // System.out.println("featuregroup " + _rnasecstr[0].getFeatureGroup());
+ // jalview.bin.Console.outPrintln("featuregroup " + _rnasecstr[0].getFeatureGroup());
}
{
/*
- * System.out.println(this.annotation._rnasecstr[x] + " Begin" +
+ * jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x] + " Begin" +
* this.annotation._rnasecstr[x].getBegin());
*/
- // System.out.println(this.annotation._rnasecstr[x].getFeatureGroup());
+ // jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x].getFeatureGroup());
int val = 0;
try
{
char firstChar = 0;
for (int i = 0; i < annotations.length; i++)
{
- // DEBUG System.out.println(i + ": " + annotations[i]);
+ // DEBUG jalview.bin.Console.outPrintln(i + ": " + annotations[i]);
if (annotations[i] == null)
{
continue;
if (annotations[i].secondaryStructure == 'H'
|| annotations[i].secondaryStructure == 'E')
{
- // DEBUG System.out.println( "/H|E/ '" +
+ // DEBUG jalview.bin.Console.outPrintln( "/H|E/ '" +
// annotations[i].secondaryStructure + "'");
hasIcons |= true;
}
else
// Check for RNA secondary structure
{
- // DEBUG System.out.println( "/else/ '" +
+ // DEBUG jalview.bin.Console.outPrintln( "/else/ '" +
// annotations[i].secondaryStructure + "'");
// TODO: 2.8.2 should this ss symbol validation check be a function in
// RNA/ResidueProperties ?
}
}
- // System.out.println("displaychar " + annotations[i].displayCharacter);
+ // jalview.bin.Console.outPrintln("displaychar " + annotations[i].displayCharacter);
if (annotations[i].displayCharacter == null
|| annotations[i].displayCharacter.length() == 0)
public static void testSelectionViews(AlignmentI alignment,
HiddenColumns hidden, SequenceGroup selection)
{
- System.out.println("Testing standard view creation:\n");
+ jalview.bin.Console.outPrintln("Testing standard view creation:\n");
AlignmentView view = null;
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View with no hidden columns, no limit to selection, no groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, false, false,
false);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View with no hidden columns, no limit to selection, and all groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, false, false,
true);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection marked but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View with no hidden columns, limited to selection and no groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, false, true,
false);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection restricted but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View with no hidden columns, limited to selection, and all groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, false, true,
true);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection restricted and groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View *with* hidden columns, no limit to selection, no groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, true, false,
false);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View *with* hidden columns, no limit to selection, and all groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, true, false,
true);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection marked but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View *with* hidden columns, limited to selection and no groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, true, true,
false);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection restricted but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View *with* hidden columns, limited to selection, and all groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, true, true,
true);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection restricted and groups marked.");
}
{
from_column = 0;
}
- if (to_column > getContactHeight())
+ if (to_column >= getContactHeight())
{
- to_column = getContactHeight();
+ to_column = getContactHeight()-1;
}
ContactRange cr = new ContactRange();
cr.setFrom_column(from_column);
import java.util.BitSet;
import java.util.List;
+import jalview.util.ColorUtils;
+import jalview.ws.datamodel.MappableContactMatrixI;
+
public interface ContactMatrixI
{
}
void setGroupSet(GroupSet makeGroups);
+
+ default void randomlyReColourGroups() {
+ if (hasGroupSet())
+ {
+ GroupSetI groups = getGroupSet();
+ for (BitSet group:groups.getGroups())
+ {
+ groups.setColorForGroup(group, ColorUtils.getARandomColor());
+ }
+ }
+ }
+
+ default void transferGroupColorsTo(AlignmentAnnotation aa)
+ {
+ if (hasGroupSet())
+ {
+ GroupSetI groups = getGroupSet();
+ // stash colors in linked annotation row.
+ // doesn't work yet. TESTS!
+ int sstart = aa.sequenceRef != null ? aa.sequenceRef.getStart() - 1
+ : 0;
+ Annotation ae;
+ Color gpcol = null;
+ int[] seqpos = null;
+ for (BitSet gp : groups.getGroups())
+ {
+ gpcol = groups.getColourForGroup(gp);
+ for (int p = gp.nextSetBit(0); p >= 0
+ && p < Integer.MAX_VALUE; p = gp.nextSetBit(p + 1))
+ {
+ if (this instanceof MappableContactMatrixI)
+ {
+ MappableContactMatrixI mcm = (MappableContactMatrixI) this;
+ seqpos = mcm.getMappedPositionsFor(aa.sequenceRef, p);
+ if (seqpos == null)
+ {
+ // no mapping for this column.
+ continue;
+ }
+ // TODO: handle ranges...
+ ae = aa.getAnnotationForPosition(seqpos[0]);
+ }
+ else
+ {
+ ae = aa.getAnnotationForPosition(p + sstart);
+ }
+ if (ae != null)
+ {
+ ae.colour = gpcol.brighter().darker();
+ }
+ }
+ }
+ }
+ }
+
+ /**
+ * look up the colour for a column in the associated contact matrix
+ * @return Color.white or assigned colour
+ */
+ default Color getGroupColorForPosition(int column)
+ {
+ if (hasGroupSet())
+ {
+ GroupSetI groups = getGroupSet();
+ for (BitSet gp:groups.getGroups())
+ {
+ if (gp.get(column))
+ {
+ return groups.getColourForGroup(gp);
+ }
+ }
+ }
+ return Color.white;
+ }
+
}
public static boolean isPrimaryCandidate(String ucversion)
{
+ if (ucversion==null)
+ {
+ // Null/empty version is not a real reference ?
+ return false;
+ }
// tricky - this test really needs to search the sequence's set of dbrefs to
// see if there is a primary reference that derived this reference.
for (int i = allSources.length; --i >= 0;)
return treeType;
}
- public static GroupSet makeGroups(ContactMatrixI matrix, float thresh,
+ public static GroupSet makeGroups(ContactMatrixI matrix, boolean autoCut)
+ {
+ return makeGroups(matrix, autoCut, 0, autoCut);
+ }
+ public static GroupSet makeGroups(ContactMatrixI matrix, boolean auto, float thresh,
boolean abs)
{
AverageDistanceEngine clusterer = new AverageDistanceEngine(null, null,
- matrix);
+ matrix, true);
double height = clusterer.findHeight(clusterer.getTopNode());
+ Console.debug("Column tree height: " + height);
String newick = new jalview.io.NewickFile(clusterer.getTopNode(), false,
true).print();
String treeType = "UPGMA";
Console.trace("Newick string\n" + newick);
List<BinaryNode> nodegroups;
- if (abs ? height > thresh : 0 < thresh && thresh < 1)
+ float cut = -1f;
+ if (auto)
{
- float cut = abs ? (float) (thresh / height) : thresh;
- Console.debug("Threshold " + cut + " for height=" + height);
-
- nodegroups = clusterer.groupNodes(cut);
+ double rootw = 0;
+ int p = 2;
+ BinaryNode bn = clusterer.getTopNode();
+ while (p-- > 0 & bn.left() != null)
+ {
+ if (bn.left() != null)
+ {
+ bn = bn.left();
+ }
+ if (bn.left() != null)
+ {
+ rootw = bn.height;
+ }
+ }
+ thresh = Math.max((float) (rootw / height) - 0.01f, 0);
+ cut = thresh;
+ nodegroups = clusterer.groupNodes(thresh);
}
else
{
- nodegroups = new ArrayList<BinaryNode>();
- nodegroups.add(clusterer.getTopNode());
+ if (abs ? (height > thresh) : (0 < thresh && thresh < 1))
+ {
+ cut = abs ? thresh : (float) (thresh * height);
+ Console.debug("Threshold " + cut + " for height=" + height);
+ nodegroups = clusterer.groupNodes(cut);
+ }
+ else
+ {
+ nodegroups = new ArrayList<BinaryNode>();
+ nodegroups.add(clusterer.getTopNode());
+ }
}
+
List<BitSet> groups = new ArrayList<>();
for (BinaryNode root : nodegroups)
{
}
groups.add(gpset);
}
- GroupSet grps = new GroupSet(abs, thresh, groups, treeType, newick);
+ GroupSet grps = new GroupSet(abs, (cut == -1f) ? thresh : cut, groups,
+ treeType, newick);
return grps;
}
if (alignmentIndex < 0 || hiddenSequences[alignmentIndex] != null)
{
- System.out.println("ERROR!!!!!!!!!!!");
+ jalview.bin.Console.outPrintln("ERROR!!!!!!!!!!!");
return;
}
}
else
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
seq.getName() + " has been deleted whilst hidden");
}
}
else
{
// debug
- // System.err.println("Outwith bounds!" + matchStart+">"+end +" or "
+ // jalview.bin.Console.errPrintln("Outwith bounds!" + matchStart+">"+end +" or "
// + matchEnd+"<"+start);
}
}
{
if (name == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"POSSIBLE IMPLEMENTATION ERROR: null sequence name passed to constructor.");
name = "";
}
{
if (sf.getType() == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"SequenceFeature type may not be null: " + sf.toString());
return false;
}
transferAnnotation(entry.getDatasetSequence(), mp);
return;
}
+ // transfer from entry to sequence
+ // if entry has a description and sequence doesn't, then transfer
+ if (entry.getDescription()!=null && (description==null || description.trim().length()==0))
+ {
+ description = entry.getDescription();
+ }
+
// transfer any new features from entry onto sequence
if (entry.getSequenceFeatures() != null)
{
} catch (java.lang.OutOfMemoryError err)
{
// TODO: catch OOM
- System.out.println("Out of memory loading groups: " + err);
+ jalview.bin.Console.outPrintln("Out of memory loading groups: " + err);
}
return upd;
}
int nextQuotePos = descriptor.indexOf(QUOTE, 1);
if (nextQuotePos == -1)
{
- System.err.println(invalidFormat);
+ jalview.bin.Console.errPrintln(invalidFormat);
return null;
}
firstField = descriptor.substring(1, nextQuotePos);
int nextSpacePos = descriptor.indexOf(SPACE);
if (nextSpacePos == -1)
{
- System.err.println(invalidFormat);
+ jalview.bin.Console.errPrintln(invalidFormat);
return null;
}
firstField = descriptor.substring(0, nextSpacePos);
cond = Condition.fromString(leftToParse);
if (cond == null || cond.needsAPattern())
{
- System.err.println(invalidFormat);
+ jalview.bin.Console.errPrintln(invalidFormat);
return null;
}
}
else
{
// unbalanced quote
- System.err.println(invalidFormat);
+ jalview.bin.Console.errPrintln(invalidFormat);
return null;
}
}
if (spacePos == -1)
{
// trailing junk after a match condition
- System.err.println(invalid);
+ jalview.bin.Console.errPrintln(invalid);
return null;
}
String conjunction = leftToParse.substring(0, spacePos);
else
{
// not an AND or an OR - invalid
- System.err.println(invalid);
+ jalview.bin.Console.errPrintln(invalid);
return null;
}
}
int closePos = leftToParse.indexOf(CLOSE_BRACKET);
if (closePos == -1)
{
- System.err.println(invalid);
+ jalview.bin.Console.errPrintln(invalid);
return null;
}
nextCondition = leftToParse.substring(1, closePos);
FeatureMatcher fm = FeatureMatcher.fromString(nextCondition);
if (fm == null)
{
- System.err.println(invalid);
+ jalview.bin.Console.errPrintln(invalid);
return null;
}
try
} catch (IllegalStateException e)
{
// thrown if OR and AND are mixed
- System.err.println(invalid);
+ jalview.bin.Console.errPrintln(invalid);
return null;
}
SequenceFeature sf = contactFeatureEnds.get(index);
if (!sf.isContactFeature())
{
- System.err.println("Error! non-contact feature type " + sf.getType()
+ jalview.bin.Console.errPrintln("Error! non-contact feature type " + sf.getType()
+ " in contact features list");
index++;
continue;
SequenceFeature sf = contactFeatureStarts.get(index);
if (!sf.isContactFeature())
{
- System.err.println("Error! non-contact feature " + sf.toString()
+ jalview.bin.Console.errPrintln("Error! non-contact feature " + sf.toString()
+ " in contact features list");
index++;
continue;
String type = sf.getType();
if (type == null)
{
- System.err.println("Feature type may not be null: " + sf.toString());
+ jalview.bin.Console.errPrintln("Feature type may not be null: " + sf.toString());
return false;
}
return true;
} catch (NumberFormatException e)
{
- System.err.println("Bad integers in description " + description);
+ jalview.bin.Console.errPrintln("Bad integers in description " + description);
}
}
return false;
ids, -1, MODE_MAP, null);
} catch (IOException | ParseException e)
{
- System.err.println("Error parsing " + identifier + " lookup response "
+ jalview.bin.Console.errPrintln("Error parsing " + identifier + " lookup response "
+ e.getMessage());
return null;
}
return (parseAssemblyMappingResponse(url));
} catch (Throwable t)
{
- System.out.println("Error calling " + url + ": " + t.getMessage());
+ jalview.bin.Console.outPrintln("Error calling " + url + ": " + t.getMessage());
return null;
}
}
return null;
} catch (Throwable t)
{
- System.out.println("Error calling " + url + ": " + t.getMessage());
+ jalview.bin.Console.outPrintln("Error calling " + url + ": " + t.getMessage());
return null;
}
}
String ass = mapped.get("assembly_name").toString();
if (assembly != null && !assembly.equals(ass))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"EnsemblMap found multiple assemblies - can't resolve");
return null;
}
String chr = mapped.get("seq_region_name").toString();
if (chromosome != null && !chromosome.equals(chr))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"EnsemblMap found multiple chromosomes - can't resolve");
return null;
}
return pingString != null;
} catch (Throwable t)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error connecting to " + pingUrl + ": " + t.getMessage());
} finally
{
* note: a GET request for an invalid id returns an error code e.g. 415
* but POST request returns 200 and an empty Fasta response
*/
- System.err.println("Response code " + responseCode);// + " for " + url);
+ jalview.bin.Console.errPrintln("Response code " + responseCode);// + " for " + url);
return null;
}
protected HttpURLConnection tryConnection(URL url, List<String> ids,
int readTimeout) throws IOException, ProtocolException
{
- // System.out.println(System.currentTimeMillis() + " " + url);
+ // jalview.bin.Console.outPrintln(System.currentTimeMillis() + " " + url);
HttpURLConnection connection = (HttpURLConnection) url.openConnection();
int retrySecs = Integer.valueOf(retryDelay);
if (retrySecs > 0 && retrySecs < 10)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Ensembl REST service rate limit exceeded, waiting "
+ retryDelay + " seconds before retrying");
Thread.sleep(1000 * retrySecs);
}
} catch (NumberFormatException | InterruptedException e)
{
- System.err.println("Error handling Retry-After: " + e.getMessage());
+ jalview.bin.Console.errPrintln("Error handling Retry-After: " + e.getMessage());
}
}
}
}
} catch (NumberFormatException e)
{
- System.err.println("Error in REST version: " + e.toString());
+ jalview.bin.Console.errPrintln("Error in REST version: " + e.toString());
}
/*
expected) == 1;
if (laterVersion)
{
- System.err.println(String.format(
+ jalview.bin.Console.errPrintln(String.format(
"EnsemblRestClient expected %s REST version %s but found %s, see %s",
getDbSource(), expected, version, REST_CHANGE_LOG));
}
info.restVersion = version;
} catch (Throwable t)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error checking Ensembl REST version: " + t.getMessage());
}
}
domainData.get(getDomain()).dataVersion = versions.get(0).toString();
} catch (Throwable e)
{// could be IOException | ParseException e) {
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error checking Ensembl data version: " + e.getMessage());
}
}
String msg = "Aborting ID retrieval after " + v
+ " chunks. Unexpected problem (" + r.getLocalizedMessage()
+ ")";
- System.err.println(msg);
+ jalview.bin.Console.errPrintln(msg);
r.printStackTrace();
break;
}
}
} catch (IOException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error transferring Ensembl features: " + e.getMessage());
}
// Platform.timeCheck("ESP.addfeat done", Platform.TIME_MARK);
String accId = querySeq.getName();
try
{
- System.out.println("Adding protein product for " + accId);
+ jalview.bin.Console.outPrintln("Adding protein product for " + accId);
AlignmentI protein = new EnsemblProtein(getDomain())
.getSequenceRecords(accId);
if (protein == null || protein.getHeight() == 0)
{
- System.out.println("No protein product found for " + accId);
+ jalview.bin.Console.outPrintln("No protein product found for " + accId);
return;
}
SequenceI proteinSeq = protein.getSequenceAt(0);
seq.addDBRef(xrefs.get(i));
}
- // System.out.println("primaries are " + seq.getPrimaryDBRefs().toString());
+ // jalview.bin.Console.outPrintln("primaries are " + seq.getPrimaryDBRefs().toString());
/*
* and add a reference to itself
*/
if (seqs.size() != ids.size())
{
- System.out.println(String.format(
+ jalview.bin.Console.outPrintln(String.format(
"Only retrieved %d sequences for %d query strings",
seqs.size(), ids.size()));
}
result.add(sequence);
} catch (ParseException | IOException e)
{
- System.err.println("Error processing JSON response: " + e.toString());
+ jalview.bin.Console.errPrintln("Error processing JSON response: " + e.toString());
// ignore
}
// Platform.timeCheck("ENS seqproxy2", Platform.TIME_MARK);
if (regions.isEmpty())
{
- System.out.println("Failed to identify target sequence for " + accId
+ jalview.bin.Console.outPrintln("Failed to identify target sequence for " + accId
+ " from genomic features");
return null;
}
boolean result = transferFeatures(sfs, targetSequence, mapping,
accessionId);
- // System.out.println("transferFeatures (" + (sfs.size()) + " --> "
+ // jalview.bin.Console.outPrintln("transferFeatures (" + (sfs.size()) + " --> "
// + targetSequence.getFeatures().getFeatureCount(true) + ") to "
// + targetSequence.getName() + " took "
// + (System.currentTimeMillis() - start) + "ms");
{
if (!isValid() || !refFile.isIndexed())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Cannot read contig as file is invalid or not indexed");
return null;
}
public void createImage(String file, String type, int quality)
{
- System.out.println("JMOL CREATE IMAGE");
+ jalview.bin.Console.outPrintln("JMOL CREATE IMAGE");
}
@Override
public String createImage(String fileName, String type,
Object textOrBytes, int quality)
{
- System.out.println("JMOL CREATE IMAGE");
+ jalview.bin.Console.outPrintln("JMOL CREATE IMAGE");
return null;
}
@Override
public String eval(String strEval)
{
- // System.out.println(strEval);
+ // jalview.bin.Console.outPrintln(strEval);
// "# 'eval' is implemented only for the applet.";
return null;
}
lastMessage = strInfo;
if (data != null)
{
- System.err.println("Ignoring additional hover info: " + data
+ jalview.bin.Console.errPrintln("Ignoring additional hover info: " + data
+ " (other info: '" + strInfo + "' pos " + atomIndex + ")");
}
mouseOverStructure(atomIndex, strInfo);
*/
if (strData != null)
{
- System.err.println("Ignoring additional pick data string " + strData);
+ jalview.bin.Console.errPrintln("Ignoring additional pick data string " + strData);
}
int chainSeparator = strInfo.indexOf(":");
int p = 0;
(data == null) ? ((String) null) : (String) data[1]);
break;
case ERROR:
- // System.err.println("Ignoring error callback.");
+ // jalview.bin.Console.errPrintln("Ignoring error callback.");
break;
case SYNC:
case RESIZE:
case CLICK:
default:
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unhandled callback " + type + " " + data[1].toString());
break;
}
} catch (Exception e)
{
- System.err.println("Squashed Jmol callback handler error:");
+ jalview.bin.Console.errPrintln("Squashed Jmol callback handler error:");
e.printStackTrace();
}
}
public void setCallbackFunction(String callbackType,
String callbackFunction)
{
- System.err.println("Ignoring set-callback request to associate "
+ jalview.bin.Console.errPrintln("Ignoring set-callback request to associate "
+ callbackType + " with function " + callbackFunction);
}
String buttonsToShow)
{
- System.err.println("Allocating Jmol Viewer: " + commandOptions);
+ jalview.bin.Console.errPrintln("Allocating Jmol Viewer: " + commandOptions);
if (commandOptions == null)
{
console = createJmolConsole(consolePanel, buttonsToShow);
} catch (Throwable e)
{
- System.err.println("Could not create Jmol application console. "
+ jalview.bin.Console.errPrintln("Could not create Jmol application console. "
+ e.getMessage());
e.printStackTrace();
}
}
} catch (OutOfMemoryError er)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"OUT OF MEMORY LOADING TRANSFORMING JMOL MODEL TO JALVIEW MODEL");
throw new IOException(MessageManager
.getString("exception.outofmemory_loading_mmcif_file"));
org.jmol.modelset.Atom prevAtom,
HashMap<String, org.jmol.modelset.Atom> chainTerMap)
{
- // System.out.println("Atom: " + curAtom.getAtomNumber()
+ // jalview.bin.Console.outPrintln("Atom: " + curAtom.getAtomNumber()
// + " Last atom index " + curAtom.group.lastAtomIndex);
if (chainTerMap == null || prevAtom == null)
{
{
int length = sq.getLength();
boolean ssFound = false;
- Annotation asecstr[] = new Annotation[length + firstResNum - 1];
+ Annotation asecstr[] = new Annotation[length + (firstResNum-sq.getStart())];
for (int p = 0; p < length; p++)
{
if (secstr[p] >= 'A' && secstr[p] <= 'z')
if (sval == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"DEVELOPER WARNING: Annotate3d didn't return a '2D' tag in its response. Consider checking output of server. Response was :"
+ val.toString());
boolean getReply)
{
String postBody = getPostRequest(command);
- // System.out.println(postBody);// debug
+ // jalview.bin.Console.outPrintln(postBody);// debug
String rpcUrl = "http://127.0.0.1:" + this.pymolXmlRpcPort;
PrintWriter out = null;
BufferedReader in = null;
}
else if (message.startsWith(MODEL_CHANGED))
{
- System.err.println(message);
+ jalview.bin.Console.errPrintln(message);
processModelChanged(message.substring(MODEL_CHANGED.length()));
}
else
{
- System.err.println("Unexpected chimeraNotification: " + message);
+ jalview.bin.Console.errPrintln("Unexpected chimeraNotification: " + message);
}
}
}
*/
protected void processModelChanged(String message)
{
- // System.out.println(message + " (not implemented in Jalview)");
+ // jalview.bin.Console.outPrintln(message + " (not implemented in Jalview)");
}
/**
startListening(chimeraListener.getUri());
} catch (BindException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to start Chimera listener: " + e.getMessage());
}
}
private void log(String message)
{
- System.err.println("## Chimera log: " + message);
+ jalview.bin.Console.errPrintln("## Chimera log: " + message);
}
/**
executeCommand(false, null, command);
} catch (IOException e)
{
- System.err.println("Sending commands to Chimera via file failed with "
+ jalview.bin.Console.errPrintln("Sending commands to Chimera via file failed with "
+ e.getMessage());
}
}
int x = 0;
for (FTSDataColumnI field : allFTSDataColumns)
{
- // System.out.println("allFTSDataColumns==" + allFTSDataColumns);
+ // jalview.bin.Console.outPrintln("allFTSDataColumns==" + allFTSDataColumns);
if (field.getName().equalsIgnoreCase("all"))
{
continue;
data[x++] = new Object[] { ftsRestClient
.getAllDefaultDisplayedFTSDataColumns().contains(field),
field.getName(), field.getGroup() };
- // System.out.println(" PUIS " + field.getName() + " ET AUSSI " +
+ // jalview.bin.Console.outPrintln(" PUIS " + field.getName() + " ET AUSSI " +
// field.getGroup() + "X = " + x);
break;
case STRUCTURE_CHOOSER:
} catch (Exception e)
{
e.printStackTrace();
- System.out.println("offending value:" + fieldData);
+ jalview.bin.Console.outPrintln("offending value:" + fieldData);
}
}
}
URI uri = webResource.getURI();
- System.out.println(uri);
+ jalview.bin.Console.outPrintln(uri);
ClientResponse clientResponse = null;
int responseStatus = -1;
// Get the JSON string from the response object or directly from the
Map<String, Object> jsonObj = null;
String responseString = null;
- System.out.println("query >>>>>>> " + pdbRestRequest.toString());
+ jalview.bin.Console.outPrintln("query >>>>>>> " + pdbRestRequest.toString());
if (!isMocked())
{
for (FTSDataColumnI field : diplayFields)
{
- // System.out.println("Field " + field);
+ // jalview.bin.Console.outPrintln("Field " + field);
String fieldData = (pdbJsonDoc.get(field.getCode()) == null) ? ""
: pdbJsonDoc.get(field.getCode()).toString();
- // System.out.println("Field Data : " + fieldData);
+ // jalview.bin.Console.outPrintln("Field Data : " + fieldData);
if (field.isPrimaryKeyColumn())
{
primaryKey = fieldData;
} catch (Exception e)
{
e.printStackTrace();
- System.out.println("offending value:" + fieldData);
+ jalview.bin.Console.outPrintln("offending value:" + fieldData);
}
}
}
@Override
protected void showHelp()
{
- System.out.println("No help implemented yet.");
+ jalview.bin.Console.outPrintln("No help implemented yet.");
}
webResource = client.resource(DEFAULT_THREEDBEACONS_DOMAIN + query);
URI uri = webResource.getURI();
- System.out.println(uri.toString());
+ jalview.bin.Console.outPrintln(uri.toString());
// Execute the REST request
ClientResponse clientResponse;
String fieldData = (tdbJsonStructure.get(field.getCode()) == null)
? " "
: tdbJsonStructure.get(field.getCode()).toString();
- // System.out.println("Field : " + field + " Data : " + fieldData);
+ // jalview.bin.Console.outPrintln("Field : " + field + " Data : " + fieldData);
if (field.isPrimaryKeyColumn())
{
primaryKey = fieldData;
} catch (Exception e)
{
// e.printStackTrace();
- System.out.println("offending value:" + fieldData + fieldData);
+ jalview.bin.Console.outPrintln("offending value:" + fieldData + fieldData);
}
}
}
.getEntity(String.class);
// Make redundant objects eligible for garbage collection to conserve
// memory
- // System.out.println(">>>>> response : "
+ // jalview.bin.Console.outPrintln(">>>>> response : "
// + uniProtTabDelimittedResponseString);
if (clientResponse.getStatus() != 200)
{
firstRow = false;
continue;
}
- // System.out.println(dataRow);
+ // jalview.bin.Console.outPrintln(dataRow);
result.add(getFTSData(dataRow, uniprotRestRequest));
}
searchResult.setNumberOfItemsFound(xTotalResults);
} catch (Exception e)
{
e.printStackTrace();
- System.out.println("offending value:" + fieldData);
+ jalview.bin.Console.outPrintln("offending value:" + fieldData);
}
}
} catch (Exception e)
import java.io.File;
import java.io.FileWriter;
import java.io.IOException;
+import java.io.OutputStreamWriter;
import java.io.PrintWriter;
import java.net.URL;
import java.util.ArrayList;
// if (viewport.cursorMode)
// {
// alignPanel.seqPanel.insertNucAtCursor(false,"A");
- // //System.out.println("A");
+ // //jalview.bin.Console.outPrintln("A");
// }
// break;
/*
* case KeyEvent.VK_CLOSE_BRACKET: if (viewport.cursorMode) {
- * System.out.println("closing bracket"); } break;
+ * jalview.bin.Console.outPrintln("closing bracket"); } break;
*/
case KeyEvent.VK_DELETE:
case KeyEvent.VK_BACK_SPACE:
@Override
public void propertyChange(PropertyChangeEvent evt)
{
- // // System.out.println("Discoverer property change.");
+ // // jalview.bin.Console.outPrintln("Discoverer property
+ // change.");
// if (evt.getPropertyName().equals("services"))
{
SwingUtilities.invokeLater(new Runnable()
@Override
public void run()
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Rebuild WS Menu for service change");
BuildWebServiceMenu();
}
public void internalFrameClosed(
javax.swing.event.InternalFrameEvent evt)
{
- // System.out.println("deregistering discoverer listener");
+ // jalview.bin.Console.outPrintln("deregistering discoverer listener");
Desktop.instance.removeJalviewPropertyChangeListener("services",
thisListener);
closeMenuItem_actionPerformed(true);
*/
public void saveAlignment(String file, FileFormatI format)
{
+ saveAlignment(file, format, false);
+ }
+
+ public void saveAlignment(String file, FileFormatI format, boolean stdout)
+ {
lastSaveSuccessful = true;
- lastFilenameSaved = file;
+ if (!stdout)
+ {
+ lastFilenameSaved = file;
+ }
lastFormatSaved = format;
if (FileFormat.Jalview.equals(format))
shortName = shortName
.substring(shortName.lastIndexOf(File.separatorChar) + 1);
}
+ // TODO deal with stdout=true
lastSaveSuccessful = new Jalview2XML().saveAlignment(this, file,
shortName);
else
{
// create backupfiles object and get new temp filename destination
- boolean doBackup = BackupFiles.getEnabled();
+ boolean doBackup = BackupFiles.getEnabled() && !stdout;
BackupFiles backupfiles = null;
if (doBackup)
{
String tempFilePath = doBackup ? backupfiles.getTempFilePath()
: file;
Console.trace("ALIGNFRAME setting PrintWriter");
- PrintWriter out = new PrintWriter(new FileWriter(tempFilePath));
+ PrintWriter out = stdout
+ ? new PrintWriter(new OutputStreamWriter(System.out))
+ : new PrintWriter(new FileWriter(tempFilePath));
if (backupfiles != null)
{
}
out.print(output);
- Console.trace("ALIGNFRAME about to close file");
- out.close();
- Console.trace("ALIGNFRAME closed file");
- AlignFrame.this.setTitle(file);
- statusBar.setText(MessageManager.formatMessage(
- "label.successfully_saved_to_file_in_format", new Object[]
- { fileName, format.getName() }));
+ out.flush();
+ if (!stdout)
+ {
+ Console.trace("ALIGNFRAME about to close file");
+ out.close();
+ Console.trace("ALIGNFRAME closed file");
+ }
+ AlignFrame.this.setTitle(stdout ? "STDOUT" : file);
+ if (stdout)
+ {
+ statusBar.setText(MessageManager.formatMessage(
+ "label.successfully_printed_to_stdout_in_format",
+ new Object[]
+ { format.getName() }));
+ }
+ else
+ {
+ statusBar.setText(MessageManager.formatMessage(
+ "label.successfully_saved_to_file_in_format",
+ new Object[]
+ { fileName, format.getName() }));
+ }
lastSaveSuccessful = true;
} catch (IOException e)
{
} catch (Exception ex)
{
ex.printStackTrace();
- System.out.println("Exception whilst pasting: " + ex);
+ jalview.bin.Console.outPrintln("Exception whilst pasting: " + ex);
// could be anything being pasted in here
}
} catch (Exception ex)
{
ex.printStackTrace();
- System.out.println("Exception whilst pasting: " + ex);
+ jalview.bin.Console.outPrintln("Exception whilst pasting: " + ex);
// could be anything being pasted in here
} catch (OutOfMemoryError oom)
{
@Override
public void wrapMenuItem_actionPerformed(ActionEvent e)
{
- scaleAbove.setVisible(wrapMenuItem.isSelected());
- scaleLeft.setVisible(wrapMenuItem.isSelected());
- scaleRight.setVisible(wrapMenuItem.isSelected());
- viewport.setWrapAlignment(wrapMenuItem.isSelected());
+ setWrapFormat(wrapMenuItem.isSelected(), false);
+ }
+
+ public void setWrapFormat(boolean b, boolean setMenuItem)
+ {
+ scaleAbove.setVisible(b);
+ scaleLeft.setVisible(b);
+ scaleRight.setVisible(b);
+ viewport.setWrapAlignment(b);
alignPanel.updateLayout();
+ if (setMenuItem)
+ {
+ wrapMenuItem.setSelected(b);
+ }
}
@Override
}
JInternalFrame frame = new JInternalFrame();
-
+ frame.setFrameIcon(null);
frame.getContentPane().add(new JScrollPane(pane));
Desktop.addInternalFrame(frame, MessageManager
return alignPanel.overviewPanel;
}
JInternalFrame frame = new JInternalFrame();
+ frame.setFrameIcon(null);
final OverviewPanel overview = new OverviewPanel(alignPanel, frame,
showHidden);
frame.setContentPane(overview);
Desktop.addInternalFrame(frame, "", true, frame.getWidth(),
frame.getHeight(), true, true);
- frame.setFrameIcon(null);
frame.pack();
frame.setLayer(JLayeredPane.PALETTE_LAYER);
final AlignmentPanel thePanel = this.alignPanel;
else
{
JInternalFrame frame = new JInternalFrame();
+ frame.setFrameIcon(null);
frame.setContentPane(new PairwiseAlignPanel(viewport));
Desktop.addInternalFrame(frame,
MessageManager.getString("action.pairwise_alignment"), 600,
{
NewickFile fin = new NewickFile(
new FileParse(cm.getNewick(), DataSourceType.PASTE));
- String title = cm.getAnnotLabel() + " " + cm.getTreeMethod() + " tree"
- + aa.sequenceRef != null
+ String title = aa.label + " " + cm.getTreeMethod() + " tree"
+ + (aa.sequenceRef != null
? (" for " + aa.sequenceRef.getDisplayId(false))
- : "";
+ : "");
showColumnWiseTree(fin, aa, title, w, h, x, y);
} catch (Throwable xx)
{
return null;
}
- TreePanel tp = new TreePanel(alignPanel, nf, aa, title);
+ TreePanel tp = new TreePanel(alignPanel, nf, aa, treeTitle);
tp.setSize(w, h);
tp.setLocation(x, y);
}
- Desktop.addInternalFrame(tp, title, w, h);
+ Desktop.addInternalFrame(tp, treeTitle, w, h);
return tp;
} catch (Throwable xx)
{
{
try
{
- System.err.println("Waiting for building menu to finish.");
+ jalview.bin.Console
+ .errPrintln("Waiting for building menu to finish.");
Thread.sleep(10);
} catch (Exception e)
{
final List<JMenuItem> legacyItems = new ArrayList<>();
try
{
- // System.err.println("Building ws menu again "
+ // jalview.bin.Console.errPrintln("Building ws menu again "
// + Thread.currentThread());
// TODO: add support for context dependent disabling of services based
// on
Desktop.instance);
if (pe != null)
{
- System.err.println("Associated file : "
+ jalview.bin.Console.errPrintln("Associated file : "
+ (fm[0].toString()) + " with "
+ toassoc.getDisplayId(true));
assocfiles++;
viewport.getAlignment()));
} catch (Exception ex)
{
- System.err.println(ex.getMessage());
+ jalview.bin.Console.errPrintln(ex.getMessage());
return;
}
}
console.runScript();
} catch (Exception ex)
{
- System.err.println((ex.toString()));
+ jalview.bin.Console.errPrintln((ex.toString()));
JvOptionPane.showInternalMessageDialog(Desktop.desktop,
MessageManager.getString("label.couldnt_run_groovy_script"),
MessageManager.getString("label.groovy_support_failed"),
}
else
{
- System.err.println("Can't run Groovy script as console not found");
+ jalview.bin.Console
+ .errPrintln("Can't run Groovy script as console not found");
}
}
import jalview.commands.CommandI;
import jalview.datamodel.AlignedCodonFrame;
import jalview.datamodel.Alignment;
-import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.ColumnSelection;
import jalview.datamodel.ContactMatrixI;
import jalview.bin.Cache;
import jalview.bin.Console;
import jalview.bin.Jalview;
+import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.HiddenColumns;
import jalview.datamodel.SearchResultsI;
Dimension r = null;
if (av.getIdWidth() < 0)
{
- int afwidth = (alignFrame != null ? alignFrame.getWidth() : 300);
- int idWidth = Math.min(afwidth - 200, 2 * afwidth / 3);
- int maxwidth = Math.max(IdwidthAdjuster.MIN_ID_WIDTH, idWidth);
- r = calculateIdWidth(maxwidth);
+ r = calculateDefaultAlignmentIdWidth();
av.setIdWidth(r.width);
}
else
return r;
}
+ public Dimension calculateDefaultAlignmentIdWidth()
+ {
+ int afwidth = (alignFrame != null ? alignFrame.getWidth() : 300);
+ int idWidth = Math.min(afwidth - 200, 2 * afwidth / 3);
+ int maxwidth = Math.max(IdwidthAdjuster.MIN_ID_WIDTH, idWidth);
+ return calculateIdWidth(-1, false, false);
+ }
+
/**
* Calculate the width of the alignment labels based on the displayed names
* and any bounds on label width set in preferences.
*/
protected Dimension calculateIdWidth(int maxwidth)
{
+ return calculateIdWidth(maxwidth, true, false);
+ }
+
+ public Dimension calculateIdWidth(int maxwidth,
+ boolean includeAnnotations, boolean visibleOnly)
+ {
Container c = new Container();
FontMetrics fm = c.getFontMetrics(
}
// Also check annotation label widths
- i = 0;
-
- if (al.getAlignmentAnnotation() != null)
+ if (includeAnnotations && al.getAlignmentAnnotation() != null)
{
- fm = c.getFontMetrics(getAlabels().getFont());
-
- while (i < al.getAlignmentAnnotation().length)
+ if (Jalview.isHeadlessMode())
{
- String label = al.getAlignmentAnnotation()[i].label;
- int stringWidth = fm.stringWidth(label);
+ AnnotationLabels aal = this.getAlabels();
+ int stringWidth = aal.drawLabels(null, false, idWidth, false, fm);
idWidth = Math.max(idWidth, stringWidth);
- i++;
+ }
+ else
+ {
+ fm = c.getFontMetrics(getAlabels().getFont());
+
+ for (i = 0; i < al.getAlignmentAnnotation().length; i++)
+ {
+ AlignmentAnnotation aa = al.getAlignmentAnnotation()[i];
+ if (visibleOnly && !aa.visible)
+ {
+ continue;
+ }
+ String label = aa.label;
+ int stringWidth = fm.stringWidth(label);
+ idWidth = Math.max(idWidth, stringWidth);
+ }
}
}
// this is called after loading new annotation onto alignment
if (alignFrame.getHeight() == 0)
{
- System.out.println("NEEDS FIXING");
+ jalview.bin.Console.outPrintln("NEEDS FIXING");
}
validateAnnotationDimensions(true);
addNotify();
// not be called directly by programs.
// I note that addNotify() is called in several areas of Jalview.
- int annotationHeight = getAnnotationPanel().adjustPanelHeight();
- annotationHeight = getAnnotationPanel()
- .adjustForAlignFrame(adjustPanelHeight, annotationHeight);
+ AnnotationPanel ap = getAnnotationPanel();
+ int annotationHeight = ap.adjustPanelHeight();
+ annotationHeight = ap.adjustForAlignFrame(adjustPanelHeight,
+ annotationHeight);
hscroll.addNotify();
- annotationScroller.setPreferredSize(
- new Dimension(annotationScroller.getWidth(), annotationHeight));
-
Dimension e = idPanel.getSize();
- alabels.setSize(new Dimension(e.width, annotationHeight));
+ int idWidth = e.width;
+ boolean manuallyAdjusted = this.getIdPanel().getIdCanvas()
+ .manuallyAdjusted();
+ annotationScroller.setPreferredSize(new Dimension(
+ manuallyAdjusted ? idWidth : annotationScroller.getWidth(),
+ annotationHeight));
+
+ alabels.setPreferredSize(new Dimension(idWidth, annotationHeight));
annotationSpaceFillerHolder.setPreferredSize(new Dimension(
- annotationSpaceFillerHolder.getWidth(), annotationHeight));
+ manuallyAdjusted ? idWidth
+ : annotationSpaceFillerHolder.getWidth(),
+ annotationHeight));
annotationScroller.validate();
annotationScroller.addNotify();
+ ap.validate();
}
/**
boolean wrap = av.getWrapAlignment();
ViewportRanges ranges = av.getRanges();
ranges.setStartSeq(0);
- scalePanelHolder.setVisible(!wrap);
+ // scalePanelHolder.setVisible(!wrap);
hscroll.setVisible(!wrap);
- idwidthAdjuster.setVisible(!wrap);
+ // Allow idPanel width adjustment in wrap mode
+ idwidthAdjuster.setVisible(true);
if (wrap)
{
}
}
- idSpaceFillerPanel1.setVisible(!wrap);
+ // idSpaceFillerPanel1.setVisible(!wrap);
repaint();
}
public void paintComponent(Graphics g)
{
invalidate(); // needed so that the id width adjuster works correctly
-
Dimension d = getIdPanel().getIdCanvas().getPreferredSize();
- idPanelHolder.setPreferredSize(d);
- hscrollFillerPanel.setPreferredSize(new Dimension(d.width, 12));
+ int idWidth = d.width;
+
+ // check wrapped alignment as at least 1 residue width
+ if (av.getWrapAlignment())
+ {
+ SeqCanvas sc = this.getSeqPanel().seqCanvas;
+ if (sc != null && sc.getWidth() < sc.getMinimumWrappedCanvasWidth())
+ {
+ // need to make some adjustments
+ idWidth -= (sc.getMinimumWrappedCanvasWidth() - sc.getWidth());
+ av.setIdWidth(idWidth);
+ av.getAlignPanel().getIdPanel().getIdCanvas()
+ .setManuallyAdjusted(true);
+
+ validateAnnotationDimensions(false);
+ }
+ }
+
+ idPanelHolder.setPreferredSize(new Dimension(idWidth, d.height));
+ hscrollFillerPanel.setPreferredSize(new Dimension(idWidth, 12));
validate(); // needed so that the id width adjuster works correctly
}
int w = getIdPanel().getWidth();
+ w = this.calculateIdWidth(-1, true, true).width;
return (w > 0 ? w : calculateIdWidth().width);
}
- void makeAlignmentImage(ImageMaker.TYPE type, File file, String renderer) throws ImageOutputException
+ void makeAlignmentImage(ImageMaker.TYPE type, File file, String renderer)
+ throws ImageOutputException
{
makeAlignmentImage(type, file, renderer,
BitmapImageSizing.nullBitmapImageSizing());
final int borderBottomOffset = 5;
AlignmentDimension aDimension = getAlignmentDimension();
+
// todo use a lambda function in place of callback here?
ImageWriterI writer = new ImageWriterI()
{
}
- public void makePNGImageMap(File imgMapFile, String imageName) throws ImageOutputException
+ public void makePNGImageMap(File imgMapFile, String imageName)
+ throws ImageOutputException
{
// /////ONLY WORKS WITH NON WRAPPED ALIGNMENTS
// ////////////////////////////////////////////
} catch (Exception ex)
{
- throw new ImageOutputException("couldn't write ImageMap due to unexpected error",ex);
+ throw new ImageOutputException(
+ "couldn't write ImageMap due to unexpected error", ex);
}
} // /////////END OF IMAGE MAP
{
int seqPanelWidth = getSeqPanel().seqCanvas.getWidth();
- if (System.getProperty("java.awt.headless") != null
- && System.getProperty("java.awt.headless").equals("true"))
+ if (Jalview.isHeadlessMode())
{
seqPanelWidth = alignFrame.getWidth() - getVisibleIdWidth()
- vscroll.getPreferredSize().width
*/
package jalview.gui;
+import java.awt.Canvas;
import java.awt.Color;
import java.awt.Cursor;
import java.awt.Dimension;
import jalview.analysis.AlignSeq;
import jalview.analysis.AlignmentUtils;
+import jalview.bin.Cache;
+import jalview.bin.Jalview;
import jalview.datamodel.Alignment;
import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.Annotation;
/**
* height in pixels for allowing height adjuster to be active
*/
- private static int HEIGHT_ADJUSTER_HEIGHT = 10;
+ public static int HEIGHT_ADJUSTER_HEIGHT = 10;
private static final Font font = new Font("Arial", Font.PLAIN, 11);
private static final String COPYCONS_SEQ = MessageManager
.getString("label.copy_consensus_sequence");
+ private static final String ADJUST_ANNOTATION_LABELS_WIDTH_PREF = "ADJUST_ANNOTATION_LABELS_WIDTH";
+
private final boolean debugRedraw = false;
private AlignmentPanel ap;
private boolean resizePanel = false;
+ private int annotationIdWidth = -1;
+
+ public static final String RESIZE_MARGINS_MARK_PREF = "RESIZE_MARGINS_MARK";
+
/**
* Creates a new AnnotationLabels object
*
*/
public AnnotationLabels(AlignmentPanel ap)
{
-
this.ap = ap;
av = ap.av;
ToolTipManager.sharedInstance().registerComponent(this);
pop.add(consclipbrd);
}
- addColourOrFilterByOptions(ap,aa[selectedRow],pop);
-
+ addColourOrFilterByOptions(ap, aa[selectedRow], pop);
+
if (aa[selectedRow].graph == AlignmentAnnotation.CONTACT_MAP)
{
- addContactMatrixOptions(ap,aa[selectedRow],pop);
- // Set/adjust threshold for grouping ?
- // colour alignment by this [type]
- // select/hide columns by this row
-
- }
+ addContactMatrixOptions(ap, aa[selectedRow], pop);
+ // Set/adjust threshold for grouping ?
+ // colour alignment by this [type]
+ // select/hide columns by this row
+
}
-
+ }
+
pop.show(this, evt.getX(), evt.getY());
}
static void addColourOrFilterByOptions(final AlignmentPanel ap,
- final AlignmentAnnotation alignmentAnnotation, final JPopupMenu pop)
+ final AlignmentAnnotation alignmentAnnotation,
+ final JPopupMenu pop)
{
JMenuItem item;
- item = new JMenuItem(MessageManager.getString("label.colour_by_annotation"));
+ item = new JMenuItem(
+ MessageManager.getString("label.colour_by_annotation"));
item.addActionListener(new ActionListener()
{
-
+
@Override
public void actionPerformed(ActionEvent e)
{
- AnnotationColourChooser.displayFor(ap.av, ap,alignmentAnnotation,false);
+ AnnotationColourChooser.displayFor(ap.av, ap, alignmentAnnotation,
+ false);
};
});
pop.add(item);
- if (alignmentAnnotation.sequenceRef!=null)
+ if (alignmentAnnotation.sequenceRef != null)
{
- item = new JMenuItem(MessageManager.getString("label.colour_by_annotation")+" ("+MessageManager.getString("label.per_seq")+")");
+ item = new JMenuItem(
+ MessageManager.getString("label.colour_by_annotation") + " ("
+ + MessageManager.getString("label.per_seq") + ")");
item.addActionListener(new ActionListener()
{
@Override
public void actionPerformed(ActionEvent e)
{
- AnnotationColourChooser.displayFor(ap.av, ap,alignmentAnnotation,true);
+ AnnotationColourChooser.displayFor(ap.av, ap, alignmentAnnotation,
+ true);
};
});
pop.add(item);
}
- item = new JMenuItem(MessageManager.getString("action.select_by_annotation"));
+ item = new JMenuItem(
+ MessageManager.getString("action.select_by_annotation"));
item.addActionListener(new ActionListener()
{
-
+
@Override
public void actionPerformed(ActionEvent e)
{
- AnnotationColumnChooser.displayFor(ap.av,ap,alignmentAnnotation);
+ AnnotationColumnChooser.displayFor(ap.av, ap, alignmentAnnotation);
};
});
pop.add(item);
}
+
static void addContactMatrixOptions(final AlignmentPanel ap,
- final AlignmentAnnotation alignmentAnnotation, final JPopupMenu pop)
+ final AlignmentAnnotation alignmentAnnotation,
+ final JPopupMenu pop)
{
-
+
final ContactMatrixI cm = ap.av.getContactMatrix(alignmentAnnotation);
JMenuItem item;
if (cm != null)
if (cm.hasGroups())
{
- JCheckBoxMenuItem chitem = new JCheckBoxMenuItem(MessageManager.getString("action.show_groups_on_matrix"));
- chitem.setToolTipText(MessageManager.getString("action.show_groups_on_matrix_tooltip"));
- boolean showGroups = alignmentAnnotation.isShowGroupsForContactMatrix();
- final AlignmentAnnotation sel_row=alignmentAnnotation;
+ JCheckBoxMenuItem chitem = new JCheckBoxMenuItem(
+ MessageManager.getString("action.show_groups_on_matrix"));
+ chitem.setToolTipText(MessageManager
+ .getString("action.show_groups_on_matrix_tooltip"));
+ boolean showGroups = alignmentAnnotation
+ .isShowGroupsForContactMatrix();
+ final AlignmentAnnotation sel_row = alignmentAnnotation;
chitem.setState(showGroups);
chitem.addActionListener(new ActionListener()
{
public void actionPerformed(ActionEvent e)
{
sel_row.setShowGroupsForContactMatrix(chitem.getState());
- ap.getAnnotationPanel()
- .paint(ap.getAnnotationPanel().getGraphics());
+ // so any annotation colour changes are propagated - though they
+ // probably won't be unless the annotation row colours are removed
+ // too!
+ ap.alignmentChanged();
}
});
pop.add(chitem);
}
if (cm.hasTree())
{
- item = new JMenuItem(MessageManager.getString("action.show_tree_for_matrix"));
- item.setToolTipText(MessageManager.getString("action.show_tree_for_matrix_tooltip"));
+ item = new JMenuItem(
+ MessageManager.getString("action.show_tree_for_matrix"));
+ item.setToolTipText(MessageManager
+ .getString("action.show_tree_for_matrix_tooltip"));
item.addActionListener(new ActionListener()
{
}
else
{
- item = new JMenuItem(MessageManager.getString("action.cluster_matrix"));
- item.setToolTipText(MessageManager.getString("action.cluster_matrix_tooltip"));
+ item = new JMenuItem(
+ MessageManager.getString("action.cluster_matrix"));
+ item.setToolTipText(
+ MessageManager.getString("action.cluster_matrix_tooltip"));
item.addActionListener(new ActionListener()
{
@Override
public void run()
{
final long progBar;
- ap.alignFrame.setProgressBar(MessageManager.formatMessage("action.clustering_matrix_for",cm.getAnnotDescr(),5f), progBar = System.currentTimeMillis());
- cm.setGroupSet(GroupSet.makeGroups(cm, 5f, true));
+ ap.alignFrame.setProgressBar(
+ MessageManager.formatMessage(
+ "action.clustering_matrix_for",
+ cm.getAnnotDescr(), 5f),
+ progBar = System.currentTimeMillis());
+ cm.setGroupSet(GroupSet.makeGroups(cm, true));
+ cm.randomlyReColourGroups();
+ cm.transferGroupColorsTo(alignmentAnnotation);
+ ap.alignmentChanged();
ap.alignFrame.showContactMapTree(alignmentAnnotation, cm);
ap.alignFrame.setProgressBar(null, progBar);
}
}
drawComponent(g2, true, width);
-
}
/**
* @param width
* Width for scaling labels
*/
- public void drawComponent(Graphics g, boolean clip, int width)
+ public void drawComponent(Graphics g, boolean clip, int givenWidth)
{
- if (av.getFont().getSize() < 10)
+ int width = givenWidth;
+ IdwidthAdjuster iwa = null;
+ if (ap != null)
{
- g.setFont(font);
+ iwa = ap.idwidthAdjuster;
+ if ((Cache.getDefault(ADJUST_ANNOTATION_LABELS_WIDTH_PREF, true)
+ || Jalview.isHeadlessMode()))
+ {
+ Graphics2D g2d = (Graphics2D) g;
+ Graphics dummy = g2d.create();
+ int newAnnotationIdWidth = drawLabels(dummy, clip, width, false,
+ null);
+ dummy.dispose();
+ Dimension d = ap.calculateDefaultAlignmentIdWidth();
+ int alignmentIdWidth = d.width;
+ if (iwa != null && !iwa.manuallyAdjusted())
+ {
+ // If no manual adjustment to ID column with has been made then adjust
+ // width match widest of alignment or annotation id widths
+ boolean allowShrink = Cache.getDefault("ALLOW_SHRINK_ID_WIDTH",
+ false);
+ width = Math.max(alignmentIdWidth, newAnnotationIdWidth);
+ if (clip && width < givenWidth && !allowShrink)
+ {
+ width = givenWidth;
+ }
+ }
+ else if (newAnnotationIdWidth != annotationIdWidth
+ && newAnnotationIdWidth > givenWidth
+ && newAnnotationIdWidth > alignmentIdWidth)
+ {
+ // otherwise if the annotation id width has become larger than the
+ // current id width, increase
+ width = newAnnotationIdWidth;
+ annotationIdWidth = newAnnotationIdWidth;
+ }
+ // set the width if it's changed
+ if (width != ap.av.getIdWidth())
+ {
+ iwa.setWidth(width);
+ }
+ }
}
else
{
- g.setFont(av.getFont());
+ int newAnnotationIdWidth = drawLabels(g, clip, width, false, null);
+ width = Math.max(newAnnotationIdWidth, givenWidth);
+ }
+ drawLabels(g, clip, width, true, null);
+ }
+
+ /**
+ * Render the full set of annotation Labels for the alignment at the given
+ * cursor. If actuallyDraw is false or g is null then no actual drawing will
+ * occur, but the widest label width will be returned. If g is null then
+ * fmetrics must be supplied.
+ *
+ * Returns the width of the annotation labels.
+ *
+ * @param g
+ * Graphics2D instance (needed for font scaling)
+ * @param clip
+ * - true indicates that only current visible area needs to be
+ * rendered
+ * @param width
+ * Width for scaling labels
+ * @param fmetrics
+ * FontMetrics if Graphics object g is null
+ */
+ public int drawLabels(Graphics g0, boolean clip, int width,
+ boolean actuallyDraw, FontMetrics fmetrics)
+ {
+ if (clip)
+ {
+ clip = Cache.getDefault("MOVE_SEQUENCE_ID_WITH_VISIBLE_ANNOTATIONS",
+ true);
+ }
+ Graphics g = null;
+ // create a dummy Graphics object if not drawing and one is supplied
+ if (g0 != null)
+ {
+ if (!actuallyDraw)
+ {
+ Graphics2D g2d = (Graphics2D) g0;
+ g = g2d.create();
+ }
+ else
+ {
+ g = g0;
+ }
}
+ int actualWidth = 0;
+ if (g != null)
+ {
+ if (av.getFont().getSize() < 10)
+ {
+ g.setFont(font);
+ }
+ else
+ {
+ g.setFont(av.getFont());
+ }
+ }
+
+ FontMetrics fm = fmetrics == null ? g.getFontMetrics(g.getFont())
+ : fmetrics;
+ if (actuallyDraw)
+ {
+ g.setColor(Color.white);
+ g.fillRect(0, 0, getWidth(), getHeight());
+
+ if (!Cache.getDefault(RESIZE_MARGINS_MARK_PREF, false)
+ && !av.getWrapAlignment())
+ {
+ g.setColor(Color.LIGHT_GRAY);
+ g.drawLine(0, HEIGHT_ADJUSTER_HEIGHT / 4, HEIGHT_ADJUSTER_WIDTH / 4,
+ HEIGHT_ADJUSTER_HEIGHT / 4);
+ g.drawLine(0, 3 * HEIGHT_ADJUSTER_HEIGHT / 4,
+ HEIGHT_ADJUSTER_WIDTH / 4, 3 * HEIGHT_ADJUSTER_HEIGHT / 4);
- FontMetrics fm = g.getFontMetrics(g.getFont());
- g.setColor(Color.white);
- g.fillRect(0, 0, getWidth(), getHeight());
+ }
+ }
- g.translate(0, getScrollOffset());
- g.setColor(Color.black);
+ if (actuallyDraw)
+ {
+ g.translate(0, getScrollOffset());
+ g.setColor(Color.black);
+ }
SequenceI lastSeqRef = null;
String lastLabel = null;
AlignmentAnnotation[] aa = av.getAlignment().getAlignmentAnnotation();
- int fontHeight = g.getFont().getSize();
+ int fontHeight = g != null ? g.getFont().getSize()
+ : fm.getFont().getSize();
int y = 0;
int x = 0;
int graphExtras = 0;
int offset = 0;
- Font baseFont = g.getFont();
+ Font baseFont = g != null ? g.getFont() : fm.getFont();
FontMetrics baseMetrics = fm;
int ofontH = fontHeight;
int sOffset = 0;
{
if (debugRedraw)
{
- System.out.println("before vis: " + i);
+ jalview.bin.Console.outPrintln("before vis: " + i);
}
before = true;
}
{
if (debugRedraw)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Scroll offset: " + sOffset + " after vis: " + i);
}
after = true;
continue;
}
}
- g.setColor(Color.black);
-
+ if (actuallyDraw && g != null)
+ {
+ g.setColor(Color.black);
+ }
offset = -aa[i].height / 2;
if (aa[i].hasText)
vertBar = true;
}
}
- x = width - fm.stringWidth(label) - 3;
+
+ int labelWidth = fm.stringWidth(label) + 3;
+ x = width - labelWidth;
if (aa[i].graphGroup > -1)
{
s = ((float) fontHeight) / (float) ofontH;
Font f = baseFont
.deriveFont(AffineTransform.getScaleInstance(s, s));
- g.setFont(f);
- fm = g.getFontMetrics();
- graphExtras = (aa[i].height - (groupSize * (fontHeight + 8)))
- / 2;
+ Canvas c = new Canvas();
+ fm = c.getFontMetrics(f);
+ if (actuallyDraw && g != null)
+ {
+ g.setFont(f);
+ // fm = g.getFontMetrics();
+ graphExtras = (aa[i].height
+ - (groupSize * (fontHeight + 8))) / 2;
+ }
}
}
if (visible)
{
if (aa[gg].graphGroup == aa[i].graphGroup)
{
- x = width - fm.stringWidth(aa[gg].label) - 3;
- g.drawString(aa[gg].label, x, y - graphExtras);
-
- if (aa[gg]._linecolour != null)
+ labelWidth = fm.stringWidth(aa[gg].label) + 3;
+ x = width - labelWidth;
+ if (actuallyDraw && g != null)
{
+ g.drawString(aa[gg].label, x, y - graphExtras);
- g.setColor(aa[gg]._linecolour);
- g.drawLine(x, y - graphExtras + 3,
- x + fm.stringWidth(aa[gg].label),
- y - graphExtras + 3);
- }
+ if (aa[gg]._linecolour != null)
+ {
+
+ g.setColor(aa[gg]._linecolour);
+ g.drawLine(x, y - graphExtras + 3,
+ x + fm.stringWidth(aa[gg].label),
+ y - graphExtras + 3);
+ }
- g.setColor(Color.black);
+ g.setColor(Color.black);
+ }
graphExtras += fontHeight + 8;
}
}
}
- g.setFont(baseFont);
+ if (actuallyDraw && g != null)
+ {
+ g.setFont(baseFont);
+ }
fm = baseMetrics;
fontHeight = ofontH;
}
else
{
- if (vertBar)
+ if (actuallyDraw && g != null)
{
- g.drawLine(width - 3, y + offset - fontHeight, width - 3,
- (int) (y - 1.5 * aa[i].height - offset - fontHeight));
- // g.drawLine(20, y + offset, x - 20, y + offset);
+ if (vertBar)
+ {
+ g.drawLine(width - 3, y + offset - fontHeight, width - 3,
+ (int) (y - 1.5 * aa[i].height - offset - fontHeight));
+ // g.drawLine(20, y + offset, x - 20, y + offset);
+ }
+ g.drawString(label, x, y + offset);
}
- g.drawString(label, x, y + offset);
}
lastSeqRef = aa[i].sequenceRef;
+
+ if (labelWidth > actualWidth)
+ {
+ actualWidth = labelWidth;
+ }
}
}
if (!resizePanel && dragEvent != null && aa != null)
{
- g.setColor(Color.lightGray);
- g.drawString(
- (aa[selectedRow].sequenceRef == null ? ""
- : aa[selectedRow].sequenceRef.getName())
- + aa[selectedRow].label,
- dragEvent.getX(), dragEvent.getY() - getScrollOffset());
+ if (actuallyDraw && g != null)
+ {
+ g.setColor(Color.lightGray);
+ g.drawString(
+ (aa[selectedRow].sequenceRef == null ? ""
+ : aa[selectedRow].sequenceRef.getName())
+ + aa[selectedRow].label,
+ dragEvent.getX(), dragEvent.getY() - getScrollOffset());
+ }
}
if (!av.getWrapAlignment() && ((aa == null) || (aa.length < 1)))
{
- g.drawString(MessageManager.getString("label.right_click"), 2, 8);
- g.drawString(MessageManager.getString("label.to_add_annotation"), 2,
- 18);
+ if (actuallyDraw && g != null)
+ {
+ g.drawString(MessageManager.getString("label.right_click"), 2, 8);
+ g.drawString(MessageManager.getString("label.to_add_annotation"), 2,
+ 18);
+ }
}
+
+ return actualWidth;
}
public int getScrollOffset()
if (evt.isControlDown()
&& PAEContactMatrix.PAEMATRIX.equals(clicked.getCalcId()))
{
- int c = fr - 1;
+ int c = fr;
ContactRange cr = forCurrentX.getRangeFor(fr, to);
double cval;
// TODO: could use GraphLine instead of arbitrary picking
// controls feathering - what other elements in row/column
// should we select
double thresh = cr.getMean() + (cr.getMax() - cr.getMean()) * .15;
- while (c > 0)
+ while (c >= 0)
{
cval = forCurrentX.getContactAt(c);
if (// cr.getMin() <= cval &&
ContactGeometry lastXcgeom = new ContactGeometry(forFromX,
cma.graphHeight);
ContactGeometry.contactInterval lastXci = lastXcgeom
- .mapFor(rowIndex[1], rowIndex[1] - deltaY);
+ .mapFor(rowIndex[1], rowIndex[1] + deltaY);
ContactGeometry cXcgeom = new ContactGeometry(forToX,
cma.graphHeight);
ContactGeometry.contactInterval cXci = cXcgeom.mapFor(rowIndex[1],
- rowIndex[1] - deltaY);
+ rowIndex[1] + deltaY);
// mark rectangular region formed by drag
jalview.bin.Console.trace("Matrix Selection from last(" + fromXc
{
row = i;
res[0] = row;
- res[1] = height - yPos;
+ res[1] = yPos-lheight;
break;
}
}
// TODO abstract tooltip generator so different implementations can be built
if (ann.graph == AlignmentAnnotation.CONTACT_MAP)
{
+ if (rowAndOffset>=ann.graphHeight)
+ {
+ return null;
+ }
ContactListI clist = av.getContactList(ann, column);
if (clist != null)
{
tried = true;
} catch (IllegalArgumentException exc)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Serious issue with viewport geometry imgWidth requested was "
+ imgWidth);
return;
&& (fadedImage == null || fadedImage.getWidth() != imgWidth
|| fadedImage.getHeight() != image.getHeight()))
{
- // System.err.println("redraw faded image ("+(fadedImage==null ?
+ // jalview.bin.Console.errPrintln("redraw faded image ("+(fadedImage==null ?
// "null image" : "") + " lastGood="+lastImageGood+")");
fadedImage = new BufferedImage(imgWidth, image.getHeight(),
BufferedImage.TYPE_INT_RGB);
import java.awt.Graphics2D;
import java.awt.RenderingHints;
import java.io.File;
+import java.lang.reflect.InvocationTargetException;
import java.util.List;
import java.util.Locale;
import java.util.Map;
+import java.util.concurrent.Callable;
+import java.util.concurrent.CompletableFuture;
+import java.util.concurrent.ExecutorService;
+import java.util.concurrent.Executors;
+import java.util.concurrent.Future;
+import java.util.concurrent.FutureTask;
import javax.swing.JPanel;
import javax.swing.JSplitPane;
}
if (waitTotal > waitMax)
{
- System.err.println("Timed out waiting for Jmol to load files after "
+ jalview.bin.Console.errPrintln("Timed out waiting for Jmol to load files after "
+ waitTotal + "ms");
- // System.err.println("finished: " + jmb.isFinishedInit()
+ // jalview.bin.Console.errPrintln("finished: " + jmb.isFinishedInit()
// + "; loaded: " + Arrays.toString(jmb.getPdbFile())
// + "; files: " + files.toString());
jmb.getStructureFiles();
};
String view = MessageManager.getString("action.view")
.toLowerCase(Locale.ROOT);
- ImageExporter exporter = new ImageExporter(writer,
+ final ImageExporter exporter = new ImageExporter(writer,
getProgressIndicator(), type, getTitle());
- exporter.doExport(file, this, width, height, view, renderer, userBis);
-
+ final Throwable[] exceptions = new Throwable[1];
+ exceptions[0] = null;
+ final AppJmol us = this;
+ try
+ {
+ Thread runner = Executors.defaultThreadFactory().newThread(new Runnable()
+ {
+ @Override
+ public void run()
+ {
+ try
+ {
+ exporter.doExport(file, us, width, height, view, renderer,
+ userBis);
+ } catch (Throwable t)
+ {
+ exceptions[0] = t;
+ }
+ }
+ });
+ runner.start();
+ do { Thread.sleep(25); } while (runner.isAlive());
+ } catch (Throwable e)
+ {
+ throw new ImageOutputException(
+ "Unexpected error when generating image", e);
+ }
+ if (exceptions[0] != null)
+ {
+ if (exceptions[0] instanceof ImageOutputException)
+ {
+ throw ((ImageOutputException) exceptions[0]);
+ }
+ else
+ {
+ throw new ImageOutputException(
+ "Unexpected error when generating image", exceptions[0]);
+ }
+ }
}
@Override
.openURL("http://wiki.jmol.org");// http://jmol.sourceforge.net/docs/JmolUserGuide/");
} catch (Exception ex)
{
- System.err.println("Show Jmol help failed with: " + ex.getMessage());
+ jalview.bin.Console.errPrintln("Show Jmol help failed with: " + ex.getMessage());
}
}
if (shift != null)
{
int i = shift.shift(newBase.getIndex());
- // System.err.println("shifted "+(arg1.getIndex())+" to "+i);
+ // jalview.bin.Console.errPrintln("shifted "+(arg1.getIndex())+" to "+i);
ssm.mouseOverVamsasSequence(seq, i, this);
}
else
} catch (ExceptionNAViewAlgorithm e)
{
// only throwable for draw mode = 3 NAView
- System.err.println("Error drawing RNA: " + e.getMessage());
+ jalview.bin.Console.errPrintln("Error drawing RNA: " + e.getMessage());
}
}
}
String formattedDate = Cache.setDateProperty(
"JALVIEW_NEWS_RSS_LASTMODIFIED", lastread.getTime());
BlogReader me = new BlogReader();
- System.out.println("Set last date to " + formattedDate);
+ jalview.bin.Console.outPrintln("Set last date to " + formattedDate);
if (me.isNewsNew())
{
Console.debug("There is news to read.");
boolean opened = jmb.openSession(chimeraSessionFile);
if (!opened)
{
- System.err.println("An error occurred opening Chimera session file "
+ jalview.bin.Console.errPrintln("An error occurred opening Chimera session file "
+ chimeraSessionFile);
}
}
}
} catch (Exception ex)
{
- System.out.println("Error loading User ColourFile\n" + ex);
+ jalview.bin.Console.outPrintln("Error loading User ColourFile\n" + ex);
}
}
// you may omit this part for your application
//
- System.out.println("Hello World 2");
- System.out.println("All fonts available to Graphic2D:\n");
+ jalview.bin.Console.outPrintln("Hello World 2");
+ jalview.bin.Console.outPrintln("All fonts available to Graphic2D:\n");
GraphicsEnvironment ge = GraphicsEnvironment
.getLocalGraphicsEnvironment();
String[] fontNames = ge.getAvailableFontFamilyNames();
for (int n = 0; n < fontNames.length; n++)
{
- System.out.println(fontNames[n]);
+ jalview.bin.Console.outPrintln(fontNames[n]);
}
// Testing part: simple an error thrown anywhere in this JVM will be printed
// on the Console
// We do it with a seperate Thread becasue we don't wan't to break a Thread
// used by the Console.
- System.out.println("\nLets throw an error on this console");
+ jalview.bin.Console.outPrintln("\nLets throw an error on this console");
errorThrower = new Thread(this);
errorThrower.setDaemon(true);
errorThrower.start();
MessageManager.getString("label.cant_map_cds"),
MessageManager.getString("label.operation_failed"),
JvOptionPane.OK_OPTION);
- System.err.println("Failed to make CDS alignment");
+ jalview.bin.Console.errPrintln("Failed to make CDS alignment");
return null;
}
if (copyAlignment.getHeight() <= 0)
{
- System.err.println("No Sequences generated for xRef type " + source);
+ jalview.bin.Console.errPrintln("No Sequences generated for xRef type " + source);
return null;
}
* Send this message to stderr as the warning that follows (due to
* reflection) also goes to stderr.
*/
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Linux platform only! You may have the following warning next: \"WARNING: An illegal reflective access operation has occurred\"\nThis is expected and cannot be avoided, sorry about that.");
}
final String awtAppClassName = "awtAppClassName";
}
// Thread off a new instance of the file chooser - this reduces the time
- // it
- // takes to open it later on.
+ // it takes to open it later on.
new Thread(new Runnable()
{
@Override
public void run()
{
jalview.bin.Console.debug("Filechooser init thread started.");
- String fileFormat = Cache.getProperty("DEFAULT_FILE_FORMAT");
+ String fileFormat = FileLoader.getUseDefaultFileFormat()
+ ? Cache.getProperty("DEFAULT_FILE_FORMAT")
+ : null;
JalviewFileChooser.forRead(Cache.getProperty("LAST_DIRECTORY"),
fileFormat);
jalview.bin.Console.debug("Filechooser init thread finished.");
}
} catch (Exception ex)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Unable to paste alignment from system clipboard:\n" + ex);
}
}
setKeyBindings(frame);
- desktop.add(frame);
+ // Since the latest FlatLaf patch, we occasionally have problems showing structureViewer frames...
+ int tries=3;
+ boolean shown=false;
+ Exception last=null;
+ do
+ {
+ try
+ {
+ desktop.add(frame);
+ shown=true;
+ } catch (IllegalArgumentException iaex)
+ {
+ last=iaex;
+ tries--;
+ jalview.bin.Console.info(
+ "Squashed IllegalArgument Exception (" + tries + " left) for "+frame.getTitle(),
+ iaex);
+ try
+ {
+ Thread.sleep(5);
+ } catch (InterruptedException iex)
+ {
+ }
+ ;
+ }
+ } while (!shown && tries > 0);
+ if (!shown)
+ {
+ jalview.bin.Console.error("Serious Problem whilst showing window "+frame.getTitle(),last);
+ }
windowMenu.add(menuItem);
@Override
public void inputLocalFileMenuItem_actionPerformed(AlignViewport viewport)
{
- String fileFormat = Cache.getProperty("DEFAULT_FILE_FORMAT");
+ String fileFormat = FileLoader.getUseDefaultFileFormat()
+ ? Cache.getProperty("DEFAULT_FILE_FORMAT")
+ : null;
JalviewFileChooser chooser = JalviewFileChooser.forRead(
Cache.getProperty("LAST_DIRECTORY"), fileFormat,
BackupFiles.getEnabled());
}
} catch (Exception ex)
{
- System.err.println("Error opening help: " + ex.getMessage());
+ jalview.bin.Console.errPrintln("Error opening help: " + ex.getMessage());
}
}
boolean autoSave = projectFile != null && !saveAs
&& BackupFiles.getEnabled();
- // System.out.println("autoSave="+autoSave+", projectFile='"+projectFile+"',
+ // jalview.bin.Console.outPrintln("autoSave="+autoSave+", projectFile='"+projectFile+"',
// saveAs="+saveAs+", Backups
// "+(BackupFiles.getEnabled()?"enabled":"disabled"));
{
if (Platform.isAMacAndNotJS())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Please ignore plist error - occurs due to problem with java 8 on OSX");
}
}
{
Desktop.instance.closeAll_actionPerformed(null);
Desktop.instance.setVisible(false);
- Desktop.instance.dispose();
+ Desktop us = Desktop.instance;
Desktop.instance = null;
+ // call dispose in a separate thread - try to avoid indirect deadlocks
+ new Thread(new Runnable() {
+ @Override
+ public void run()
+ {
+ ExecutorService dex = us.dialogExecutor;
+ if (dex!=null) {
+ dex.shutdownNow();
+ us.dialogExecutor=null;
+ us.block.drainPermits();
+ }
+ us.dispose();
+ }
+ }).start();
}
}
}
} catch (Exception ex)
{
- System.out.println("Error loading User Colour File\n" + ex);
+ jalview.bin.Console.outPrintln("Error loading User Colour File\n" + ex);
}
}
{
Color newColor = gcol.getMaxColour();
comp.setBackground(newColor);
- // System.err.println("Width is " + w / 2);
+ // jalview.bin.Console.errPrintln("Width is " + w / 2);
Icon ficon = new FeatureIcon(gcol, comp.getBackground(), w, h, thr);
comp.setIcon(ficon);
// tt+="RGB value: Max (" + newColor.getRed() + ", "
{
if (featureSettings != null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION ISSUE: overwriting action listener for FeatureColourChooser");
}
featureSettings = listener;
hb.setCurrentID(id.getId());
} catch (BadIDException bad)
{
- System.out.println("Bad help link: " + id.getId()
+ jalview.bin.Console.outPrintln("Bad help link: " + id.getId()
+ ": must match a target in help.jhm");
throw bad;
}
import java.awt.BorderLayout;
import java.awt.Color;
+import java.awt.Dimension;
import java.awt.Font;
import java.awt.FontMetrics;
import java.awt.Graphics;
void drawIdsWrapped(Graphics2D g, AlignViewport alignViewport,
int startSeq, int pageHeight)
{
+ drawIdsWrapped(g, alignViewport, startSeq, pageHeight, -1);
+ }
+
+ void drawIdsWrapped(Graphics2D g, AlignViewport alignViewport,
+ int startSeq, int pageHeight, int idWidth)
+ {
int alignmentWidth = alignViewport.getAlignment().getWidth();
final int alheight = alignViewport.getAlignment().getHeight();
if (labels != null && alignViewport.isShowAnnotation())
{
+ int getWidth = getWidth();
+ int thisIdWidth = getWidth;
g.translate(0, ypos + (alheight * charHeight));
- labels.drawComponent(g, getWidth());
+ if (!manuallyAdjusted())
+ {
+ int getAnnotationsIdWidth = labels.drawLabels(g, false, -1, false,
+ null);
+ thisIdWidth = idWidth < 0 ? getAnnotationsIdWidth : idWidth;
+ if (thisIdWidth > getWidth)
+ {
+ this.setPreferredSize(
+ new Dimension(thisIdWidth, this.getHeight()));
+ this.repaint();
+ alignViewport.setIdWidth(thisIdWidth);
+ }
+ }
+ labels.drawComponent(g, false, thisIdWidth);
g.translate(0, -ypos - (alheight * charHeight));
}
repaint();
}
}
+
+ private boolean manuallyAdjusted = false;
+
+ public boolean manuallyAdjusted()
+ {
+ return manuallyAdjusted;
+ }
+
+ public void setManuallyAdjusted(boolean b)
+ {
+ manuallyAdjusted = b;
+ }
}
*/
package jalview.gui;
-import jalview.api.AlignViewportI;
-
import java.awt.Color;
import java.awt.Cursor;
import java.awt.Graphics;
import javax.swing.JPanel;
+import jalview.api.AlignViewportI;
+import jalview.bin.Cache;
+
/**
* DOCUMENT ME!
*
return;
}
+ /*
+ * don't allow residue width to be < 1 in wrapped format
+ */
+ if (viewport.getWrapAlignment())
+ {
+ SeqCanvas sc = ap.getSeqPanel().seqCanvas;
+ if (sc != null && sc.getWrappedCanvasWidth(sc.getWidth() - dif) < 1)
+ {
+ return;
+ }
+ }
+
oldX = evt.getX();
/*
return;
}
viewport.setIdWidth(newWidth);
+ ap.validateAnnotationDimensions(false);
+ ap.paintAlignment(true, false);
+
+ ap.getIdPanel().getIdCanvas().setManuallyAdjusted(true);
+ }
+
+ public void setWidth(int newWidth)
+ {
+ if (newWidth < MIN_ID_WIDTH
+ || ap.getIdPanel().getIdCanvas().manuallyAdjusted())
+ {
+ return;
+ }
+ final AlignViewportI viewport = ap.getAlignViewport();
+ viewport.setIdWidth(newWidth);
ap.paintAlignment(true, false);
}
+ public boolean manuallyAdjusted()
+ {
+ return ap.getIdPanel().getIdCanvas().manuallyAdjusted();
+ }
+
@Override
public void mouseMoved(MouseEvent evt)
{
@Override
public void paintComponent(Graphics g)
{
+ int width = getWidth();
+ int height = getHeight();
g.setColor(Color.white);
- g.fillRect(0, 0, getWidth(), getHeight());
+ g.fillRect(0, 0, width, height);
+
+ if (!Cache.getDefault(AnnotationLabels.RESIZE_MARGINS_MARK_PREF, false))
+ // && !ap.getAlignViewport().getWrapAlignment()) // now allowing adjustment
+ // in wrap mode
+ {
+ int spacer = Math.max(2, AnnotationLabels.HEIGHT_ADJUSTER_HEIGHT / 4);
+ g.setColor(Color.LIGHT_GRAY);
+ g.drawLine(width - 3 * spacer, 0, width - 3 * spacer, height / 2);
+ g.drawLine(width - spacer, 0, width - spacer, height / 2);
+ }
+
setCursor(Cursor.getPredefinedCursor(Cursor.W_RESIZE_CURSOR));
}
}
import jalview.util.ImageMaker.TYPE;
import jalview.util.MessageManager;
import jalview.util.Platform;
+import jalview.util.StringUtils;
import jalview.util.imagemaker.BitmapImageSizing;
/**
}
public void doExport(File file, Component parent, int width, int height,
- String imageSource, String renderer, BitmapImageSizing userBis) throws ImageOutputException
+ String imageSource, String renderer, BitmapImageSizing userBis)
+ throws ImageOutputException
{
final long messageId = System.currentTimeMillis();
setStatus(
*/
if (file == null && !Jalview.isHeadlessMode())
{
+ if (Desktop.instance.isInBatchMode())
+ {
+ // defensive error report - we could wait for user input.. I guess ?
+ throw (new ImageOutputException(
+ "Need an output file to render to when exporting images in batch mode!"));
+ }
JalviewFileChooser chooser = imageType.getFileChooser();
chooser.setFileView(new JalviewFileView());
MessageManager.formatMessage("label.create_image_of",
renderStyle = "Text";
}
AtomicBoolean textSelected = new AtomicBoolean(
- !"Lineart".equals(renderStyle));
- if ((imageType == TYPE.EPS || imageType == TYPE.SVG)
- && LineartOptions.PROMPT_EACH_TIME.equals(renderStyle)
+ !StringUtils.equalsIgnoreCase("lineart", renderStyle));
+ if ((imageType == TYPE.EPS || imageType == TYPE.SVG) && StringUtils
+ .equalsIgnoreCase(LineartOptions.PROMPT_EACH_TIME, renderStyle)
&& !Jalview.isHeadlessMode())
{
final File chosenFile = file;
else
{
/*
- * character rendering not required, or preference already set
- * - just do the export
+ * character rendering not required, or preference already set
+ * or we're in headless mode - just do the export
*/
exportImage(file, !textSelected.get(), width, height, messageId,
userBis);
messageId);
} catch (Exception e)
{
- jalview.bin.Console.error(String.format("Error creating %s file: %s", type,
- e.toString()),e);
+ jalview.bin.Console.error(String.format("Error creating %s file: %s",
+ type, e.toString()), e);
setStatus(MessageManager.formatMessage("info.error_creating_file",
type), messageId);
}
}
else
{
- System.err.println("dupe ig for : " + dbs[i] + " \t"
+ jalview.bin.Console.errPrintln("dupe ig for : " + dbs[i] + " \t"
+ dbp.getDbName() + " (" + dbp.getDbSource() + ")");
source.remove(tn);
}
@Override
public void setVisible(boolean arg0)
{
- System.out.println("setVisible: " + arg0);
+ jalview.bin.Console.outPrintln("setVisible: " + arg0);
super.setVisible(arg0);
}
}
private static void outputMessage(Object message)
{
- System.out.println(">>> JOption Message : " + message.toString());
+ jalview.bin.Console.outPrintln(">>> JOption Message : " + message.toString());
}
public static Object getMockResponse()
private void internalDialogHandleResponse()
{
- String responseString = (String) this.getValue();
+ Object value = this.getValue();
+ if (value == null
+ || (value instanceof Integer && (Integer) value == -1))
+ {
+ return;
+ }
+ String responseString = value.toString();
int response = ourOptions.indexOf(responseString);
if (!Platform.isJS())
}
} catch (NumberFormatException e)
{
- System.err.println(e.toString());
+ jalview.bin.Console.errPrintln(e.toString());
}
if (minValue != null || maxValue != null)
{
}
} catch (NumberFormatException e)
{
- System.err.println(e.toString());
+ jalview.bin.Console.errPrintln(e.toString());
}
if (minValue != null && maxValue != null)
{
{
// raise an implementation warning here - not sure if this situation
// will ever occur
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION PROBLEM: DATASET out of sync due to an insert whilst calling PaintRefresher.validateSequences(AlignmentI, ALignmentI)");
}
List<SequenceI> alsq = comp.getSequences();
if (!first)
{
- System.out.println(DASHES);
+ jalview.bin.Console.outPrintln(DASHES);
textarea.append(DASHES);
}
first = false;
for (int i = 0; i < seqs.length; i++)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
String.format("%3d %s", i + 1, seqs[i].getDisplayId(true)));
}
{
System.out.print(String.format("%7d", i + 1));
}
- System.out.println();
+ jalview.bin.Console.outPrintln();
for (int i = 0; i < seqs.length; i++)
{
*/
System.out.print(String.format("%7.3f", scores[i][j] / totscore));
}
- System.out.println();
+ jalview.bin.Console.outPrintln();
}
- System.out.println("\n");
+ jalview.bin.Console.outPrintln("\n");
}
/**
if (Platform.isJS())
{
details = new JInternalFrame();
+ details.setFrameIcon(null);
JPanel panel = new JPanel(new BorderLayout());
panel.setOpaque(true);
panel.setBackground(Color.white);
protected void addReferenceAnnotations_actionPerformed(
Map<SequenceI, List<AlignmentAnnotation>> candidates)
{
- final SequenceGroup selectionGroup = this.ap.av.getSelectionGroup();
final AlignmentI alignment = this.ap.getAlignment();
AlignmentUtils.addReferenceAnnotations(candidates, alignment,
- selectionGroup);
+ null);
refresh();
}
pane.setBackground(Color.WHITE);
pane.add(textLabel, BorderLayout.NORTH);
frame = new JInternalFrame();
+ frame.setFrameIcon(null);
frame.getContentPane().add(new JScrollPane(pane));
}
else
String[] omitHidden = null;
- System.out.println("PROMPT USER HERE"); // TODO: decide if a prompt happens
+ jalview.bin.Console.outPrintln("PROMPT USER HERE"); // TODO: decide if a prompt happens
// or we simply trust the user wants
// wysiwig behaviour
final JPanel progressPanel = progressBars.get(id);
if (progressPanel == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"call setProgressBar before registering the progress bar's handler.");
return;
}
protected List<String> executeCommand(StructureCommandI command,
boolean getReply)
{
- // System.out.println(command.toString()); // debug
+ // jalview.bin.Console.outPrintln(command.toString()); // debug
return pymolManager.sendCommand(command, getReply);
}
validate();
sliderValueChanged();
- // System.out.println((System.currentTimeMillis()-start));
+ // jalview.bin.Console.outPrintln((System.currentTimeMillis()-start));
}
void sliderValueChanged()
.newInstance());
} catch (Throwable x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected exception when instantiating rest input type.");
x.printStackTrace();
}
updated = true;
} catch (InvalidArgumentException ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION ERROR: Invalid argument for type : "
+ typeList.getSelectedValue() + "\n");
ex.printStackTrace();
types.add(jtype.getURLtokenPrefix());
} catch (Throwable x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected exception when instantiating rest input type.");
x.printStackTrace();
}
mtch.group(2) + ":" + mtch.group(3), mtch.group(1),
mtch.group(2), mtch.group(3), inputTypes, warnings))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION PROBLEM: Cannot parse RestService input parameter string '"
+ its + "'" + "\n" + warnings);
}
} catch (Throwable x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION PROBLEM: Cannot parse RestService output parameter string '"
+ its + "'" + "\n" + warnings);
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION PROBLEM: Restservice generated from GUI is invalid\n"
+ warnings);
}
}
- // System.err.println(">>> FastPaint to " + transX + " " + transY + " "
+ // jalview.bin.Console.errPrintln(">>> FastPaint to " + transX + " " + transY + " "
// + horizontal + " " + vertical + " " + startRes + " " + endRes
// + " " + startSeq + " " + endSeq);
// Call repaint on alignment panel so that repaints from other alignment
// panel components can be aggregated. Otherwise performance of the
// overview window and others may be adversely affected.
- // System.out.println("SeqCanvas fastPaint() repaint() request...");
+ // jalview.bin.Console.outPrintln("SeqCanvas fastPaint() repaint() request...");
av.getAlignPanel().repaint();
} finally
{
return (canvasWidth - labelWidthEast - labelWidthWest) / charWidth;
}
+ public int getMinimumWrappedCanvasWidth()
+ {
+ int charWidth = av.getCharWidth();
+ FontMetrics fm = getFontMetrics(av.getFont());
+ int labelWidth = 0;
+ if (av.getScaleRightWrapped() || av.getScaleLeftWrapped())
+ {
+ labelWidth = getLabelWidth(fm);
+ }
+ labelWidthEast = av.getScaleRightWrapped() ? labelWidth : 0;
+ labelWidthWest = av.getScaleLeftWrapped() ? labelWidth : 0;
+ return labelWidthEast + labelWidthWest + charWidth;
+ }
+
/**
* Returns a pixel width sufficient to show the largest sequence coordinate
* (end position) in the alignment, calculated as the FontMetrics width of
public void propertyChange(PropertyChangeEvent evt)
{
String eventName = evt.getPropertyName();
- // System.err.println(">>SeqCanvas propertyChange " + eventName);
+ // jalview.bin.Console.errPrintln(">>SeqCanvas propertyChange " + eventName);
if (eventName.equals(SequenceGroup.SEQ_GROUP_CHANGED))
{
fastPaint = true;
else if (eventName.equals(ViewportRanges.MOVE_VIEWPORT))
{
fastPaint = false;
- // System.err.println("!!!! fastPaint false from MOVE_VIEWPORT");
+ // jalview.bin.Console.errPrintln("!!!! fastPaint false from MOVE_VIEWPORT");
repaint();
return;
}
} catch (OutOfMemoryError er)
{
System.gc();
- System.err.println("SeqCanvas OutOfMemory Redraw Error.\n" + er);
+ jalview.bin.Console.errPrintln("SeqCanvas OutOfMemory Redraw Error.\n" + er);
new OOMWarning("Creating alignment image for display", er);
return;
MousePos o = (MousePos) obj;
boolean b = (column == o.column && seqIndex == o.seqIndex
&& annotationIndex == o.annotationIndex);
- // System.out.println(obj + (b ? "= " : "!= ") + this);
+ // jalview.bin.Console.outPrintln(obj + (b ? "= " : "!= ") + this);
return b;
}
if (lastMessage == null || !lastMessage.equals(tmp))
{
- // System.err.println("mouseOver Sequence: "+tmp);
+ // jalview.bin.Console.errPrintln("mouseOver Sequence: "+tmp);
ssm.mouseOverSequence(sequence, index, pos, av);
}
lastMessage = tmp;
@Override
public void updateColours(SequenceI seq, int index)
{
- System.out.println("update the seqPanel colours");
+ jalview.bin.Console.outPrintln("update the seqPanel colours");
// repaint();
}
if (copycolsel && av.hasHiddenColumns()
&& (av.getAlignment().getHiddenColumns() == null))
{
- System.err.println("Bad things");
+ jalview.bin.Console.errPrintln("Bad things");
}
if (repaint) // always true!
{
+ ((StringPair) database.getSelectedItem()).getDisplay());
// error
// +="Couldn't retrieve sequences from "+database.getSelectedItem();
- System.err.println("Retrieval failed for source ='"
+ jalview.bin.Console.errPrintln("Retrieval failed for source ='"
+ ((StringPair) database.getSelectedItem()).getDisplay()
+ "' and query\n'" + textArea.getText() + "'\n");
e.printStackTrace();
}
if (mt.isErrorAny())
{
- System.err.println("Error when loading images!");
+ jalview.bin.Console.errPrintln("Error when loading images!");
}
} while (!mt.checkAll());
Desktop.instance.setIconImages(ChannelProperties.getIconList());
protected boolean refreshText()
{
String newtext = Desktop.instance.getAboutMessage();
- // System.err.println("Text found: \n"+newtext+"\nEnd of newtext.");
+ // jalview.bin.Console.errPrintln("Text found: \n"+newtext+"\nEnd of newtext.");
if (oldTextLength != newtext.length())
{
iframe.setVisible(false);
});
featureSettingsUI = new JInternalFrame(MessageManager.getString(
"label.sequence_feature_settings_for_CDS_and_Protein"));
+ featureSettingsUI.setFrameIcon(null);
featureSettingsPanels.setOpaque(true);
JPanel dialog = new JPanel();
import jalview.gui.structurechooser.StructureChooserQuerySource;
import jalview.gui.structurechooser.ThreeDBStructureChooserQuerySource;
import jalview.io.DataSourceType;
-import jalview.io.FileFormatException;
import jalview.io.JalviewFileChooser;
import jalview.io.JalviewFileView;
import jalview.jbgui.FilterOption;
import jalview.ws.DBRefFetcher;
import jalview.ws.DBRefFetcher.FetchFinishedListenerI;
import jalview.ws.datamodel.alphafold.PAEContactMatrix;
-import jalview.ws.dbsources.EBIAlfaFold;
import jalview.ws.seqfetcher.DbSourceProxy;
import jalview.ws.sifts.SiftsSettings;
// for moment, it will work fine as is because it is self-contained
String searchTerm = text.toLowerCase(Locale.ROOT);
searchTerm = searchTerm.split(":")[0];
- // System.out.println(">>>>> search term : " + searchTerm);
+ // jalview.bin.Console.outPrintln(">>>>> search term : " + searchTerm);
List<FTSDataColumnI> wantedFields = new ArrayList<>();
FTSRestRequest pdbRequest = new FTSRestRequest();
pdbRequest.setAllowEmptySeq(false);
sc.mainFrame.dispose();
if (showRefAnnotations)
+ {
showReferenceAnnotationsForSequence(ap.alignFrame, seq);
+ }
return sv;
}
package jalview.gui;
import java.util.ArrayList;
+import java.util.EnumSet;
import java.util.HashMap;
import java.util.LinkedHashMap;
import java.util.List;
+import java.util.Locale;
import java.util.Map;
import java.util.Map.Entry;
public enum ViewerType
{
- JMOL, CHIMERA, CHIMERAX, PYMOL
+ JMOL, CHIMERA, CHIMERAX, PYMOL;
+
+ public static ViewerType getFromString(String viewerString)
+ {
+ ViewerType viewerType = null;
+ if (!"none".equals(viewerString))
+ {
+ for (ViewerType v : EnumSet.allOf(ViewerType.class))
+ {
+ String name = v.name().toLowerCase(Locale.ROOT).replaceAll(" ",
+ "");
+ if (viewerString.equals(name))
+ {
+ viewerType = v;
+ break;
+ }
+ }
+ }
+ return viewerType;
+ }
+
};
/**
}
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error retrieving PDB id " + pdbid + ": " + e.getMessage());
} finally
{
import jalview.analysis.Conservation;
import jalview.analysis.TreeModel;
import jalview.api.AlignViewportI;
+import jalview.bin.Console;
import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.Annotation;
import jalview.datamodel.BinaryNode;
import jalview.gui.JalviewColourChooser.ColourChooserListener;
import jalview.schemes.ColourSchemeI;
import jalview.structure.SelectionSource;
+import jalview.util.ColorUtils;
import jalview.util.Format;
import jalview.util.MessageManager;
import jalview.ws.datamodel.MappableContactMatrixI;
boolean has_placeholders = false;
longestName = "";
+ AlignmentAnnotation aa = tp.getAssocAnnotation();
+ ContactMatrixI cm = (aa!=null) ? av.getContactMatrix(aa) : null;
+ if (cm!=null && cm.hasCutHeight())
+ {
+ threshold=(float) cm.getCutHeight();
+ }
+
for (int i = 0; i < leaves.size(); i++)
{
BinaryNode lf = leaves.elementAt(i);
longestName = TreeCanvas.PLACEHOLDER
+ ((Sequence) lf.element()).getName();
}
+ if (tp.isColumnWise() && cm!=null)
+ {
+ // get color from group colours, if they are set for the matrix
+ try {
+ Color col = cm.getGroupColorForPosition(parseColumnNode(lf));
+ setColor(lf,col.brighter());
+ } catch (NumberFormatException ex) {};
+ }
}
setMarkPlaceholders(has_placeholders);
* @param offy
* DOCUMENT ME!
*/
- public void drawNode(Graphics g, BinaryNode node, float chunk,
+ public void drawNode(Graphics g, BinaryNode node, double chunk,
double wscale, int width, int offx, int offy)
{
if (node == null)
+ ((BinaryNode) top.right()).count;
}
- float chunk = (float) (height - (offy)) / top.count;
+ double chunk = (double) (height - (offy)) / (double)top.count;
drawNode(g2, tree.getTopNode(), chunk, wscale, width, offx, offy);
threshold = 0f;
}
}
-
+ Console.log.debug("Tree cut threshold set at:" + threshold);
PaintRefresher.Refresh(tp,
getAssociatedPanel().av.getSequenceSetId());
repaint();
Map<BitSet, Color> colors = new HashMap();
for (int i = 0; i < groups.size(); i++)
{
- Color col = new Color((int) (Math.random() * 255),
- (int) (Math.random() * 255), (int) (Math.random() * 255));
+ Color col = ColorUtils.getARandomColor();
+
setColor(groups.get(i), col.brighter());
Vector<BinaryNode> l = tree.findLeaves(groups.get(i));
cm.setColorForGroup(gp, colors.get(gp));
}
}
- // stash colors in linked annotation row.
- // doesn't work yet. TESTS!
- int sstart = aa.sequenceRef != null ? aa.sequenceRef.getStart() - 1
- : 0;
- Annotation ae;
- Color gpcol = null;
- int[] seqpos = null;
- for (BitSet gp : colors.keySet())
- {
- gpcol = colors.get(gp);
- for (int p = gp.nextSetBit(0); p >= 0
- && p < Integer.MAX_VALUE; p = gp.nextSetBit(p + 1))
- {
- if (cm instanceof MappableContactMatrixI)
- {
- MappableContactMatrixI mcm = (MappableContactMatrixI) cm;
- seqpos = mcm.getMappedPositionsFor(aa.sequenceRef, p);
- if (seqpos == null)
- {
- // no mapping for this column.
- continue;
- }
- // TODO: handle ranges...
- ae = aa.getAnnotationForPosition(seqpos[0]);
- }
- else
- {
- ae = aa.getAnnotationForPosition(p + sstart);
- }
- if (ae != null)
- {
- ae.colour = gpcol.brighter().darker();
- }
- }
- }
+ cm.transferGroupColorsTo(aa);
}
}
}
}
}
-
+ private int parseColumnNode(BinaryNode bn) throws NumberFormatException
+ {
+ return Integer.parseInt(
+ bn.getName().substring(bn.getName().indexOf("c") + 1));
+ }
private boolean isColumnForNodeSelected(BinaryNode bn)
{
SequenceI rseq = tp.assocAnnotation.sequenceRef;
int colm = -1;
try
{
- colm = Integer.parseInt(
- bn.getName().substring(bn.getName().indexOf("c") + 1));
+ colm = parseColumnNode(bn);
} catch (Exception e)
{
return false;
// parse out from nodename
try
{
- colm = Integer.parseInt(
- bn.getName().substring(bn.getName().indexOf("c") + 1));
+ colm = parseColumnNode(bn);
} catch (Exception e)
{
continue;
if (mcm!=null)
{
int[] seqpos = mcm.getMappedPositionsFor(
- tp.assocAnnotation.sequenceRef, colm);
+ rseq, colm);
if (seqpos == null)
{
// no mapping for this column.
continue;
}
// TODO: handle ranges...
- offp = seqpos[0]-1;
+ offp = rseq.findIndex(seqpos[0])-1;
}
else
{
this.treeType = type;
this.scoreModelName = modelName;
+ treeCanvas = new TreeCanvas(this, ap, scrollPane);
+ scrollPane.setViewportView(treeCanvas);
+
if (columnWise)
{
bootstrapMenu.setVisible(false);
- placeholdersMenu.setSelected(false);
+ placeholdersMenu.setState(false);
placeholdersMenu.setVisible(false);
- fitToWindow.setSelected(false);
+ fitToWindow.setState(false);
sortAssocViews.setVisible(false);
}
- treeCanvas = new TreeCanvas(this, ap, scrollPane);
- scrollPane.setViewportView(treeCanvas);
addKeyListener(new KeyAdapter()
{
{
if (tree == null)
{
- System.out.println("tree is null");
+ jalview.bin.Console.outPrintln("tree is null");
// TODO: deal with case when a change event is received whilst a
// tree is still being calculated - should save reference for
// processing message later.
}
if (evt.getNewValue() == null)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"new alignment sequences vector value is null");
}
? new NJTree(av, sm, similarityParams)
: new AverageDistanceTree(av, sm, similarityParams);
tree = new TreeModel(njtree);
- showDistances(true);
+ // don't display distances for columnwise trees
}
-
+ showDistances(!columnWise);
tree.reCount(tree.getTopNode());
tree.findHeight(tree.getTopNode());
treeCanvas.setTree(tree);
pg.close();
} catch (Exception ex)
{
- System.err.println("Error writing tree as EPS");
+ jalview.bin.Console.errPrintln("Error writing tree as EPS");
ex.printStackTrace();
}
}
cdoc = null;
} catch (Exception ee)
{
- System.err.println("Exception whilst updating :");
+ jalview.bin.Console.errPrintln("Exception whilst updating :");
ee.printStackTrace(System.err);
// recover object map backup, since its probably corrupted with references
// to Vobjects that don't exist anymore.
// we only care about AlignmentSequence selections
SelectionMessage sm = (SelectionMessage) message;
sm.validate();
- System.err.println("Received\n" + sm.getRawMessage());
+ jalview.bin.Console.errPrintln("Received\n" + sm.getRawMessage());
Object[] jvobjs = sm.getVorbaIDs() == null ? null
: new Object[sm.getVorbaIDs().length];
if (jvobjs == null)
@Override
public void internalFrameClosed(InternalFrameEvent evt)
{
- // System.out.println("Shutting down webservice client");
+ // jalview.bin.Console.outPrintln("Shutting down webservice client");
WSClientI service = thisinfo.getthisService();
if (service != null && service.isCancellable())
{
else
{
// TODO: show warning
- System.err.println("Invalid name. Not saved.");
+ jalview.bin.Console.errPrintln("Invalid name. Not saved.");
}
}
}
else
{
- System.err.println("Ignoring unknown service argument type "
+ jalview.bin.Console.errPrintln("Ignoring unknown service argument type "
+ myarg.getClass().getName());
}
}
{
if (arg instanceof OptionI)
{
- // System.out.println("Setting option "
+ // jalview.bin.Console.outPrintln("Setting option "
// + System.identityHashCode(arg) + ":" + arg.getName()
// + " with " + arg.getDefaultValue());
opanp.selectOption((OptionI) arg, arg.getValue());
if (cw + 120 > panewidth)
{
jobOptions.add(pbox, "wrap");
- // System.out.println("Wrap on "+pbox.option.getName());
+ // jalview.bin.Console.outPrintln("Wrap on "+pbox.option.getName());
cw = hgap + pbox.getSize().width;
fh = true;
}
}
// TODO: waste some time trying to eliminate any unnecessary .validate calls
// here
- // System.out.println("Size will be : "+w+","+os);
+ // jalview.bin.Console.outPrintln("Size will be : "+w+","+os);
// optsAndparams.setPreferredSize(null);
// paramPane.getViewport().setView(optsAndparams);
paramPane.getViewport().setAutoscrolls(true);
disc.run();
} catch (Exception e)
{
- System.err.println("Aborting. Problem discovering services.");
+ jalview.bin.Console.errPrintln("Aborting. Problem discovering services.");
e.printStackTrace();
return;
}
pr = en.next();
}
{
- System.out.println("Testing opts dupes for "
+ jalview.bin.Console.outPrintln("Testing opts dupes for "
+ lastserv.getUri() + " : " + lastserv.getActionText()
+ ":" + pr.getName());
List<Option> rg = lastserv.getRunnerConfig().getOptions();
Option cpy = jalview.ws.jws2.ParameterUtils.copyOption(o);
} catch (Exception e)
{
- System.err.println("Failed to copy " + o.getName());
+ jalview.bin.Console.errPrintln("Failed to copy " + o.getName());
e.printStackTrace();
} catch (Error e)
{
- System.err.println("Failed to copy " + o.getName());
+ jalview.bin.Console.errPrintln("Failed to copy " + o.getName());
e.printStackTrace();
}
}
}
{
- System.out.println("Testing param dupes:");
+ jalview.bin.Console.outPrintln("Testing param dupes:");
List<Parameter> rg = lastserv.getRunnerConfig()
.getParameters();
for (Parameter o : rg)
.copyParameter(o);
} catch (Exception e)
{
- System.err.println("Failed to copy " + o.getName());
+ jalview.bin.Console.errPrintln("Failed to copy " + o.getName());
e.printStackTrace();
} catch (Error e)
{
- System.err.println("Failed to copy " + o.getName());
+ jalview.bin.Console.errPrintln("Failed to copy " + o.getName());
e.printStackTrace();
}
}
}
{
- System.out.println("Testing param write:");
+ jalview.bin.Console.outPrintln("Testing param write:");
List<String> writeparam = null, readparam = null;
try
{
.writeParameterSet(
pr.getArguments(lastserv.getRunnerConfig()),
" ");
- System.out.println("Testing param read :");
+ jalview.bin.Console.outPrintln("Testing param read :");
List<Option> pset = jalview.ws.jws2.ParameterUtils
.processParameters(writeparam,
lastserv.getRunnerConfig(), " ");
String on = o.next(), sn = s.next(), st = t.next();
if (!sn.equals(st))
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Original was " + on + " Phase 1 wrote " + sn
+ "\tPhase 2 wrote " + st);
failed = true;
}
if (failed)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Original parameters:\n" + pr.getOptions());
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Wrote parameters in first set:\n" + writeparam);
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Wrote parameters in second set:\n" + readparam);
}
* + storeSetName + ": ", jobParams); }
*
* private void writeParam(String nm, List<ArgumentI> params) { for (ArgumentI
- * p : params) { System.out.println(nm + ":" + System.identityHashCode(p) +
+ * p : params) { jalview.bin.Console.outPrintln(nm + ":" + System.identityHashCode(p) +
* " Name: " + p.getName() + " Value: " + p.getDefaultValue()); } }
*
* private Object[] _getUserPreset(String setName) { Object[] pset =
return;
}
settingDialog = true;
- System.out.println("Prompting to save " + lsetname);
+ jalview.bin.Console.outPrintln("Prompting to save " + lsetname);
if (JvOptionPane.showConfirmDialog(this, "Parameter set '" + lsetname
+ "' is modifed, and your changes will be lost.\nReally change preset ?",
"Warning: Unsaved Changes",
settingDialog = false;
// and leave.
return;
- // System.out.println("Saving for " + lsetname);
+ // jalview.bin.Console.outPrintln("Saving for " + lsetname);
// _storeCurrentPreset(lsetname);
}
return;
}
curSetName = newname;
- System.err.println("New name for user setting " + curSetName
+ jalview.bin.Console.errPrintln("New name for user setting " + curSetName
+ " (was " + setName.getSelectedItem() + ")");
if (curSetName.equals(setName.getSelectedItem()))
{
String[] names = seqName.toLowerCase(Locale.ROOT).split("\\|");
for (String name : names)
{
- // System.out.println("Found name : " + name);
+ // jalview.bin.Console.outPrintln("Found name : " + name);
name.trim();
if (isValidSeqName(name))
{
*/
static boolean isValidSeqName(String seqName)
{
- // System.out.println("seqName : " + seqName);
+ // jalview.bin.Console.outPrintln("seqName : " + seqName);
String ignoreList = "pdb,uniprot,swiss-prot";
if (seqName.length() < 3)
{
*/
static boolean isValidSeqName(String seqName)
{
- // System.out.println("seqName : " + seqName);
+ // jalview.bin.Console.outPrintln("seqName : " + seqName);
String ignoreList = "pdb,uniprot,swiss-prot";
if (seqName.length() < 3)
{
int idx = EXP_CATEGORIES.indexOf(upper_cat);
if (idx == -1)
{
- System.out.println("Unknown category: '" + cat + "'");
+ jalview.bin.Console.outPrintln("Unknown category: '" + cat + "'");
EXP_CATEGORIES.add(upper_cat);
idx = EXP_CATEGORIES.size() - 1;
}
{
if (!hasPdbResp)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Warning: seems like we couldn't get to the PDBe search interface.");
}
else
/*
* Set server error status on response
*/
- System.err.println("Exception handling request "
+ jalview.bin.Console.errPrintln("Exception handling request "
+ request.getRequestURI() + " : " + t.getMessage());
if (response.isCommitted())
{
/*
* Can't write an HTTP header once any response content has been written
*/
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unable to return HTTP 500 as response already committed");
}
else
*/
protected void dumpRequest(HttpServletRequest request)
{
- System.out.println(request.getMethod());
- System.out.println(request.getRequestURL());
+ jalview.bin.Console.outPrintln(request.getMethod());
+ jalview.bin.Console.outPrintln(request.getRequestURL());
for (String hdr : Collections.list(request.getHeaderNames()))
{
for (String val : Collections.list(request.getHeaders(hdr)))
{
- System.out.println(hdr + ": " + val);
+ jalview.bin.Console.outPrintln(hdr + ": " + val);
}
}
for (String param : Collections.list(request.getParameterNames()))
{
for (String val : request.getParameterValues(param))
{
- System.out.println(param + "=" + val);
+ jalview.bin.Console.outPrintln(param + "=" + val);
}
}
}
stop();
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error stopping " + getName() + ": " + e.getMessage());
}
}
contextHandlers = new HandlerCollection(true);
server.setHandler(contextHandlers);
server.start();
- // System.out.println(String.format(
+ // jalview.bin.Console.outPrintln(String.format(
// "HttpServer started with %d threads", server.getThreadPool()
// .getThreads()));
contextRoot = server.getURI();
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error trying to start HttpServer: " + e.getMessage());
try
{
{
for (String val : Collections.list(request.getHeaders(hdr)))
{
- System.out.println(hdr + ": " + val);
+ jalview.bin.Console.outPrintln(hdr + ": " + val);
}
}
for (String param : Collections.list(request.getParameterNames()))
{
for (String val : request.getParameterValues(param))
{
- System.out.println(param + "=" + val);
+ jalview.bin.Console.outPrintln(param + "=" + val);
}
}
}
server.stop();
} catch (Exception e)
{
- System.err.println("Error stopping Http Server on "
+ jalview.bin.Console.errPrintln("Error stopping Http Server on "
+ server.getURI() + ": " + e.getMessage());
}
}
ch.start();
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error starting handler for " + path + ": " + e.getMessage());
}
handler.setUri(this.contextRoot + ch.getContextPath().substring(1));
- System.out.println("Jalview " + handler.getName()
+ jalview.bin.Console.outPrintln("Jalview " + handler.getName()
+ " handler started on " + handler.getUri());
}
{
contextHandlers.removeHandler(ch);
myHandlers.remove(handler);
- System.out.println("Stopped Jalview " + handler.getName()
+ jalview.bin.Console.outPrintln("Stopped Jalview " + handler.getName()
+ " handler on " + handler.getUri());
}
}
}
else
{
- // System.err.println("Skipping NaN - not valid value.");
+ // jalview.bin.Console.errPrintln("Skipping NaN - not valid value.");
text.append(comma + 0f);// row.annotations[j].value);
}
comma = ",";
} catch (Exception ex)
{
ex.printStackTrace();
- System.out.println("Problem reading annotation file: " + ex);
+ jalview.bin.Console.outPrintln("Problem reading annotation file: " + ex);
if (nlinesread > 0)
{
- System.out.println("Last read line " + nlinesread + ": '" + lastread
+ jalview.bin.Console.outPrintln("Last read line " + nlinesread + ": '" + lastread
+ "' (first 80 chars) ...");
}
return false;
if (refSeqIndex < 1)
{
refSeqIndex = 1;
- System.out.println(
+ jalview.bin.Console.outPrintln(
"WARNING: SEQUENCE_REF index must be > 0 in AnnotationFile");
}
} catch (Exception ex)
{
if (hidden == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Cannot process HIDE_INSERTIONS without an alignment view: Ignoring line: "
+ line);
}
{
// TODO: specify and implement duplication of alignment annotation
// for multiple group references.
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Ignoring 1:many group reference mappings for group name '"
+ groupRef + "'");
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't combine annotations. None are added to alignment yet!");
}
}
value = Float.valueOf(nextToken);
} catch (NumberFormatException e)
{
- System.err.println("line " + nlinesread + ": Threshold '" + nextToken
+ jalview.bin.Console.errPrintln("line " + nlinesread + ": Threshold '" + nextToken
+ "' invalid, setting to zero");
}
String label = st.hasMoreTokens() ? st.nextToken() : null;
}
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't parse Group Start or End Field as '*' or a valid column or sequence index: '"
+ rng + "' - assuming alignment width for group.");
// assume group is full width
} catch (Exception e)
{
e.printStackTrace();
- System.err.println("Failed to read alignment using the '" + fileFormat
+ jalview.bin.Console.errPrintln("Failed to read alignment using the '" + fileFormat
+ "' reader.\n" + e);
if (e.getMessage() != null
} catch (Exception e)
{
e.printStackTrace();
- System.err.println("Failed to read alignment using the '" + format
+ jalview.bin.Console.errPrintln("Failed to read alignment using the '" + format
+ "' reader.\n" + e);
if (e.getMessage() != null
String afileresp = afile.print(seqs, jvsuffix);
if (afile.hasWarningMessage())
{
- System.err.println("Warning raised when writing as " + format
+ jalview.bin.Console.errPrintln("Warning raised when writing as " + format
+ " : " + afile.getWarningMessage());
}
return afileresp;
} catch (Exception e)
{
- System.err.println("Failed to write alignment as a '"
+ jalview.bin.Console.errPrintln("Failed to write alignment as a '"
+ format.getName() + "' file\n");
e.printStackTrace();
}
{
try
{
- System.out.println("Reading file: " + f);
+ jalview.bin.Console.outPrintln("Reading file: " + f);
AppletFormatAdapter afa = new AppletFormatAdapter();
Runtime r = Runtime.getRuntime();
System.gc();
memf += r.totalMemory() - r.freeMemory();
if (al != null)
{
- System.out.println("Alignment contains " + al.getHeight()
+ jalview.bin.Console.outPrintln("Alignment contains " + al.getHeight()
+ " sequences and " + al.getWidth() + " columns.");
try
{
- System.out.println(new AppletFormatAdapter()
+ jalview.bin.Console.outPrintln(new AppletFormatAdapter()
.formatSequences(FileFormat.Fasta, al, true));
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couln't format the alignment for output as a FASTA file.");
e.printStackTrace(System.err);
}
}
else
{
- System.out.println("Couldn't read alignment");
+ jalview.bin.Console.outPrintln("Couldn't read alignment");
}
- System.out.println("Read took " + (t1 / 1000.0) + " seconds.");
- System.out.println(
+ jalview.bin.Console.outPrintln("Read took " + (t1 / 1000.0) + " seconds.");
+ jalview.bin.Console.outPrintln(
"Difference between free memory now and before is "
+ (memf / (1024.0 * 1024.0) * 1.0) + " MB");
} catch (Exception e)
{
- System.err.println("Exception when dealing with " + i
+ jalview.bin.Console.errPrintln("Exception when dealing with " + i
+ "'th argument: " + args[i] + "\n" + e);
}
}
else
{
- System.err.println("Ignoring argument '" + args[i] + "' (" + i
+ jalview.bin.Console.errPrintln("Ignoring argument '" + args[i] + "' (" + i
+ "'th)- not a readable file.");
}
i++;
DataSourceType protocol = null;
if (debug)
{
- System.out.println("resolving datasource started with:\n>>file\n"
+ jalview.bin.Console.outPrintln("resolving datasource started with:\n>>file\n"
+ file + ">>endfile");
}
}
if (debug)
{
- System.err.println("Resource '" + file + "' was "
+ jalview.bin.Console.errPrintln("Resource '" + file + "' was "
+ (rtn ? "" : "not") + " located by classloader.");
}
if (rtn)
{
if (debug)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Trying to get contents of resource as " + protocol + ":");
}
fp = new FileParse(file, protocol);
{
if (debug)
{
- System.out.println("Successful.");
+ jalview.bin.Console.outPrintln("Successful.");
}
}
} catch (Exception e)
{
if (debug)
{
- System.err.println("Exception when accessing content: " + e);
+ jalview.bin.Console.errPrintln("Exception when accessing content: " + e);
}
fp = null;
}
{
if (debug)
{
- System.out.println("Accessing as paste.");
+ jalview.bin.Console.outPrintln("Accessing as paste.");
}
protocol = DataSourceType.PASTE;
fp = null;
}
} catch (Exception e)
{
- System.err.println("Failed to access content as paste!");
+ jalview.bin.Console.errPrintln("Failed to access content as paste!");
e.printStackTrace();
fp = null;
}
{
if (debug)
{
- System.out.println("Format not identified. Inaccessible file.");
+ jalview.bin.Console.outPrintln("Format not identified. Inaccessible file.");
}
return null;
}
if (debug)
{
- System.out.println("Format identified as " + idformat
+ jalview.bin.Console.outPrintln("Format identified as " + idformat
+ "and expected as " + format);
}
if (idformat.equals(format))
{
if (debug)
{
- System.out.println("Protocol identified as " + protocol);
+ jalview.bin.Console.outPrintln("Protocol identified as " + protocol);
}
return protocol;
}
{
if (debug)
{
- System.err.println("File deemed not accessible via " + protocol);
+ jalview.bin.Console.errPrintln("File deemed not accessible via " + protocol);
e.printStackTrace();
}
}
}
} catch (IOException e)
{
- System.out.println("IOException when checking file '" + filename
+ jalview.bin.Console.outPrintln("IOException when checking file '" + filename
+ "' is a backupfile");
}
{
if (!biojsDirectory.mkdirs())
{
- System.out.println("Couldn't create local directory : "
+ jalview.bin.Console.outPrintln("Couldn't create local directory : "
+ BJS_TEMPLATES_LOCAL_DIRECTORY);
return;
}
} catch (OutOfMemoryError err)
{
- System.out.println("########################\n" + "OUT OF MEMORY "
+ jalview.bin.Console.outPrintln("########################\n" + "OUT OF MEMORY "
+ generatedFile + "\n" + "########################");
new OOMWarning("Creating Image for " + generatedFile, err);
} catch (Exception e)
}
} catch (IOException e)
{
- System.err.println("Exception parsing clustal file " + e);
+ jalview.bin.Console.errPrintln("Exception parsing clustal file " + e);
e.printStackTrace();
}
}
else
{
- System.err.println("Clustal File Reader: Can't find sequence for "
+ jalview.bin.Console.errPrintln("Clustal File Reader: Can't find sequence for "
+ headers.elementAt(i));
}
}
// should report somewhere useful for UI if necessary
warningMessage = ((warningMessage == null) ? "" : warningMessage)
+ "Parsing error at\n" + line;
- System.out.println("Error parsing feature file: " + ex + "\n" + line);
+ jalview.bin.Console.outPrintln("Error parsing feature file: " + ex + "\n" + line);
ex.printStackTrace(System.err);
resetMatcher();
return false;
String[] tokens = line.split(TAB_REGEX);
if (tokens.length != 2)
{
- System.err.println(String.format("Invalid token count %d for %d",
+ jalview.bin.Console.errPrintln(String.format("Invalid token count %d for %d",
tokens.length, line));
}
else
*/
if (gffColumns.length < 6)
{
- System.err.println("Ignoring feature line '" + line
+ jalview.bin.Console.errPrintln("Ignoring feature line '" + line
+ "' with too few columns (" + gffColumns.length + ")");
return false;
}
seq = alignment.getSequenceAt(idx);
} catch (NumberFormatException ex)
{
- System.err.println("Invalid sequence index: " + seqIndex);
+ jalview.bin.Console.errPrintln("Invalid sequence index: " + seqIndex);
}
}
if (seq == null)
{
- System.out.println("Sequence not found: " + line);
+ jalview.bin.Console.outPrintln("Sequence not found: " + line);
return false;
}
@Override
public String print(SequenceI[] sqs, boolean jvsuffix)
{
- System.out.println("Use printGffFormat() or printJalviewFormat()");
+ jalview.bin.Console.outPrintln("Use printGffFormat() or printJalviewFormat()");
return null;
}
*/
if (gffColumns.length < 5)
{
- System.err.println("Ignoring GFF feature line with too few columns ("
+ jalview.bin.Console.errPrintln("Ignoring GFF feature line with too few columns ("
+ gffColumns.length + ")");
return null;
}
}
} catch (IOException e)
{
- System.err.println("GFF parsing failed with: " + e.getMessage());
+ jalview.bin.Console.errPrintln("GFF parsing failed with: " + e.getMessage());
return null;
}
}
}
else
{
- System.err.println("Ignoring unknown pragma: " + line);
+ jalview.bin.Console.errPrintln("Ignoring unknown pragma: " + line);
}
}
}
String name = format.getName().toUpperCase(Locale.ROOT);
if (formats.containsKey(name))
{
- System.err.println("Overwriting file format: " + format.getName());
+ jalview.bin.Console.errPrintln("Overwriting file format: " + format.getName());
}
formats.put(name, format);
if (isIdentifiable)
private File selectedFile;
+ private static boolean useDefaultFileFormat = false;
+
/**
* default constructor always raised errors in GUI dialog boxes
*/
if (format == null)
{
Desktop.instance.stopLoading();
- System.err.println("The input file \"" + file
+ jalview.bin.Console.errPrintln("The input file \"" + file
+ "\" has null or unidentifiable data content!");
if (!Jalview.isHeadlessMode())
{
if (source != null)
{
// Tell the user (developer?) that this is going to cause a problem
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION ERROR: Cannot read consecutive Jalview XML projects from a stream.");
// We read the data anyway - it might make sense.
}
}
else
{
- System.err.println(errorMessage);
+ jalview.bin.Console.errPrintln(errorMessage);
}
}
}
} catch (Exception er)
{
- System.err.println("Exception whilst opening file '" + file);
+ jalview.bin.Console.errPrintln("Exception whilst opening file '" + file);
er.printStackTrace();
if (raiseGUI)
{
}
});
}
- System.err.println("Out of memory loading file " + file + "!!");
+ jalview.bin.Console.errPrintln("Out of memory loading file " + file + "!!");
}
loadtime += System.currentTimeMillis();
{
AlignmentI al = alignFrame.getViewport().getAlignment();
- System.out.println("Loaded '" + title + "' in "
+ jalview.bin.Console.outPrintln("Loaded '" + title + "' in "
+ (loadtime / 1000.0) + "s, took an additional "
+ (1.0 * memused / (1024.0 * 1024.0)) + " MB ("
+ al.getHeight() + " seqs by " + al.getWidth() + " cols)");
{
// report that we didn't load anything probably due to an out of memory
// error
- System.out.println("Failed to load '" + title + "' in "
+ jalview.bin.Console.outPrintln("Failed to load '" + title + "' in "
+ (loadtime / 1000.0) + "s, took an additional "
+ (1.0 * memused / (1024.0 * 1024.0))
+ " MB (alignment is null)");
}
this.setShouldBeSaved();
+ // after first file loaded we revert to assuming a default file format
+ useDefaultFileFormat = true;
}
/**
QuitHandler.Message.UNSAVED_ALIGNMENTS);
}
+ public static boolean getUseDefaultFileFormat()
+ {
+ return useDefaultFileFormat;
+ }
+
}
if (sfpos > -1 && sfpos < fileStr.length() - 1)
{
suffix = fileStr.substring(sfpos + 1);
- // System.err.println("DEBUG: Found Suffix:"+suffix);
+ // jalview.bin.Console.errPrintln("DEBUG: Found Suffix:"+suffix);
return fileStr.substring(0, sfpos);
}
return null;
{
if (bytesRead >= READAHEAD_LIMIT)
{
- System.err.println(String.format(
+ jalview.bin.Console.errPrintln(String.format(
"File reset error: read %d bytes but reset limit is %d",
bytesRead, READAHEAD_LIMIT));
}
}
else
{
- System.out.println(message);
+ jalview.bin.Console.outPrintln(message);
}
}
}
} catch (OutOfMemoryError err)
{
- System.out.println("########################\n" + "OUT OF MEMORY "
+ jalview.bin.Console.outPrintln("########################\n" + "OUT OF MEMORY "
+ generatedFile + "\n" + "########################");
new OOMWarning("Creating Image for " + generatedFile, err);
} catch (Exception e)
@Override
public void parse() throws IOException
{
- // JBPNote log.System.out.println("all read in ");
+ // JBPNote log.jalview.bin.Console.outPrintln("all read in ");
String line;
QuerySeqPosition = -1;
noSeqs = 0;
}
else if (id.equals("jnetconf"))
{
- // log.debug System.out.println("here");
+ // log.debug jalview.bin.Console.outPrintln("here");
id = "Prediction Confidence";
this.conf = new Vector(numSymbols);
for (int i = 0; i < jpred.seqs.size(); i++)
{
- System.out.println(((Sequence) jpred.seqs.elementAt(i)).getName()
+ jalview.bin.Console.outPrintln(((Sequence) jpred.seqs.elementAt(i)).getName()
+ "\n"
+ ((Sequence) jpred.seqs.elementAt(i)).getSequenceAsString()
+ "\n");
}
} catch (java.io.IOException e)
{
- System.err.println("Exception " + e);
+ jalview.bin.Console.errPrintln("Exception " + e);
// e.printStackTrace(); not java 1.1 compatible!
}
}
* out = BLCFile.print(s);
*
* AlignFrame af = new AlignFrame(null, s); af.resize(700, 500); af.show();
- * System.out.println(out); } catch (java.io.IOException e) {
- * System.out.println("Exception " + e); } } }
+ * jalview.bin.Console.outPrintln(out); } catch (java.io.IOException e) {
+ * jalview.bin.Console.outPrintln("Exception " + e); } } }
*/
.setSecondaryStructure(annotation.secondaryStructure);
String displayChar = annotation.displayCharacter == null ? null
: annotation.displayCharacter;
- // System.out.println("--------------------->[" + displayChar + "]");
+ // jalview.bin.Console.outPrintln("--------------------->[" + displayChar + "]");
annotationPojo.setDisplayCharacter(displayChar);
if (annotation.colour != null)
{
import java.util.Vector;
import javax.swing.BoxLayout;
-import javax.swing.DefaultListCellRenderer;
import javax.swing.JCheckBox;
import javax.swing.JDialog;
import javax.swing.JFileChooser;
+import javax.swing.JLabel;
import javax.swing.JList;
import javax.swing.JOptionPane;
import javax.swing.JPanel;
import javax.swing.JScrollPane;
+import javax.swing.ListCellRenderer;
import javax.swing.SpringLayout;
+import javax.swing.SwingConstants;
+import javax.swing.SwingUtilities;
+import javax.swing.border.TitledBorder;
import javax.swing.filechooser.FileFilter;
import javax.swing.plaf.basic.BasicFileChooserUI;
}
else
{
- System.err.println("JalviewFileChooser arguments mismatch: "
+ jalview.bin.Console.errPrintln("JalviewFileChooser arguments mismatch: "
+ extensions + ", " + descs);
}
}
// file filters to fix bug on Mac OSX
setAcceptAllFileFilterUsed(acceptAny);
+ // add a "All known alignment files" option
+ List<String> allExtensions = new ArrayList<>();
+ for (String[] format : formats)
+ {
+ String[] extensions = format[0].split(",");
+ for (String ext : extensions)
+ {
+ if (!allExtensions.contains(ext))
+ {
+ allExtensions.add(ext);
+ }
+ }
+ }
+ allExtensions.sort(null);
+ JalviewFileFilter alljvf = new JalviewFileFilter(
+ allExtensions.toArray(new String[] {}),
+ MessageManager.getString("label.all_known_alignment_files"));
+ alljvf.setExtensionListInDescription(false);
+ addChoosableFileFilter(alljvf);
+
+ if (selected == null)
+ {
+ chosen = alljvf;
+ }
+
for (String[] format : formats)
{
JalviewFileFilter jvf = new JalviewFileFilter(format[0], format[1]);
return FileFormats.getInstance().forName(format);
} catch (IllegalArgumentException e)
{
- System.err.println("Unexpected format: " + format);
+ jalview.bin.Console.errPrintln("Unexpected format: " + format);
}
}
return null;
}
} catch (Throwable x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected exception when trying to get filename.");
x.printStackTrace();
}
}
}
+ if (!file.isAbsolute() && file.exists())
+ {
+ file = file.getAbsoluteFile();
+ }
+
setSelectedFile(file);
}
}
}
list = new JList<>(recent);
-
- DefaultListCellRenderer dlcr = new DefaultListCellRenderer();
- dlcr.setHorizontalAlignment(DefaultListCellRenderer.RIGHT);
- list.setCellRenderer(dlcr);
+ list.setCellRenderer(new recentlyOpenedCellRenderer());
list.addMouseListener(new MouseAdapter()
{
}
});
- this.setBorder(new javax.swing.border.TitledBorder(
- MessageManager.getString("label.recently_opened")));
+ TitledBorder recentlyOpenedBorder = new TitledBorder(
+ MessageManager.getString("label.recently_opened"));
+ recentlyOpenedBorder.setTitleFont(
+ recentlyOpenedBorder.getTitleFont().deriveFont(10f));
+ this.setBorder(recentlyOpenedBorder);
final JScrollPane scroller = new JScrollPane(list);
layout.putConstraint(SpringLayout.NORTH, scroller, 5,
SpringLayout.NORTH, this);
- if (Platform.isAMacAndNotJS())
- {
- scroller.setPreferredSize(new Dimension(500, 100));
- }
- else
- {
- scroller.setPreferredSize(new Dimension(530, 200));
- }
-
+ // one size okay for all
+ scroller.setPreferredSize(new Dimension(280, 105));
this.add(scroller);
- javax.swing.SwingUtilities.invokeLater(new Runnable()
+ SwingUtilities.invokeLater(new Runnable()
{
@Override
public void run()
}
+ class recentlyOpenedCellRenderer extends JLabel
+ implements ListCellRenderer<String>
+ {
+ private final static int maxChars = 46;
+
+ private final static String ellipsis = "...";
+
+ @Override
+ public Component getListCellRendererComponent(
+ JList<? extends String> list, String value, int index,
+ boolean isSelected, boolean cellHasFocus)
+ {
+ String filename = value.toString();
+ String displayFilename;
+ if (filename.length() > maxChars)
+ {
+ StringBuilder displayFileSB = new StringBuilder();
+ File file = new File(filename);
+ displayFileSB.append(file.getName());
+ if (file.getParent() != null)
+ {
+ File parent = file;
+ boolean spaceleft = true;
+ while (spaceleft && parent.getParent() != null)
+ {
+ parent = parent.getParentFile();
+ String name = parent.getName();
+ displayFileSB.insert(0, File.separator);
+ if (displayFileSB.length() + name.length() < maxChars - 1)
+ {
+ displayFileSB.insert(0, name);
+ }
+ else
+ {
+ displayFileSB.insert(0, ellipsis);
+ spaceleft = false;
+ }
+ }
+ if (spaceleft && filename.startsWith(File.separator)
+ && !(displayFileSB.charAt(0) == File.separatorChar))
+ {
+ displayFileSB.insert(0, File.separator);
+ }
+ }
+ displayFilename = displayFileSB.toString();
+ }
+ else
+ {
+ displayFilename = filename;
+ }
+ this.setText(displayFilename.toString());
+ this.setToolTipText(filename);
+ if (isSelected)
+ {
+ setBackground(list.getSelectionBackground());
+ setForeground(list.getSelectionForeground());
+ }
+ else
+ {
+ setBackground(list.getBackground());
+ setForeground(list.getForeground());
+ }
+ this.setHorizontalAlignment(SwingConstants.TRAILING);
+ this.setEnabled(list.isEnabled());
+ this.setFont(list.getFont().deriveFont(12f));
+ this.setOpaque(true);
+ return this;
+ }
+
+ }
+
/*
@Override
public JalviewFileChooser setResponseHandler(Object response,
*/
package jalview.io;
-import java.util.Locale;
-
import java.io.File;
import java.util.Hashtable;
import java.util.Iterator;
import java.util.LinkedHashMap;
+import java.util.Locale;
import java.util.Map;
import java.util.StringTokenizer;
while (extensions.hasNext())
{
- fullDescription += (", " + extensions.next());
+ fullDescription += (", ." + extensions.next());
}
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"JalviewFileView.createImageIcon: Couldn't find file: "
+ filePath);
}
}
} catch (IOException e)
{
- System.err.println("Exception parsing MSFFile " + e);
+ jalview.bin.Console.errPrintln("Exception parsing MSFFile " + e);
e.printStackTrace();
}
}
else
{
- System.err.println("MSFFile Parser: Can't find sequence for "
+ jalview.bin.Console.errPrintln("MSFFile Parser: Can't find sequence for "
+ headers.get(i));
}
}
}
} catch (Exception e)
{
- System.err.println("Exception during MSF Checksum calculation");
+ jalview.bin.Console.errPrintln("Exception during MSF Checksum calculation");
e.printStackTrace();
}
}
// node string contains Comment or structured/extended NH format info
/*
* if ((fcp-cp>1 && nf.substring(cp,fcp).trim().length()>1)) { // will
- * process in remains System.err.println("skipped text:
+ * process in remains jalview.bin.Console.errPrintln("skipped text:
* '"+nf.substring(cp,fcp)+"'"); }
*/
// verify termination.
// more codes here.
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't parse code '" + code + "' = '" + value + "'");
e.printStackTrace(System.err);
}
}
treefile.close();
- System.out.println("Read file :\n");
+ jalview.bin.Console.outPrintln("Read file :\n");
NewickFile trf = new NewickFile(args[0], DataSourceType.FILE);
trf.parse();
- System.out.println("Original file :\n");
+ jalview.bin.Console.outPrintln("Original file :\n");
Regex nonl = new Regex("\n+", "");
- System.out.println(nonl.replaceAll(newickfile.toString()) + "\n");
-
- System.out.println("Parsed file.\n");
- System.out.println("Default output type for original input.\n");
- System.out.println(trf.print());
- System.out.println("Without bootstraps.\n");
- System.out.println(trf.print(false));
- System.out.println("Without distances.\n");
- System.out.println(trf.print(true, false));
- System.out.println("Without bootstraps but with distanecs.\n");
- System.out.println(trf.print(false, true));
- System.out.println("Without bootstraps or distanecs.\n");
- System.out.println(trf.print(false, false));
- System.out.println("With bootstraps and with distances.\n");
- System.out.println(trf.print(true, true));
+ jalview.bin.Console.outPrintln(nonl.replaceAll(newickfile.toString()) + "\n");
+
+ jalview.bin.Console.outPrintln("Parsed file.\n");
+ jalview.bin.Console.outPrintln("Default output type for original input.\n");
+ jalview.bin.Console.outPrintln(trf.print());
+ jalview.bin.Console.outPrintln("Without bootstraps.\n");
+ jalview.bin.Console.outPrintln(trf.print(false));
+ jalview.bin.Console.outPrintln("Without distances.\n");
+ jalview.bin.Console.outPrintln(trf.print(true, false));
+ jalview.bin.Console.outPrintln("Without bootstraps but with distanecs.\n");
+ jalview.bin.Console.outPrintln(trf.print(false, true));
+ jalview.bin.Console.outPrintln("Without bootstraps or distanecs.\n");
+ jalview.bin.Console.outPrintln(trf.print(false, false));
+ jalview.bin.Console.outPrintln("With bootstraps and with distances.\n");
+ jalview.bin.Console.outPrintln(trf.print(true, true));
} catch (java.io.IOException e)
{
- System.err.println("Exception\n" + e);
+ jalview.bin.Console.errPrintln("Exception\n" + e);
e.printStackTrace();
}
}
{
if (line.length() == 0)
{
- // System.out.println("blank line");
+ // jalview.bin.Console.outPrintln("blank line");
continue;
}
if (line.indexOf("C;") == 0 || line.indexOf("#") == 0)
}
else
{
- System.err.println("PFAM File reader: Can't find sequence for "
+ jalview.bin.Console.errPrintln("PFAM File reader: Can't find sequence for "
+ headers.get(i));
}
}
} catch (IOException e)
{
- System.err.println("Exception parsing PHYLIP file " + e);
+ jalview.bin.Console.errPrintln("Exception parsing PHYLIP file " + e);
e.printStackTrace(System.err);
throw e;
}
}
}
sqs[i] = new Sequence(id, seq, begin, end);
-
- sqs[i].setEnd(sqs[i].findPosition(sqs[i].getLength()));
+ if (seq.length()!=(end-begin+1))
+ {
+ sqs[i].setEnd(sqs[i].findPosition(sqs[i].getLength()));
+ }
String[] annot = new String[rna.length()];
Annotation[] ann = new Annotation[rna.length()];
// public static void main(String[] args) {
// Pattern p= Pattern.compile("(.+)[.][^.]+");
// Matcher m = p.matcher("toto.xml.zip");
- // System.out.println(m.matches());
- // System.out.println(m.group(1));
+ // jalview.bin.Console.outPrintln(m.matches());
+ // jalview.bin.Console.outPrintln(m.group(1));
// }
/**
* make a friendly ID string.
}
} catch (Exception x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"problem when creating links from " + urlstring);
x.printStackTrace();
}
UrlLink urlLink = new UrlLink(link);
if (!urlLink.isValid())
{
- System.err.println(urlLink.getInvalidMessage());
+ jalview.bin.Console.errPrintln(urlLink.getInvalidMessage());
return null;
}
rstart = Long.parseLong(stindx);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't parse '" + stindx + "' as start of row");
// inAlignments = false;
// warn for this line
rend = Long.parseLong(endindx);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't parse '" + endindx + "' as end of row");
// inAlignments = false;
+ umcp.getMessage() + ")";
throw new IOException(umcp);
}
- // DEBUG System.out.println("this is the secondary scructure:"
+ // DEBUG jalview.bin.Console.outPrintln("this is the secondary scructure:"
// +result.size());
SequenceI[] seqs = new SequenceI[result.size()];
String id = null;
for (int i = 0; i < result.size(); i++)
{
- // DEBUG System.err.println("Processing i'th sequence in Stockholm file")
+ // DEBUG jalview.bin.Console.errPrintln("Processing i'th sequence in Stockholm file")
RNA current = result.get(i);
String seq = current.getSeq();
String rna = current.getStructDBN(true);
- // DEBUG System.out.println(seq);
- // DEBUG System.err.println(rna);
+ // DEBUG jalview.bin.Console.outPrintln(seq);
+ // DEBUG jalview.bin.Console.errPrintln(rna);
int begin = 0;
int end = seq.length() - 1;
id = safeName(getDataName());
}
else if (!r.search(line))
{
- // System.err.println("Found sequence line: " + line);
+ // jalview.bin.Console.errPrintln("Found sequence line: " + line);
// Split sequence in sequence and accession parts
if (!x.search(line))
String annType = r.stringMatched(1);
String annContent = r.stringMatched(2);
- // System.err.println("type:" + annType + " content: " + annContent);
+ // jalview.bin.Console.errPrintln("type:" + annType + " content: " + annContent);
if (annType.equals("GF"))
{
else
{
// throw new IOException("Error parsing " + line);
- System.err.println(">> missing annotation: " + line);
+ jalview.bin.Console.errPrintln(">> missing annotation: " + line);
}
}
else if (annType.equals("GC"))
// }
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning - couldn't parse sequence annotation row line:\n"
+ line);
// throw new IOException("Error parsing " + line);
annot.annotations.length);
System.arraycopy(els, 0, anns, annot.annotations.length, els.length);
annot.annotations = anns;
- // System.out.println("else: ");
+ // jalview.bin.Console.outPrintln("else: ");
}
return annot;
}
{
return (String) typeIds.get(id);
}
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning : Unknown Stockholm annotation type code " + id);
return id;
}
{
return key;
}
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning : Unknown Stockholm annotation type: " + type);
return key;
}
protected void processPdbFileWithAnnotate3d(List<SequenceI> rna)
throws Exception
{
- // System.out.println("this is a PDB format and RNA sequence");
+ // jalview.bin.Console.outPrintln("this is a PDB format and RNA sequence");
// note: we use reflection here so that the applet can compile and run
// without the HTTPClient bits and pieces needed for accessing Annotate3D
// web service
processPdbFileWithAnnotate3d(rnaSequences);
} catch (Exception x)
{
- System.err.println("Exceptions when dealing with RNA in pdb file");
+ jalview.bin.Console.errPrintln("Exceptions when dealing with RNA in pdb file");
x.printStackTrace();
}
processWithJmolParser(proteinSequences, true);
} catch (Exception x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exceptions from Jmol when processing data in pdb file");
x.printStackTrace();
}
annotations[j] = null;
if (val > 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning: non-zero value for positional T-COFFEE score for gap at "
+ j + " in sequence " + s.getName());
}
{
// removeValignmentSequences(alignment, docseqs);
docseqs.removeAllElements();
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Sequence deletion from alignment is not implemented.");
}
}
if (alismod)
{
- System.out.println("update alignment in document.");
+ jalview.bin.Console.outPrintln("update alignment in document.");
}
else
{
- System.out.println("alignment in document left unchanged.");
+ jalview.bin.Console.outPrintln("alignment in document left unchanged.");
}
}
else
// unbind alignment from view.
// create new binding and new alignment.
// mark trail on new alignment as being derived from old ?
- System.out.println(
+ jalview.bin.Console.outPrintln(
"update edited alignment to new alignment in document.");
}
}
// METHODS)
{
// verify existing alignment sequence annotation is up to date
- System.out.println("update dataset sequence annotation.");
+ jalview.bin.Console.outPrintln("update dataset sequence annotation.");
}
else
{
// verify existing alignment sequence annotation is up to date
- System.out.println(
+ jalview.bin.Console.outPrintln(
"make new alignment dataset sequence annotation if modification has happened.");
}
}
// METHODS)
{
// verify existing alignment sequence annotation is up to date
- System.out.println("update alignment sequence annotation.");
+ jalview.bin.Console.outPrintln("update alignment sequence annotation.");
}
else
{
// verify existing alignment sequence annotation is up to date
- System.out.println(
+ jalview.bin.Console.outPrintln(
"make new alignment sequence annotation if modification has happened.");
}
}
for (int i = 0; i < ids.size(); i++)
{
Sequence sequence = (Sequence) ids.get(i);
- System.out.println(sequence.getName());
+ jalview.bin.Console.outPrintln(sequence.getName());
BlastThread thread = new BlastThread(sequence);
thread.start();
BlastThread(Sequence sequence)
{
- System.out.println("blasting for: " + sequence.getName());
+ jalview.bin.Console.outPrintln("blasting for: " + sequence.getName());
this.sequence = sequence;
}
else
{
Thread.sleep(10000);
- System.out.println("WSWuBlastClient: I'm alive "
+ jalview.bin.Console.outPrintln("WSWuBlastClient: I'm alive "
+ sequence.getName() + " " + jobid); // log.debug
}
} catch (Exception ex)
{
jobComplete = true;
jobsRunning--;
- System.err.println("WSWUBlastClient error:\n" + exp.toString());
+ jalview.bin.Console.errPrintln("WSWUBlastClient error:\n" + exp.toString());
exp.printStackTrace();
}
}
@Override
public void actionPerformed(ActionEvent e)
{
- // System.out.println(">>>>> Clear cache items");
+ // jalview.bin.Console.outPrintln(">>>>> Clear cache items");
setSelectedItem("");
appCache.deleteCacheItems(cacheKey);
updateCache();
relaxedIdMatching);
} catch (IOException ivfe)
{
- System.err.println(ivfe);
+ jalview.bin.Console.errPrintln(ivfe);
}
/*
}
else if (!"+".equals(strand))
{
- System.err.println("Strand must be specified for alignment");
+ jalview.bin.Console.errPrintln("Strand must be specified for alignment");
return;
}
String[] tokens = region.split(" ");
if (tokens.length != 3)
{
- System.err.println("Malformed Align descriptor: " + region);
+ jalview.bin.Console.errPrintln("Malformed Align descriptor: " + region);
return null;
}
alignCount = Integer.parseInt(tokens[2]);
} catch (NumberFormatException nfe)
{
- System.err.println(nfe.toString());
+ jalview.bin.Console.errPrintln(nfe.toString());
return null;
}
return true;
}
}
- System.err.println("Sorry, I don't handle exonerate model " + model);
+ jalview.bin.Console.errPrintln("Sorry, I don't handle exonerate model " + model);
return false;
}
*/
if ("-".equals(strand))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Skipping mapping from reverse complement as not yet supported");
return null;
}
List<String> targets = attributes.get(TARGET);
if (targets == null)
{
- System.err.println("'Target' missing in GFF");
+ jalview.bin.Console.errPrintln("'Target' missing in GFF");
return null;
}
String[] tokens = target.split(" ");
if (tokens.length < 3)
{
- System.err.println("Incomplete Target: " + target);
+ jalview.bin.Console.errPrintln("Incomplete Target: " + target);
continue;
}
}
} catch (NumberFormatException nfe)
{
- System.err.println("Invalid start or end in Target " + target);
+ jalview.bin.Console.errPrintln("Invalid start or end in Target " + target);
}
}
*/
if (!trimMapping(from, to, fromRatio, toRatio))
{
- System.err.println("Ignoring mapping from " + Arrays.toString(from)
+ jalview.bin.Console.errPrintln("Ignoring mapping from " + Arrays.toString(from)
+ " to " + Arrays.toString(to) + " as counts don't match!");
return null;
}
{
from[1] += fromOverlap / toRatio;
}
- System.err.println(Arrays.toString(from));
+ jalview.bin.Console.errPrintln(Arrays.toString(from));
return true;
}
else if (fromOverlap < 0 && fromOverlap % fromRatio == 0)
{
to[1] += fromOverlap / fromRatio;
}
- System.err.println(Arrays.toString(to));
+ jalview.bin.Console.errPrintln(Arrays.toString(to));
return true;
}
return sf;
} catch (NumberFormatException nfe)
{
- System.err.println("Invalid number in gff: " + nfe.getMessage());
+ jalview.bin.Console.errPrintln("Invalid number in gff: " + nfe.getMessage());
return null;
}
}
if (!valid)
{
- System.err.println(INVALID_GFF_ATTRIBUTE_FORMAT + s);
+ jalview.bin.Console.errPrintln(INVALID_GFF_ATTRIBUTE_FORMAT + s);
return map;
}
theKey = theKey.trim();
if (theKey.isEmpty())
{
- System.err.println(INVALID_GFF_ATTRIBUTE_FORMAT + s);
+ jalview.bin.Console.errPrintln(INVALID_GFF_ATTRIBUTE_FORMAT + s);
map.clear();
return map;
}
{
// suppress logging here as it reports Uniprot sequence features
// (which do not use SO terms) when auto-configuring feature colours
- // System.out.println("SO term " + term
+ // jalview.bin.Console.outPrintln("SO term " + term
// + " not known - add to model if needed in "
// + getClass().getName());
termsNotFound.add(term);
AlignmentSet last = getLastAlignmentSet();
if (last != null)
{
- System.err.println("Deuniquifying last alignment set.");
+ jalview.bin.Console.errPrintln("Deuniquifying last alignment set.");
last.deuniquifyAlignment();
}
al.add(new AlignmentSet(newal));
fp = new FileParse(file, AppletFormatAdapter.checkProtocol(file));
} catch (Exception e)
{
- System.err.println("Couldn't handle datasource of type " + jtype
+ jalview.bin.Console.errPrintln("Couldn't handle datasource of type " + jtype
+ " using URI " + file);
e.printStackTrace();
return;
}
else
{
- System.out.println("Couldn't parse source type token '"
+ jalview.bin.Console.outPrintln("Couldn't parse source type token '"
+ type.toUpperCase(Locale.ROOT) + "'");
}
}
System.out.print("\n");
}
- System.out.println("Now trying to parse set:");
+ jalview.bin.Console.outPrintln("Now trying to parse set:");
JalviewDataset context;
Object[] newdm;
ParsePackedSet pps;
.getAlignment(context = new JalviewDataset(), dp);
} catch (Exception e)
{
- System.out.println("Test failed for these arguments.\n");
+ jalview.bin.Console.outPrintln("Test failed for these arguments.\n");
e.printStackTrace(System.out);
return;
}
{
for (Object o : newdm)
{
- System.out.println("Will need to create an " + o.getClass());
+ jalview.bin.Console.outPrintln("Will need to create an " + o.getClass());
}
// now test uniquify/deuniquify stuff
{
if (context.getLastAlignmentSet().isModified())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Initial alignment set was modified and any associated views should be updated.");
}
}
private void conflict(Mapping mjvmapping, SequenceMapping sequenceMapping)
{
- System.err.println("Conflict in update of sequenceMapping "
+ jalview.bin.Console.errPrintln("Conflict in update of sequenceMapping "
+ sequenceMapping.getVorbaId());
}
}
else
{
- System.err.println("WARNING: Unassociated treeNode "
+ jalview.bin.Console.errPrintln("WARNING: Unassociated treeNode "
+ tnode.element().toString() + " "
+ ((tnode.getName() != null)
? " label " + tnode.getName()
occurence = Integer.valueOf(oval).intValue();
} catch (Exception e)
{
- System.err.println("Invalid nodespec '" + nodespec + "'");
+ jalview.bin.Console.errPrintln("Invalid nodespec '" + nodespec + "'");
return null;
}
jalview.datamodel.BinaryNode bn = null;
initialise(vcfFile);
} catch (IOException e)
{
- System.err.println("Error opening VCF file: " + e.getMessage());
+ jalview.bin.Console.errPrintln("Error opening VCF file: " + e.getMessage());
}
// map of species!chromosome!fromAssembly!toAssembly to {fromRange, toRange}
}
} catch (Throwable e)
{
- System.err.println("Error processing VCF: " + e.getMessage());
+ jalview.bin.Console.errPrintln("Error processing VCF: " + e.getMessage());
e.printStackTrace();
if (gui != null)
{
patterns.add(Pattern.compile(token.toUpperCase(Locale.ROOT)));
} catch (PatternSyntaxException e)
{
- System.err.println("Invalid pattern ignored: " + token);
+ jalview.bin.Console.errPrintln("Invalid pattern ignored: " + token);
}
}
return patterns;
{
if (jvlite.debug && dbgMsg != null)
{
- System.err.println(dbgMsg);
+ jalview.bin.Console.errPrintln(dbgMsg);
}
scriptObject.call(_listener, objects);
}
{
if (jvlite.debug)
{
- System.err.println(jex);
+ jalview.bin.Console.errPrintln(jex);
}
if (jex instanceof netscape.javascript.JSException
&& jvlite.jsfallbackEnabled)
jsex[0] = jex;
if (jvlite.debug)
{
- System.err.println("Falling back to javascript: url call");
+ jalview.bin.Console.errPrintln("Falling back to javascript: url call");
}
StringBuffer sb = new StringBuffer(
"javascript:" + _listener + "(");
sb.append(")");
if (jvlite.debug)
{
- System.err.println(sb.toString());
+ jalview.bin.Console.errPrintln(sb.toString());
}
// alternate
URL url = null;
public void selection(SequenceGroup seqsel, ColumnSelection colsel,
HiddenColumns hidden, SelectionSource source)
{
- // System.err.println("Testing selection event relay to
+ // jalview.bin.Console.errPrintln("Testing selection event relay to
// jsfunction:"+_listener);
try
{
;
}
- System.err.println("Relaying selection to jsfunction:" + _listener);
+ jalview.bin.Console.errPrintln("Relaying selection to jsfunction:" + _listener);
executeJavascriptFunction(_listener,
new Object[]
{ src, setid, jvlite.arrayToSeparatorList(seqs),
jvlite.arrayToSeparatorList(cols) });
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Jalview Javascript exec error: Couldn't send selection message using function '"
+ _listener + "'");
ex.printStackTrace();
if (ex instanceof netscape.javascript.JSException)
{
- System.err.println("Javascript Exception: "
+ jalview.bin.Console.errPrintln("Javascript Exception: "
+ ((netscape.javascript.JSException) ex).getCause()
.toString());
}
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"JalviewLite javascript error: Couldn't send mouseOver with handler '"
+ _listener + "'");
if (ex instanceof netscape.javascript.JSException)
{
- System.err.println("Javascript Exception: "
+ jalview.bin.Console.errPrintln("Javascript Exception: "
+ ((netscape.javascript.JSException) ex).getMessage());
}
ex.printStackTrace();
"" + (atom.getPdbResNum()), "" + atom.getAtomIndex() });
} catch (Exception ex)
{
- System.err.println("Couldn't execute callback with " + _listenerfn
+ jalview.bin.Console.errPrintln("Couldn't execute callback with " + _listenerfn
+ " for atomSpec: " + atom);
ex.printStackTrace();
}
if (JalviewLite.debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
this.getClass().getName() + " modelSet[0]: " + modelSet[0]);
ssm.reportMapping();
}
}
// if (jvlite.debug)
// {
- // System.err.println("Mapped '" + modelSet[m] + "' to "
+ // jalview.bin.Console.errPrintln("Mapped '" + modelSet[m] + "' to "
// + sequence[m].length + " sequences.");
// }
}
executeJavascriptFunction(true, _listenerfn, st);
} catch (Exception ex)
{
- System.err.println("Couldn't execute callback with " + _listenerfn
+ jalview.bin.Console.errPrintln("Couldn't execute callback with " + _listenerfn
+ " using args { " + st[0] + ", " + st[1] + ", " + st[2]
+ "," + st[3] + "}"); // + ","+st[4]+"\n");
ex.printStackTrace();
* executeJavascriptFunction( false, _listenerfn, st = new String[] {
* "colourstruct", "" + ((jalview.appletgui.AlignmentPanel) source).av
* .getViewId(), handle, "" }); } catch (Exception ex) {
- * System.err.println("Couldn't execute callback with " + _listenerfn +
+ * jalview.bin.Console.errPrintln("Couldn't execute callback with " + _listenerfn +
* " using args { " + st[0] + ", " + st[1] + ", " + st[2] + "," + st[3] +
* "\n"); ex.printStackTrace();
*
import jalview.gui.JvSwingUtils;
import jalview.gui.Preferences;
import jalview.io.FileFormats;
-import jalview.io.exceptions.ImageOutputException;
import jalview.schemes.ResidueColourScheme;
import jalview.util.MessageManager;
import jalview.util.Platform;
{
try
{
+ setFrameIcon(null);
// for Web-page embedding using id=align-frame-div
setName("jalview-alignment");
}
} catch (Exception e)
{
- System.err.println(e.toString());
+ jalview.bin.Console.errPrintln(e.toString());
}
if (Platform.allowMnemonics()) // was "not mac and not JS"
protected void createPNG_actionPerformed(ActionEvent object)
{
// TODO Auto-generated method stub
-
+
}
protected void createEPS_actionPerformed(ActionEvent object)
{
// TODO Auto-generated method stub
-
+
}
protected void createSVG_actionPerformed(ActionEvent object)
{
// TODO Auto-generated method stub
-
+
}
protected void copyHighlightedColumns_actionPerformed(
{
}
-
protected void font_actionPerformed(ActionEvent e)
{
}
}
-
protected void loadTreeMenuItem_actionPerformed(ActionEvent e)
{
protected JPanel scalePanelHolder = newJPanel();
- protected JPanel idPanelHolder = newJPanel();
+ public JPanel idPanelHolder = newJPanel();
protected JPanel idSpaceFillerPanel1 = newJPanel();
APQHandlers.setAPQHandlers((Desktop) this);
} catch (Exception e)
{
- System.out.println("Cannot set APQHandlers");
+ jalview.bin.Console.outPrintln("Cannot set APQHandlers");
// e.printStackTrace();
} catch (Throwable t)
{
inputURLMenuItem_actionPerformed(null);
} catch (FileFormatException e1)
{
- System.err.println("Error loading from URL: " + e1.getMessage());
+ jalview.bin.Console.errPrintln("Error loading from URL: " + e1.getMessage());
}
}
});
*/
protected void quit()
{
- // System.out.println("********** GDesktop.quit()");
+ // jalview.bin.Console.outPrintln("********** GDesktop.quit()");
}
/**
mainFrame.pack();
} catch (Exception e)
{
- System.out.println(e); // for JavaScript TypeError
+ jalview.bin.Console.outPrintln(e); // for JavaScript TypeError
e.printStackTrace();
}
}
protected void closeAction(int preferredHeight)
{
- // System.out.println(">>>>>>>>>> closing internal frame!!!");
- // System.out.println("width : " + mainFrame.getWidth());
- // System.out.println("heigh : " + mainFrame.getHeight());
- // System.out.println("x : " + mainFrame.getX());
- // System.out.println("y : " + mainFrame.getY());
+ // jalview.bin.Console.outPrintln(">>>>>>>>>> closing internal frame!!!");
+ // jalview.bin.Console.outPrintln("width : " + mainFrame.getWidth());
+ // jalview.bin.Console.outPrintln("heigh : " + mainFrame.getHeight());
+ // jalview.bin.Console.outPrintln("x : " + mainFrame.getX());
+ // jalview.bin.Console.outPrintln("y : " + mainFrame.getY());
tempUserPrefs.put("structureChooser.width", pnl_filter.getWidth());
tempUserPrefs.put("structureChooser.height", preferredHeight);
tempUserPrefs.put("structureChooser.x", mainFrame.getX());
{
String logLine = String.format("%s: %s", loglevel.toString(),
message);
- System.out.println(logLine);
+ jalview.bin.Console.outPrintln(logLine);
if (t != null)
{
if (loglevel.compareTo(LogLevel.DEBUG) <= 0)
t.printStackTrace(System.err);
else
- System.err.println(t.getMessage());
+ jalview.bin.Console.errPrintln(t.getMessage());
}
return false;
}
}
else
{
- // System.out.println("Iteration " + iter);
+ // jalview.bin.Console.outPrintln("Iteration " + iter);
}
g = (d[l] - d[l - 1]) / (2.0 * e[l - 1]);
}
else
{
- // System.out.println("Iteration " + iter);
+ // jalview.bin.Console.outPrintln("Iteration " + iter);
}
g = (d[l] - d[l - 1]) / (2.0 * e[l - 1]);
Float floatValue = Float.valueOf(degrees);
if (cachedRotations.get(axis).containsKey(floatValue))
{
- // System.out.println("getRotation from cache: " + (int) degrees);
+ // jalview.bin.Console.outPrintln("getRotation from cache: " + (int) degrees);
return cachedRotations.get(axis).get(floatValue);
}
}
} catch (Exception x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION ERROR: Failed to resolve forward reference for sequence "
+ ref.getSref());
x.printStackTrace();
}
if (unresolved > 0)
{
- System.err.println("Jalview Project Import: There were " + unresolved
+ jalview.bin.Console.errPrintln("Jalview Project Import: There were " + unresolved
+ " forward references left unresolved on the stack.");
}
if (failedtoresolve > 0)
{
- System.err.println("SERIOUS! " + failedtoresolve
+ jalview.bin.Console.errPrintln("SERIOUS! " + failedtoresolve
+ " resolvable forward references failed to resolve.");
}
if (incompleteSeqs != null && incompleteSeqs.size() > 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Jalview Project Import: There are " + incompleteSeqs.size()
+ " sequences which may have incomplete metadata.");
if (incompleteSeqs.size() < 10)
{
for (SequenceI s : incompleteSeqs.values())
{
- System.err.println(s.toString());
+ jalview.bin.Console.errPrintln(s.toString());
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Too many to report. Skipping output of incomplete sequences.");
}
}
object.setCreationDate(now);
} catch (DatatypeConfigurationException e)
{
- System.err.println("error writing date: " + e.toString());
+ jalview.bin.Console.errPrintln("error writing date: " + e.toString());
}
object.setVersion(Cache.getDefault("VERSION", "Development Build"));
// HAPPEN! (PF00072.15.stk does this)
// JBPNote: Uncomment to debug writing out of files that do not read
// back in due to ArrayOutOfBoundExceptions.
- // System.err.println("vamsasSeq backref: "+id+"");
- // System.err.println(jds.getName()+"
+ // jalview.bin.Console.errPrintln("vamsasSeq backref: "+id+"");
+ // jalview.bin.Console.errPrintln(jds.getName()+"
// "+jds.getStart()+"-"+jds.getEnd()+" "+jds.getSequenceAsString());
- // System.err.println("Hashcode: "+seqHash(jds));
+ // jalview.bin.Console.errPrintln("Hashcode: "+seqHash(jds));
// SequenceI rsq = (SequenceI) seqRefIds.get(id + "");
- // System.err.println(rsq.getName()+"
+ // jalview.bin.Console.errPrintln(rsq.getName()+"
// "+rsq.getStart()+"-"+rsq.getEnd()+" "+rsq.getSequenceAsString());
- // System.err.println("Hashcode: "+seqHash(rsq));
+ // jalview.bin.Console.errPrintln("Hashcode: "+seqHash(rsq));
}
else
{
try
{
fileName = fileName.replace('\\', '/');
- System.out.println("Writing jar entry " + fileName);
+ jalview.bin.Console.outPrintln("Writing jar entry " + fileName);
JarEntry entry = new JarEntry(fileName);
jout.putNextEntry(entry);
PrintWriter pout = new PrintWriter(
} catch (Exception ex)
{
// TODO: raise error in GUI if marshalling failed.
- System.err.println("Error writing Jalview project");
+ jalview.bin.Console.errPrintln("Error writing Jalview project");
ex.printStackTrace();
}
}
File file = new File(infilePath);
if (file.exists() && jout != null)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Writing jar entry " + jarEntryName + " (" + msg + ")");
jout.putNextEntry(new JarEntry(jarEntryName));
copyAll(is, jout);
});
} catch (Exception x)
{
- System.err.println("Error loading alignment: " + x.getMessage());
+ jalview.bin.Console.errPrintln("Error loading alignment: " + x.getMessage());
}
}
return af;
{
if (bytes != null)
{
- // System.out.println("Jalview2XML: opening byte jarInputStream for
+ // jalview.bin.Console.outPrintln("Jalview2XML: opening byte jarInputStream for
// bytes.length=" + bytes.length);
return new JarInputStream(new ByteArrayInputStream(bytes));
}
if (_url != null)
{
- // System.out.println("Jalview2XML: opening url jarInputStream for "
+ // jalview.bin.Console.outPrintln("Jalview2XML: opening url jarInputStream for "
// + _url);
return new JarInputStream(_url.openStream());
}
else
{
- // System.out.println("Jalview2XML: opening file jarInputStream for
+ // jalview.bin.Console.outPrintln("Jalview2XML: opening file jarInputStream for
// " + file);
return new JarInputStream(new FileInputStream(file));
}
{
ex.printStackTrace();
errorMessage = "Couldn't locate Jalview XML file : " + file;
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exception whilst loading jalview XML file : " + ex + "\n");
} catch (Exception ex)
{
- System.err.println("Parsing as Jalview Version 2 file failed.");
+ jalview.bin.Console.errPrintln("Parsing as Jalview Version 2 file failed.");
ex.printStackTrace(System.err);
if (attemptversion1parse)
{
}
if (af != null)
{
- System.out.println("Successfully loaded archive file");
+ jalview.bin.Console.outPrintln("Successfully loaded archive file");
return af;
}
ex.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exception whilst loading jalview XML file : " + ex + "\n");
} catch (OutOfMemoryError e)
{
// Don't use the OOM Window here
errorMessage = "Out of memory loading jalview XML file";
- System.err.println("Out of memory whilst loading jalview XML file");
+ jalview.bin.Console.errPrintln("Out of memory whilst loading jalview XML file");
e.printStackTrace();
}
Desktop.addInternalFrame(af, view.getTitle(),
safeInt(view.getWidth()), safeInt(view.getHeight()));
af.setMenusForViewport();
- System.err.println("Failed to restore view " + view.getTitle()
+ jalview.bin.Console.errPrintln("Failed to restore view " + view.getTitle()
+ " to split frame");
}
}
}
else
{
- System.err.println("Problem loading Jalview file: " + errorMessage);
+ jalview.bin.Console.errPrintln("Problem loading Jalview file: " + errorMessage);
}
}
errorMessage = null;
if (tmpSeq.getStart() != jseq.getStart()
|| tmpSeq.getEnd() != jseq.getEnd())
{
- System.err.println(String.format(
+ jalview.bin.Console.errPrintln(String.format(
"Warning JAL-2154 regression: updating start/end for sequence %s from %d/%d to %d/%d",
tmpSeq.getName(), tmpSeq.getStart(), tmpSeq.getEnd(),
jseq.getStart(), jseq.getEnd()));
// XML.
// and then recover its containing af to allow the settings to be applied.
// TODO: fix for vamsas demo
- System.err.println(
+ jalview.bin.Console.errPrintln(
"About to recover a viewport for existing alignment: Sequence set ID is "
+ uniqueSeqSetId);
Object seqsetobj = retrieveExistingObj(uniqueSeqSetId);
if (seqsetobj instanceof String)
{
uniqueSeqSetId = (String) seqsetobj;
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Recovered extant sequence set ID mapping for ID : New Sequence set ID is "
+ uniqueSeqSetId);
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning : Collision between sequence set ID string and existing jalview object mapping.");
}
createOrLinkStructureViewer(entry, af, ap, jprovider);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error loading structure viewer: " + e.getMessage());
// failed - try the next one
}
|| version.equalsIgnoreCase("Test")
|| version.equalsIgnoreCase("AUTOMATED BUILD"))
{
- System.err.println("Assuming project file with "
+ jalview.bin.Console.errPrintln("Assuming project file with "
+ (version == null ? "null" : version)
+ " is compatible with Jalview version " + supported);
return true;
//
// @Override
// protected void processKeyEvent(java.awt.event.KeyEvent e) {
- // System.out.println("Jalview2XML AF " + e);
+ // jalview.bin.Console.outPrintln("Jalview2XML AF " + e);
// super.processKeyEvent(e);
//
// }
}
if (matchedAnnotation == null)
{
- System.err.println("Failed to match annotation colour scheme for "
+ jalview.bin.Console.errPrintln("Failed to match annotation colour scheme for "
+ annotationId);
return null;
}
}
// TODO: merges will never happen if we 'know' we have the real dataset
// sequence - this should be detected when id==dssid
- System.err.println(
+ jalview.bin.Console.errPrintln(
"DEBUG Notice: Merged dataset sequence (if you see this often, post at http://issues.jalview.org/browse/JAL-1474)"); // ("
// + (pre ? "prepended" : "") + " "
// + (post ? "appended" : ""));
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning - making up dataset sequence id for DbRef sequence map reference");
sqid = ((Object) ms).toString(); // make up a new hascode for
// undefined dataset sequence hash
} catch (IllegalStateException e)
{
// mixing AND and OR conditions perhaps
- System.err.println(
+ jalview.bin.Console.errPrintln(
String.format("Error reading filter conditions for '%s': %s",
featureType, e.getMessage()));
// return as much as was parsed up to the error
}
else
{
- System.err.println("Malformed compound filter condition");
+ jalview.bin.Console.errPrintln("Malformed compound filter condition");
}
}
}
import java.awt.Graphics;
import java.awt.Graphics2D;
import java.awt.Image;
+import java.awt.RenderingHints;
+import java.awt.Stroke;
import java.awt.geom.AffineTransform;
import java.awt.image.ImageObserver;
import java.util.BitSet;
import java.util.Hashtable;
+import org.jfree.graphics2d.svg.SVGGraphics2D;
+import org.jibble.epsgraphics.EpsGraphics2D;
+
import jalview.analysis.AAFrequency;
import jalview.analysis.CodingUtils;
import jalview.analysis.Rna;
import jalview.analysis.StructureFrequency;
import jalview.api.AlignViewportI;
+import jalview.bin.Cache;
+import jalview.bin.Console;
import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.Annotation;
import jalview.datamodel.ColumnSelection;
private boolean av_ignoreGapsConsensus;
+ private boolean vectorRendition = false;
+
+ private boolean glyphLineDrawn = false;
+
/**
* attributes set from AwtRenderPanelI
*/
* if new annotation with a closing base pair half of the stem,
* display a backward arrow
*/
- g.fillPolygon(new int[] { lastSSX + 5, lastSSX + 5, lastSSX },
+ fillPolygon(g, new int[] { lastSSX + 5, lastSSX + 5, lastSSX },
new int[]
{ y + iconOffset, y + 14 + iconOffset, y + 8 + iconOffset },
3);
* if annotation ending with an opeing base pair half of the stem,
* display a forward arrow
*/
- g.fillPolygon(new int[] { x2 - 5, x2 - 5, x2 },
+ fillPolygon(g, new int[] { x2 - 5, x2 - 5, x2 },
new int[]
{ y + iconOffset, y + 14 + iconOffset, y + 8 + iconOffset },
3);
}
}
// draw arrow body
- g.fillRect(x1, y + 4 + iconOffset, x2 - x1, 7);
+ fillRect(g, x1, y + 4 + iconOffset, x2 - x1, 7);
}
void drawNotCanonicalAnnot(Graphics g, Color nonCanColor,
int iconOffset, int startRes, int column, boolean validRes,
boolean validEnd)
{
- // System.out.println(nonCanColor);
+ // Console.info(nonCanColor);
- g.setColor(nonCanColor);
int sCol = (lastSSX / charWidth)
+ hiddenColumns.visibleToAbsoluteColumn(startRes);
int x1 = lastSSX;
boolean diffdownstream = !validRes || !validEnd
|| row_annotations[column] == null
|| !dc.equals(row_annotations[column].displayCharacter);
- // System.out.println("Column "+column+" diff up: "+diffupstream+"
+ // Console.info("Column "+column+" diff up:
+ // "+diffupstream+"
// down:"+diffdownstream);
// If a closing base pair half of the stem, display a backward arrow
+ if (diffupstream || diffdownstream)
+ {
+ // draw glyphline under arrow
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+ }
+ g.setColor(nonCanColor);
if (column > 0 && Rna.isClosingParenthesis(dc))
{
// if (validRes && column>1 && row_annotations[column-2]!=null &&
// dc.equals(row_annotations[column-2].displayCharacter))
{
- g.fillPolygon(new int[] { lastSSX + 5, lastSSX + 5, lastSSX },
+ fillPolygon(g, new int[] { lastSSX + 5, lastSSX + 5, lastSSX },
new int[]
- { y + iconOffset, y + 14 + iconOffset, y + 8 + iconOffset },
+ { y + iconOffset + 1, y + 13 + iconOffset,
+ y + 7 + iconOffset },
3);
x1 += 5;
}
// display a forward arrow
if (diffdownstream)
{
- g.fillPolygon(new int[] { x2 - 5, x2 - 5, x2 },
+ fillPolygon(g, new int[] { x2 - 6, x2 - 6, x2 - 1 },
new int[]
- { y + iconOffset, y + 14 + iconOffset, y + 8 + iconOffset },
+ { y + iconOffset + 1, y + 13 + iconOffset,
+ y + 7 + iconOffset },
3);
x2 -= 5;
}
}
}
// draw arrow body
- g.fillRect(x1, y + 4 + iconOffset, x2 - x1, 7);
+ unsetAntialias(g);
+ fillRect(g, x1, y + 4 + iconOffset, x2 - x1, 6);
}
// public void updateFromAnnotationPanel(FontMetrics annotFM, AlignViewportI
AlignViewportI av, Graphics g, int activeRow, int startRes,
int endRes)
{
+ if (g instanceof EpsGraphics2D || g instanceof SVGGraphics2D)
+ {
+ this.setVectorRendition(true);
+ }
+ Graphics2D g2d = (Graphics2D) g;
+
long stime = System.currentTimeMillis();
boolean usedFaded = false;
// NOTES:
*
* continue; }
*/
+
// first pass sets up state for drawing continuation from left-hand
// column
// of startRes
+
+ // flag used for vector rendition
+ this.glyphLineDrawn = false;
x = (startRes == 0) ? 0 : -1;
while (x < endRes - startRes)
{
: null;
if (x > -1)
{
+ unsetAntialias(g);
if (activeRow == i)
{
g.setColor(Color.red);
{
if (columnSelection.contains(column))
{
- g.fillRect(x * charWidth, y, charWidth, charHeight);
+ fillRect(g, x * charWidth, y, charWidth, charHeight);
}
}
}
if (row.getInvalidStrucPos() > x)
{
g.setColor(Color.orange);
- g.fillRect(x * charWidth, y, charWidth, charHeight);
+ fillRect(g, x * charWidth, y, charWidth, charHeight);
}
else if (row.getInvalidStrucPos() == x)
{
g.setColor(Color.orange.darker());
- g.fillRect(x * charWidth, y, charWidth, charHeight);
+ fillRect(g, x * charWidth, y, charWidth, charHeight);
}
if (validCharWidth && validRes && displayChar != null
&& (displayChar.length() > 0))
{
- Graphics2D gg = ((Graphics2D) g);
+ // Graphics2D gg = (g);
float fmWidth = fm.charsWidth(displayChar.toCharArray(), 0,
displayChar.length());
if (row_annotations[column].colour == null)
{
- gg.setColor(Color.black);
+ g2d.setColor(Color.black);
}
else
{
- gg.setColor(row_annotations[column].colour);
+ g2d.setColor(row_annotations[column].colour);
}
/*
/*
* translate to drawing position _before_ applying any scaling
*/
- gg.translate(xPos, yPos);
+ g2d.translate(xPos, yPos);
if (scaledToFit)
{
/*
* use a scaling transform to make the label narrower
* (JalviewJS doesn't have Font.deriveFont(AffineTransform))
*/
- gg.transform(
+ g2d.transform(
AffineTransform.getScaleInstance(fmScaling, 1.0));
}
+ setAntialias(g);
if (column == 0 || row.graph > 0)
{
- gg.drawString(displayChar, 0, 0);
+ g2d.drawString(displayChar, 0, 0);
}
else if (row_annotations[column - 1] == null || (labelAllCols
|| !displayChar.equals(
|| (displayChar.length() < 2
&& row_annotations[column].secondaryStructure == ' ')))
{
- gg.drawString(displayChar, 0, 0);
+ g2d.drawString(displayChar, 0, 0);
}
if (scaledToFit)
{
* undo scaling before translating back
* (restoring saved transform does NOT work in JS PDFGraphics!)
*/
- gg.transform(AffineTransform
+ g2d.transform(AffineTransform
.getScaleInstance(1D / fmScaling, 1.0));
}
- gg.translate(-xPos, -yPos);
+ g2d.translate(-xPos, -yPos);
}
}
if (row.hasIcons)
{
// int nb_annot = x - temp;
- // System.out.println("\t type :"+lastSS+"\t x :"+x+"\t nbre
+ // Console.info("\t type :"+lastSS+"\t x
+ // :"+x+"\t nbre
// annot :"+nb_annot);
switch (lastSS)
{
// temp = x;
break;
default:
- g.setColor(Color.gray);
- g.fillRect(lastSSX, y + 6 + iconOffset,
- (x * charWidth) - lastSSX, 2);
- // temp = x;
+ if (isVectorRendition())
+ {
+ // draw single full width glyphline
+ drawGlyphLine(g, lastSSX, endRes - x, y, iconOffset);
+ // disable more glyph lines
+ this.glyphLineDrawn = true;
+ }
+ else
+ {
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+ }
break;
}
}
case 'y':
case 'Z':
case 'z':
- // System.out.println(lastSS);
+ // Console.info(lastSS);
Color nonCanColor = getNotCanonicalColor(lastSS);
drawNotCanonicalAnnot(g, nonCanColor, row_annotations, lastSSX,
x, y, iconOffset, startRes, column, validRes, validEnd);
break;
default:
- drawGlyphLine(g, row_annotations, lastSSX, x, y, iconOffset,
- startRes, column, validRes, validEnd);
+ if (isVectorRendition())
+ {
+ // draw single full width glyphline
+ drawGlyphLine(g, lastSSX, endRes - x, y, iconOffset);
+ // disable more glyph lines
+ this.glyphLineDrawn = true;
+ }
+ else
+ {
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+ }
break;
}
}
}
else
{
- System.err.println(
+ Console.warn(
"rendered with " + renderer.getClass().toString());
}
}
{
if (clipst)
{
- System.err.println(
- "Start clip at : " + yfrom + " (index " + f_i + ")");
+ Console.warn("Start clip at : " + yfrom + " (index " + f_i + ")");
}
if (clipend)
{
- System.err.println(
- "End clip at : " + yto + " (index " + f_to + ")");
+ Console.warn("End clip at : " + yto + " (index " + f_to + ")");
}
}
;
- System.err.println("Annotation Rendering time:"
+ Console.warn("Annotation Rendering time:"
+ (System.currentTimeMillis() - stime));
}
;
// private Color sdNOTCANONICAL_COLOUR;
- void drawGlyphLine(Graphics g, Annotation[] row, int lastSSX, int x,
- int y, int iconOffset, int startRes, int column, boolean validRes,
- boolean validEnd)
+ void drawGlyphLine(Graphics g, int lastSSX, int x, int y, int iconOffset)
{
+ if (glyphLineDrawn)
+ {
+ // if we've drawn a single long glyphline for an export, don't draw the
+ // bits
+ return;
+ }
+ unsetAntialias(g);
g.setColor(GLYPHLINE_COLOR);
g.fillRect(lastSSX, y + 6 + iconOffset, (x * charWidth) - lastSSX, 2);
}
int lastSSX, int x, int y, int iconOffset, int startRes,
int column, boolean validRes, boolean validEnd)
{
- g.setColor(SHEET_COLOUR);
-
if (!validEnd || !validRes || row == null || row[column] == null
|| row[column].secondaryStructure != 'E')
{
- g.fillRect(lastSSX, y + 4 + iconOffset, (x * charWidth) - lastSSX - 4,
- 7);
- g.fillPolygon(
+ // draw the glyphline underneath
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+
+ g.setColor(SHEET_COLOUR);
+ fillRect(g, lastSSX, y + 4 + iconOffset,
+ (x * charWidth) - lastSSX - 4, 6);
+ fillPolygon(g,
new int[]
- { (x * charWidth) - 4, (x * charWidth) - 4, (x * charWidth) },
+ { (x * charWidth) - 6, (x * charWidth) - 6,
+ (x * charWidth - 1) },
new int[]
- { y + iconOffset, y + 14 + iconOffset, y + 7 + iconOffset },
+ { y + iconOffset + 1, y + 13 + iconOffset,
+ y + 7 + iconOffset },
3);
}
else
{
- g.fillRect(lastSSX, y + 4 + iconOffset, (x + 1) * charWidth - lastSSX,
- 7);
+ g.setColor(SHEET_COLOUR);
+ fillRect(g, lastSSX, y + 4 + iconOffset, (x * charWidth) - lastSSX,
+ 6);
}
-
}
void drawHelixAnnot(Graphics g, Annotation[] row, int lastSSX, int x,
int y, int iconOffset, int startRes, int column, boolean validRes,
boolean validEnd)
{
- g.setColor(HELIX_COLOUR);
-
int sCol = (lastSSX / charWidth)
+ hiddenColumns.visibleToAbsoluteColumn(startRes);
int x1 = lastSSX;
int x2 = (x * charWidth);
- if (USE_FILL_ROUND_RECT)
+ if (USE_FILL_ROUND_RECT || isVectorRendition())
{
+ // draw glyph line behind helix (visible in EPS or SVG output)
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+
+ g.setColor(HELIX_COLOUR);
+ setAntialias(g);
int ofs = charWidth / 2;
// Off by 1 offset when drawing rects and ovals
// to offscreen image on the MAC
- g.fillRoundRect(lastSSX, y + 4 + iconOffset, x2 - x1, 8, 8, 8);
+ fillRoundRect(g, lastSSX, y + 3 + iconOffset, x2 - x1 - 1, 8, 8, 8);
if (sCol == 0 || row[sCol - 1] == null
|| row[sCol - 1].secondaryStructure != 'H')
{
else
{
// g.setColor(Color.orange);
- g.fillRoundRect(lastSSX, y + 4 + iconOffset, x2 - x1 - ofs + 1, 8,
- 0, 0);
+ fillRoundRect(g, lastSSX, y + 3 + iconOffset, x2 - x1 - ofs, 8, 0,
+ 0);
}
if (!validRes || row[column] == null
|| row[column].secondaryStructure != 'H')
else
{
// g.setColor(Color.magenta);
- g.fillRoundRect(lastSSX + ofs, y + 4 + iconOffset,
- x2 - x1 - ofs + 1, 8, 0, 0);
-
+ fillRoundRect(g, lastSSX + ofs, y + 3 + iconOffset, x2 - x1 - ofs,
+ 8, 0, 0);
}
return;
}
- if (sCol == 0 || row[sCol - 1] == null
- || row[sCol - 1].secondaryStructure != 'H')
+ boolean leftEnd = sCol == 0 || row[sCol - 1] == null
+ || row[sCol - 1].secondaryStructure != 'H';
+ boolean rightEnd = !validRes || row[column] == null
+ || row[column].secondaryStructure != 'H';
+
+ if (leftEnd || rightEnd)
+ {
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+ }
+ g.setColor(HELIX_COLOUR);
+
+ if (leftEnd)
{
- g.fillArc(lastSSX, y + 4 + iconOffset, charWidth, 8, 90, 180);
+ fillArc(g, lastSSX, y + 3 + iconOffset, charWidth, 8, 90, 180);
x1 += charWidth / 2;
}
- if (!validRes || row[column] == null
- || row[column].secondaryStructure != 'H')
+ if (rightEnd)
{
- g.fillArc((x * charWidth) - charWidth, y + 4 + iconOffset, charWidth,
- 8, 270, 180);
+ fillArc(g, ((x - 1) * charWidth), y + 3 + iconOffset, charWidth, 8,
+ 270, 180);
x2 -= charWidth / 2;
}
- g.fillRect(x1, y + 4 + iconOffset, x2 - x1, 8);
+ fillRect(g, x1, y + 3 + iconOffset, x2 - x1, 8);
}
void drawLineGraph(Graphics g, AlignmentAnnotation _aa,
{
return;
}
+ Stroke roundStroke = new BasicStroke(1, BasicStroke.CAP_ROUND,
+ BasicStroke.JOIN_ROUND);
+ Stroke squareStroke = new BasicStroke(1, BasicStroke.CAP_SQUARE,
+ BasicStroke.JOIN_MITER);
+ Graphics2D g2d = (Graphics2D) g;
+ Stroke prevStroke = g2d.getStroke();
+ g2d.setStroke(roundStroke);
int x = 0;
}
g.setColor(Color.gray);
- g.drawLine(x - charWidth, y2, (eRes - sRes + 1) * charWidth, y2);
+ drawLine(g, squareStroke, x * charWidth - charWidth, y2,
+ (eRes - sRes) * charWidth, y2);
eRes = Math.min(eRes, aa_annotations.length);
// standalone value
y1 = y - (int) (((aa_annotations[column].value - min) / range)
* graphHeight);
- g.drawLine(x * charWidth + charWidth / 4, y1,
+ drawLine(g, x * charWidth + charWidth / 4, y1,
x * charWidth + 3 * charWidth / 4, y1);
x++;
continue;
y2 = y - (int) (((aa_annotations[column].value - min) / range)
* graphHeight);
- g.drawLine(x * charWidth - charWidth / 2, y1,
+ drawLine(g, (x - 1) * charWidth + charWidth / 2, y1,
x * charWidth + charWidth / 2, y2);
x++;
}
{
g.setColor(_aa.threshold.colour);
Graphics2D g2 = (Graphics2D) g;
- g2.setStroke(new BasicStroke(1, BasicStroke.CAP_SQUARE,
+ Stroke s = new BasicStroke(1, BasicStroke.CAP_SQUARE,
BasicStroke.JOIN_ROUND, 3f, new float[]
- { 5f, 3f }, 0f));
+ { 5f, 3f }, 0f);
y2 = (int) (y - ((_aa.threshold.value - min) / range) * graphHeight);
- g.drawLine(0, y2, (eRes - sRes) * charWidth, y2);
- g2.setStroke(new BasicStroke());
+ drawLine(g, s, 0, y2, (eRes - sRes) * charWidth, y2);
}
+ g2d.setStroke(prevStroke);
}
@SuppressWarnings("unused")
g.setColor(Color.gray);
- g.drawLine(x, y2, (eRes - sRes) * charWidth, y2);
+ drawLine(g, x, y2, (eRes - sRes) * charWidth, y2);
int column;
int aaMax = aa_annotations.length - 1;
{
if (y1 - y2 > 0)
{
- g.fillRect(x * charWidth, y2, charWidth, y1 - y2);
+ fillRect(g, x * charWidth, y2, charWidth, y1 - y2);
}
else
{
- g.fillRect(x * charWidth, y1, charWidth, y2 - y1);
+ fillRect(g, x * charWidth, y1, charWidth, y2 - y1);
}
}
// draw profile if available
// lm is not necessary - we can just use fm - could be off by no more
// than 0.5 px
// LineMetrics lm = g.getFontMetrics(ofont).getLineMetrics("Q", g);
- // System.out.println(asc + " " + dec + " " + (asc - lm.getAscent())
+ // Console.info(asc + " " + dec + " " + (asc -
+ // lm.getAscent())
// + " " + (dec - lm.getDescent()));
double asc = fm.getAscent();
if (_aa.threshold != null)
{
g.setColor(_aa.threshold.colour);
- Graphics2D g2 = (Graphics2D) g;
- g2.setStroke(new BasicStroke(1, BasicStroke.CAP_SQUARE,
+ Stroke s = new BasicStroke(1, BasicStroke.CAP_SQUARE,
BasicStroke.JOIN_ROUND, 3f, new float[]
- { 5f, 3f }, 0f));
+ { 5f, 3f }, 0f);
y2 = (int) (y
- ((_aa.threshold.value - min) / range) * _aa.graphHeight);
- g.drawLine(0, y2, (eRes - sRes) * charWidth, y2);
- g2.setStroke(new BasicStroke());
+ drawLine(g, s, 0, y2, (eRes - sRes) * charWidth, y2);
}
}
{
eRes = Math.min(eRes, aa_annotations.length);
g.setColor(Color.white);
- g.fillRect(0, 0, width, y);
+ fillRect(g, 0, 0, width, y);
g.setColor(new Color(0, 0, 180));
int x = 0, height;
height = y;
}
- g.fillRect(x, y - height, charWidth, height);
+ fillRect(g, x, y - height, charWidth, height);
}
x += charWidth;
}
return new Color(0, 80, 255);
default:
- System.out.println("This is not a interaction : " + lastss);
+ Console.info("This is not a interaction : " + lastss);
return null;
}
}
+
+ private void fillPolygon(Graphics g, int[] xpoints, int[] ypoints, int n)
+ {
+ setAntialias(g);
+ g.fillPolygon(xpoints, ypoints, n);
+ }
+
+ /*
+ private void fillRect(Graphics g, int a, int b, int c, int d)
+ {
+ fillRect(g, false, a, b, c, d);
+ }*/
+
+ private void fillRect(Graphics g, int a, int b, int c, int d)
+ {
+ unsetAntialias(g);
+ g.fillRect(a, b, c, d);
+ }
+
+ private void fillRoundRect(Graphics g, int a, int b, int c, int d, int e,
+ int f)
+ {
+ setAntialias(g);
+ g.fillRoundRect(a, b, c, d, e, f);
+ }
+
+ private void fillArc(Graphics g, int a, int b, int c, int d, int e, int f)
+ {
+ setAntialias(g);
+ g.fillArc(a, b, c, d, e, f);
+ }
+
+ private void drawLine(Graphics g, Stroke s, int a, int b, int c, int d)
+ {
+ Graphics2D g2d = (Graphics2D) g;
+ Stroke p = g2d.getStroke();
+ g2d.setStroke(s);
+ drawLine(g, a, b, c, d);
+ g2d.setStroke(p);
+ }
+
+ private void drawLine(Graphics g, int a, int b, int c, int d)
+ {
+ setAntialias(g);
+ g.drawLine(a, b, c, d);
+ }
+
+ private void setAntialias(Graphics g)
+ {
+ if (isVectorRendition())
+ {
+ // no need to antialias vector drawings
+ return;
+ }
+ if (Cache.getDefault("ANTI_ALIAS", true))
+ {
+ Graphics2D g2d = (Graphics2D) g;
+ g2d.setRenderingHint(RenderingHints.KEY_ANTIALIASING,
+ RenderingHints.VALUE_ANTIALIAS_ON);
+ }
+ }
+
+ private void unsetAntialias(Graphics g)
+ {
+ if (isVectorRendition())
+ {
+ // no need to antialias vector drawings
+ return;
+ }
+ Graphics2D g2d = (Graphics2D) g;
+ g2d.setRenderingHint(RenderingHints.KEY_ANTIALIASING,
+ RenderingHints.VALUE_ANTIALIAS_OFF);
+ }
+
+ public void setVectorRendition(boolean b)
+ {
+ vectorRendition = b;
+ }
+
+ public boolean isVectorRendition()
+ {
+ return vectorRendition;
+ }
}
}
eRes = Math.min(eRes, aa_annotations.length);
- int x = 0, y2 = y;
+ int x = 0, topY = y;
- g.setColor(shade.no_data);
-
- g.drawLine(x, y2, (eRes - sRes) * charWidth, y2);
+ // uncomment below to render whole area of matrix as pink
+ // g.setColor(shade.no_data);
+ // g.fillRect(x, topY-_aa.height, (eRes - sRes) * charWidth, _aa.graphHeight);
+
boolean showGroups = _aa.isShowGroupsForContactMatrix();
int column;
int aaMax = aa_annotations.length - 1;
final ContactGeometry cgeom = new ContactGeometry(contacts,
_aa.graphHeight);
- for (int ht = y2, eht = y2
- - _aa.graphHeight; ht >= eht; ht -= cgeom.pixels_step)
+ for (int ht = 0, botY = topY
+ - _aa.height; ht < _aa.graphHeight; ht += cgeom.pixels_step)
{
- ContactGeometry.contactInterval ci = cgeom.mapFor(y2 - ht,
- y2 - ht + cgeom.pixels_step);
+ ContactGeometry.contactInterval ci = cgeom.mapFor(ht,
+ ht + cgeom.pixels_step);
// cstart = (int) Math.floor(((double) y2 - ht) * contacts_per_pixel);
// cend = (int) Math.min(contact_height,
// Math.ceil(cstart + contacts_per_pixel * pixels_step));
g.setColor(col);
if (cgeom.pixels_step > 1)
{
- g.fillRect(x * charWidth, ht, charWidth, 1 + cgeom.pixels_step);
+ g.fillRect(x * charWidth, botY+ht, charWidth, 1 + cgeom.pixels_step);
}
else
{
- g.drawLine(x * charWidth, ht, (x + 1) * charWidth, ht);
+ g.drawLine(x * charWidth, botY+ht, (x + 1) * charWidth, botY+ht);
}
}
x++;
final String reply = "REST not yet implemented; received "
+ request.getMethod() + ": " + request.getRequestURL()
+ (queryString == null ? "" : "?" + queryString);
- System.out.println(reply);
+ jalview.bin.Console.outPrintln(reply);
response.setHeader("Cache-Control", "no-cache/no-store");
response.setHeader("Content-type", "text/plain");
} catch (Exception ex)
{
// used to try to parse a V1 Castor generated colours file
- System.err.println("Failed to read colour scheme from " + filePath
+ jalview.bin.Console.errPrintln("Failed to read colour scheme from " + filePath
+ " : " + ex.toString());
}
cs.getSchemeClass().getDeclaredConstructor().newInstance());
} catch (InstantiationException | IllegalAccessException e)
{
- System.err.println("Error instantiating colour scheme for "
+ jalview.bin.Console.errPrintln("Error instantiating colour scheme for "
+ cs.toString() + " " + e.getMessage());
e.printStackTrace();
} catch (ReflectiveOperationException roe)
String name = cs.getSchemeName();
if (name == null)
{
- System.err.println("ColourScheme name may not be null");
+ jalview.bin.Console.errPrintln("ColourScheme name may not be null");
return;
}
this.mask = setNums(s);
// for (int i=0; i < mask.length; i++) {
- // System.out.println(mask[i] + " " + ResidueProperties.aa[mask[i]]);
+ // jalview.bin.Console.outPrintln(mask[i] + " " + ResidueProperties.aa[mask[i]]);
// }
}
@Deprecated
public boolean isConserved(int[][] cons2, int col, int size)
{
- System.out.println("DEPRECATED!!!!");
+ jalview.bin.Console.outPrintln("DEPRECATED!!!!");
return isConserved(cons2, col, size, true);
}
if (tot > ((threshold * size) / 100))
{
- // System.out.println("True conserved "+tot+" from "+threshold+" out of
+ // jalview.bin.Console.outPrintln("True conserved "+tot+" from "+threshold+" out of
// "+size+" : "+maskstr);
return true;
}
for (int x = 0; x < this.annotation._rnasecstr.length; x++)
{
- // System.out.println(this.annotation._rnasecstr[x] + " Begin" +
+ // jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x] + " Begin" +
// this.annotation._rnasecstr[x].getBegin());
- // System.out.println(this.annotation._rnasecstr[x].getFeatureGroup());
+ // jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x].getFeatureGroup());
// pairs.put(this.annotation._rnasecstr[x].getBegin(),
// this.annotation._rnasecstr[x].getEnd());
@Override
public Color findColour(char c)
{
- // System.out.println("called"); log.debug
+ // jalview.bin.Console.outPrintln("called"); log.debug
// Generate a random pastel color
return ResidueProperties.purinepyrimidine[ResidueProperties.purinepyrimidineIndex[c]];// jalview.util.ColorUtils.generateRandomColor(Color.white);
{
Color currentColour = Color.white;
String currentHelix = null;
- // System.out.println(c + " " + j);
+ // jalview.bin.Console.outPrintln(c + " " + j);
currentHelix = positionsToHelix.get(j);
- // System.out.println(positionsToHelix.get(j));
+ // jalview.bin.Console.outPrintln(positionsToHelix.get(j));
if (currentHelix != null)
{
currentColour = helixcolorhash.get(currentHelix);
}
- // System.out.println(c + " " + j + " helix " + currentHelix + " " +
+ // jalview.bin.Console.outPrintln(c + " " + j + " helix " + currentHelix + " " +
// currentColour);
return currentColour;
}
{
if (!ttype.toLowerCase(Locale.ROOT).startsWith("no"))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Ignoring unrecognised threshold type : " + ttype);
}
}
featureColour.setThreshold(Float.valueOf(tval).floatValue());
} catch (Exception e)
{
- System.err.println("Couldn't parse threshold value as a float: ("
+ jalview.bin.Console.errPrintln("Couldn't parse threshold value as a float: ("
+ tval + ")");
}
}
if (gcol.hasMoreTokens())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Ignoring additional tokens in parameters in graduated colour specification\n");
while (gcol.hasMoreTokens())
{
- System.err.println(BAR + gcol.nextToken());
+ jalview.bin.Console.errPrintln(BAR + gcol.nextToken());
}
- System.err.println("\n");
+ jalview.bin.Console.errPrintln("\n");
}
return featureColour;
} catch (Exception e)
{
/*
- * System.out.println(this.annotation._rnasecstr[x] + " Begin" +
+ * jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x] + " Begin" +
* this.annotation._rnasecstr[x].getBegin());
*/
- // System.out.println(this.annotation._rnasecstr[x].getFeatureGroup());
+ // jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x].getFeatureGroup());
positionsToHelix.put(this.annotation._rnasecstr[x].getBegin(),
this.annotation._rnasecstr[x].getFeatureGroup());
public static void main(String[] args)
{
Hashtable<String, Vector<String>> aaProps = new Hashtable<>();
- System.out.println("my %aa = {");
+ jalview.bin.Console.outPrintln("my %aa = {");
// invert property hashes
for (String pname : propHash.keySet())
{
System.out.print("'" + props.nextElement() + "'");
if (props.hasMoreElements())
{
- System.out.println(", ");
+ jalview.bin.Console.outPrintln(", ");
}
}
- System.out.println("]" + (res.hasMoreElements() ? "," : ""));
+ jalview.bin.Console.outPrintln("]" + (res.hasMoreElements() ? "," : ""));
}
- System.out.println("};");
+ jalview.bin.Console.outPrintln("};");
}
// to here
if (col == null)
{
- System.out.println("Making colour from name: " + colour);
+ jalview.bin.Console.outPrintln("Making colour from name: " + colour);
col = ColorUtils.createColourFromName(colour);
}
}
} catch (Exception ex)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Error parsing userDefinedColours:\n" + token + "\n" + ex);
}
{
if (mappings.isEmpty())
{
- System.err.println("reportMapping: No PDB/Sequence mappings.");
+ jalview.bin.Console.errPrintln("reportMapping: No PDB/Sequence mappings.");
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"reportMapping: There are " + mappings.size() + " mappings.");
int i = 0;
for (StructureMapping sm : mappings)
{
- System.err.println("mapping " + i++ + " : " + sm.pdbfile);
+ jalview.bin.Console.errPrintln("mapping " + i++ + " : " + sm.pdbfile);
}
}
}
chain.transferResidueAnnotation(siftsMapping, null);
} catch (SiftsException e)
{
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected exception during SIFTS mapping - falling back to NW for this sequence/structure pair");
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
}
}
if (!foundSiftsMappings.isEmpty())
*
* if (mappings[j].sequence == seq && mappings[j].getPdbId().equals(pdbid)
* && mappings[j].pdbfile.equals(sl.getPdbFile())) {
- * System.out.println(pdbid+" "+mappings[j].getPdbId() +"
+ * jalview.bin.Console.outPrintln(pdbid+" "+mappings[j].getPdbId() +"
* "+mappings[j].pdbfile);
*
* java.awt.Color col; for(int index=0; index<seq.getLength(); index++) {
boolean removed = seqmappings.remove(acf);
if (removed && seqmappings.isEmpty())
{ // debug
- System.out.println("All mappings removed");
+ jalview.bin.Console.outPrintln("All mappings removed");
}
}
}
if (waiting)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Timed out waiting for structure viewer to load file "
+ notLoaded);
return false;
}
else
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Unexpected key returned from identifiers jalview service");
return idData;
}
// BH 2018 -- added more valuable report
if (errorMessage != null)
{
- System.err.println("IdentifiersUrlProvider: cannot read " + idFileName
+ jalview.bin.Console.errPrintln("IdentifiersUrlProvider: cannot read " + idFileName
+ ": " + errorMessage);
}
return idData;
}
}
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Error initialising UrlProvider - no custom url provider");
return null;
}
// testing part
// you may omit this part for your application
//
- System.out.println("Hello World 2");
- System.out.println("All fonts available to Graphic2D:\n");
+ jalview.bin.Console.outPrintln("Hello World 2");
+ jalview.bin.Console.outPrintln("All fonts available to Graphic2D:\n");
GraphicsEnvironment ge = GraphicsEnvironment
.getLocalGraphicsEnvironment();
String[] fontNames = ge.getAvailableFontFamilyNames();
for (int n = 0; n < fontNames.length; n++)
{
- System.out.println(fontNames[n]);
+ jalview.bin.Console.outPrintln(fontNames[n]);
}
// Testing part: simple an error thrown anywhere in this JVM will be printed
// on the Console
// We do it with a seperate Thread becasue we don't wan't to break a Thread
// used by the Console.
- System.out.println("\nLets throw an error on this console");
+ jalview.bin.Console.outPrintln("\nLets throw an error on this console");
errorThrower = new Thread(this);
errorThrower.setDaemon(true);
errorThrower.start();
if (channelPropsURL == null)
{
// complete failure of channel_properties, set all properties to defaults
- System.err.println("Failed to find '/" + CHANNEL_PROPERTIES_FILENAME
+ jalview.bin.Console.errPrintln("Failed to find '/" + CHANNEL_PROPERTIES_FILENAME
+ "' file at '"
+ (channelPropsURL == null ? "null"
: channelPropsURL.toString())
channelPropsIS.close();
} catch (IOException e)
{
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
// return false;
}
}
channelProps.load(is);
} catch (FileNotFoundException e)
{
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
} catch (IOException e)
{
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
}
}
}
}
else
{
- System.err.println("Failed to get channel property '" + key + "'");
+ jalview.bin.Console.errPrintln("Failed to get channel property '" + key + "'");
}
}
return null;
img = imgIcon == null ? null : imgIcon.getImage();
if (img == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to load channel image " + key + "=" + path);
if (!useClassDefaultImage)
{
{
return urlMap().getOrDefault(key, null);
}
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Do not use getImageURL(key) before using getImage(key...)");
}
return null;
return color;
}
+
+ /**
+ *
+ * @return random color
+ */
+ public static final Color getARandomColor()
+ {
+ Color col = new Color((int) (Math.random() * 255),
+ (int) (Math.random() * 255), (int) (Math.random() * 255));
+ return col;
+ }
/**
* Convert to Tk colour code format
*
}
else
{
- System.err.println("Malformed PDB DR line:" + acn);
+ jalview.bin.Console.errPrintln("Malformed PDB DR line:" + acn);
}
}
else
// debug
/*
* for (int s = 0; s <= rg.numSubs(); s++) {
- * System.err.println("Sub " + s + " : " + rg.matchedFrom(s) +
+ * jalview.bin.Console.errPrintln("Sub " + s + " : " + rg.matchedFrom(s) +
* " : " + rg.matchedTo(s) + " : '" + rg.stringMatched(s) + "'");
* }
*/
if (url == null)
{
- System.out.println("Created NO urls.");
+ jalview.bin.Console.outPrintln("Created NO urls.");
}
else
{
- System.out.println("Created a url from " + ((int[]) url[0])[0]
+ jalview.bin.Console.outPrintln("Created a url from " + ((int[]) url[0])[0]
+ "out of " + idstring[0].length + " sequences.");
- System.out.println("Sequences that did not match:");
+ jalview.bin.Console.outPrintln("Sequences that did not match:");
for (int sq = 0; sq < idstring[0].length; sq++)
{
if (!((boolean[]) url[1])[sq])
{
- System.out.println("Seq " + sq + ": " + idstring[0][sq] + "\t: "
+ jalview.bin.Console.outPrintln("Seq " + sq + ": " + idstring[0][sq] + "\t: "
+ idstring[1][sq]);
}
}
- System.out.println("Sequences that DID match:");
+ jalview.bin.Console.outPrintln("Sequences that DID match:");
for (int sq = 0; sq < idstring[0].length; sq++)
{
if (((boolean[]) url[1])[sq])
{
- System.out.println("Seq " + sq + ": " + idstring[0][sq] + "\t: "
+ jalview.bin.Console.outPrintln("Seq " + sq + ": " + idstring[0][sq] + "\t: "
+ idstring[1][sq]);
}
}
- System.out.println("The generated URL:");
- System.out.println(((String[]) url[3])[0]);
+ jalview.bin.Console.outPrintln("The generated URL:");
+ jalview.bin.Console.outPrintln(((String[]) url[3])[0]);
}
}
GroupUrlLink ul = new GroupUrlLink(links[i]);
if (ul.isValid())
{
- System.out.println("\n\n\n");
- System.out.println(
+ jalview.bin.Console.outPrintln("\n\n\n");
+ jalview.bin.Console.outPrintln(
"Link " + i + " " + links[i] + " : " + ul.toString());
- System.out.println(" pref : " + ul.getUrl_prefix());
- System.out.println(" IdReplace : " + ul.getIDRegexReplace());
- System.out.println(" SeqReplace : " + ul.getSeqRegexReplace());
- System.out.println(" Suffixes : " + ul.getUrl_suffix());
+ jalview.bin.Console.outPrintln(" pref : " + ul.getUrl_prefix());
+ jalview.bin.Console.outPrintln(" IdReplace : " + ul.getIDRegexReplace());
+ jalview.bin.Console.outPrintln(" SeqReplace : " + ul.getSeqRegexReplace());
+ jalview.bin.Console.outPrintln(" Suffixes : " + ul.getUrl_suffix());
- System.out.println(
+ jalview.bin.Console.outPrintln(
"<insert input id and sequence strings here> Without onlyIfMatches:");
Object[] urls;
try
testUrls(ul, seqsandids, urls);
} catch (UrlStringTooLongException ex)
{
- System.out.println("too long exception " + ex);
+ jalview.bin.Console.outPrintln("too long exception " + ex);
}
- System.out.println(
+ jalview.bin.Console.outPrintln(
"<insert input id and sequence strings here> With onlyIfMatches set:");
try
{
testUrls(ul, seqsandids, urls);
} catch (UrlStringTooLongException ex)
{
- System.out.println("too long exception " + ex);
+ jalview.bin.Console.outPrintln("too long exception " + ex);
}
}
else
{
- System.err.println("Invalid URLLink : " + links[i] + " : "
+ jalview.bin.Console.errPrintln("Invalid URLLink : " + links[i] + " : "
+ ul.getInvalidMessage());
}
}
import java.net.HttpURLConnection;
import java.net.ProtocolException;
import java.net.URL;
-import java.util.List;
import javax.ws.rs.HttpMethod;
+import jalview.bin.Cache;
+
public class HttpUtils
{
public static boolean checkUrlAvailable(URL url, int readTimeout)
throws IOException, ProtocolException
{
- // System.out.println(System.currentTimeMillis() + " " + url);
+ // jalview.bin.Console.outPrintln(System.currentTimeMillis() + " " + url);
HttpURLConnection connection = (HttpURLConnection) url.openConnection();
return connection.getResponseCode() == 200;
}
+ public static String getUserAgent()
+ {
+ return getUserAgent(null);
+ }
+
+ public static String getUserAgent(String className)
+ {
+ StringBuilder sb = new StringBuilder();
+ sb.append("Jalview");
+ sb.append('/');
+ sb.append(Cache.getDefault("VERSION", "Unknown"));
+ sb.append(" (");
+ sb.append(System.getProperty("os.name"));
+ sb.append("; ");
+ sb.append(System.getProperty("os.arch"));
+ sb.append(' ');
+ sb.append(System.getProperty("os.name"));
+ sb.append(' ');
+ sb.append(System.getProperty("os.version"));
+ sb.append("; ");
+ sb.append("java/");
+ sb.append(System.getProperty("java.version"));
+ sb.append("; ");
+ sb.append("jalview/");
+ sb.append(ChannelProperties.getProperty("channel"));
+ if (className != null)
+ {
+ sb.append("; ");
+ sb.append(className);
+ }
+ String installation = Cache.applicationProperties
+ .getProperty("INSTALLATION");
+ if (installation != null)
+ {
+ sb.append("; ");
+ sb.append(installation);
+ }
+ sb.append(')');
+ sb.append(" help@jalview.org");
+ return sb.toString();
+ }
+
}
import java.net.URL;
import java.util.Properties;
+import jalview.bin.Console;
+
public class LaunchUtils
{
+ // setting these is LaunchUtils so don't need to import Platform
+ public final static boolean isMac = System.getProperty("os.name")
+ .indexOf("Mac") > -1;
+
+ public final static boolean isWindows = System.getProperty("os.name")
+ .indexOf("Win") > -1;
+
+ private static boolean isJS = /** @j2sNative true || */
+ false;
+
public static void loadChannelProps(File dir)
{
ChannelProperties.loadProps(dir);
return null;
} catch (IOException e)
{
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
return null;
}
}
public static int getJavaCompileVersion()
{
- if (Platform.isJS())
+ if (LaunchUtils.isJS)
{
return -1;
}
null);
if (JCV == null)
{
- System.out.println(
+ Console.errPrintln(
"Could not obtain JAVA_COMPILE_VERSION for comparison");
return -2;
}
JAVA_COMPILE_VERSION = Integer.parseInt(JCV);
} catch (MalformedURLException e)
{
- System.err.println("Could not find " + buildDetails);
+ jalview.bin.Console.errPrintln("Could not find " + buildDetails);
return -3;
} catch (IOException e)
{
- System.err.println("Could not load " + buildDetails);
+ jalview.bin.Console.errPrintln("Could not load " + buildDetails);
return -4;
} catch (NumberFormatException e)
{
- System.err.println("Could not parse JAVA_COMPILE_VERSION");
+ jalview.bin.Console.errPrintln("Could not parse JAVA_COMPILE_VERSION");
return -5;
}
public static int getJavaVersion()
{
- if (Platform.isJS())
+ if (LaunchUtils.isJS)
{
return -1;
}
String JV = System.getProperty("java.version");
if (JV == null)
{
- System.out.println("Could not obtain java.version for comparison");
+ Console.errPrintln("Could not obtain java.version for comparison");
return -2;
}
if (JV.startsWith("1."))
: Integer.parseInt(JV.substring(0, JV.indexOf(".")));
} catch (NumberFormatException e)
{
- System.err.println("Could not parse java.version");
+ jalview.bin.Console.errPrintln("Could not parse java.version");
return -3;
}
return JAVA_VERSION;
public static boolean checkJavaVersion()
{
- if (Platform.isJS())
+ if (LaunchUtils.isJS)
{
return true;
}
if (java_compile_version <= 0 || java_version <= 0)
{
- System.out.println("Could not make Java version check");
+ Console.errPrintln("Could not make Java version check");
return true;
}
// Warn if these java.version and JAVA_COMPILE_VERSION conditions exist
return true;
}
+
+ public static String findJavaBin(boolean winConsole)
+ {
+ return findJavaBin(System.getProperty("java.home"), winConsole, true);
+ }
+
+ /*
+ * Returns a string path to the most likely java binary wanted to run this
+ * installation of Jalview.
+ *
+ * @param winConsole whether to use java.exe (console) in preference to javaw.exe
+ * (only affects Windows).
+ * @param javaHome Try this javaHome dir (defaults to the running java.home).
+ * @param generic Return a generic java command if not found.
+ */
+ public static String findJavaBin(String javaHome, boolean winConsole,
+ boolean generic)
+ {
+ String javaBin = null;
+ final String javaExe = winConsole ? "java.exe" : "javaw.exe";
+ final String java = "java";
+
+ if (javaHome != null)
+ {
+ // property "channel.app_name" is set by install4j when launching getdown
+ String propertyAppName = System.getProperty("channel.app_name");
+ final String appName = (propertyAppName != null
+ && propertyAppName.length() > 0) ? propertyAppName
+ : ChannelProperties.getProperty("app_name");
+
+ final String javaBinDir = javaHome + File.separator + "bin"
+ + File.separator;
+
+ // appName and "Jalview" will not point to javaw.exe or java.exe but in
+ // this case that's okay because the taskbar display name problem doesn't
+ // manifest in Windows. See JAL-3820, JAL-4189.
+ for (String name : new String[] { appName, "Jalview", java, javaExe })
+ {
+ if (LaunchUtils.checkJVMSymlink(javaBinDir + name, winConsole))
+ {
+ javaBin = javaBinDir + name;
+ break;
+ }
+ }
+ }
+
+ if (javaBin == null && generic)
+ {
+ javaBin = LaunchUtils.isWindows ? javaExe : java;
+ }
+
+ return javaBin;
+ }
+
+ /*
+ * checkJVMSymlink returns true if the path in testBin *is* a java binary, or
+ * points to a java binary.
+ * @param testBin The binary or symbolic link to check
+ * @param winConsole whether we are in/want a Windows console (only relevant for Windows,
+ * determines whether we use java.exe or javaw.exe)
+ */
+ private static boolean checkJVMSymlink(String testBin, boolean winConsole)
+ {
+ File testBinFile = new File(testBin);
+ if (!testBinFile.exists())
+ {
+ return false;
+ }
+ File targetFile = null;
+ try
+ {
+ targetFile = testBinFile.getCanonicalFile();
+ } catch (IOException e)
+ {
+ return false;
+ }
+ final String javaExe = winConsole ? "java.exe" : "javaw.exe";
+ if (targetFile != null && ("java".equals(targetFile.getName())
+ || javaExe.equals(targetFile.getName())))
+ {
+ return true;
+ }
+ return false;
+ }
}
init = true;
} catch (Exception e)
{
- System.err.println("Problems initializing the log4j system\n");
+ jalview.bin.Console.errPrintln("Problems initializing the log4j system\n");
e.printStackTrace(System.err);
}
}
time = mark = t;
if (msg != null)
{
- System.err.println("Platform: timer reset\t\t\t" + msg);
+ jalview.bin.Console.errPrintln("Platform: timer reset\t\t\t" + msg);
}
break;
case TIME_MARK:
}
if (msg != null)
{
- System.err.println("Platform: timer mark\t" + ((t - time) / 1000f)
+ jalview.bin.Console.errPrintln("Platform: timer mark\t" + ((t - time) / 1000f)
+ "\t" + ((t - mark) / 1000f) + "\t" + msg);
}
mark = t;
case TIME_GET:
if (msg != null)
{
- System.err.println("Platform: timer dur\t" + ((t - time) / 1000f)
+ jalview.bin.Console.errPrintln("Platform: timer dur\t" + ((t - time) / 1000f)
+ "\t" + ((duration) / 1000f) + "\t" + msg);
}
set = 0;
* info[key];
*/
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Platform id=" + id + " reading Info." + key + " = " + value);
p.put(id + "_" + key, value);
if (isJS())
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Platform adding known access-control-allow-origin * for domain "
+ domain);
/**
* @j2sNative var a =
* decodeURI((document.location.href.replace("&","?").split("?j2s")[0]
* + "?").split("?")[1].split("#")[0]); a &&
- * (System.out.println("URL arguments detected were "+a)) &&
+ * (jalview.bin.Console.outPrintln("URL arguments detected were "+a)) &&
* (J2S.thisApplet.__Info.urlargs = a.split(" "));
* (!J2S.thisApplet.__Info.args || J2S.thisApplet.__Info.args
* == "" || J2S.thisApplet.__Info.args == "??") &&
- * (J2S.thisApplet.__Info.args = a) && (System.out.println("URL
+ * (J2S.thisApplet.__Info.args = a) && (jalview.bin.Console.outPrintln("URL
* arguments were passed to J2S main."));
*/
} catch (Throwable t)
jv.clear();
if (DEBUG)
{
- System.err.println("Array from '" + delimiter
+ jalview.bin.Console.errPrintln("Array from '" + delimiter
+ "' separated List:\n" + v.length);
for (int i = 0; i < v.length; i++)
{
- System.err.println("item " + i + " '" + v[i] + "'");
+ jalview.bin.Console.errPrintln("item " + i + " '" + v[i] + "'");
}
}
return v;
}
if (DEBUG)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Empty Array from '" + delimiter + "' separated List");
}
return null;
{
System.err
.println("Returning '" + separator + "' separated List:\n");
- System.err.println(v);
+ jalview.bin.Console.errPrintln(v);
}
return v.toString();
}
if (DEBUG)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Returning empty '" + separator + "' separated List\n");
}
return "" + separator;
return min < text.length() + 1 ? min : -1;
}
+ public static boolean equalsIgnoreCase(String s1, String s2)
+ {
+ if (s1 == null || s2 == null)
+ {
+ return s1 == s2;
+ }
+ return s1.toLowerCase(Locale.ROOT).equals(s2.toLowerCase(Locale.ROOT));
+ }
+
public static int indexOfFirstWhitespace(String text)
{
int index = -1;
// debug
for (int s = 0; s <= rg.numSubs(); s++)
{
- System.err.println("Sub " + s + " : " + rg.matchedFrom(s)
+ jalview.bin.Console.errPrintln("Sub " + s + " : " + rg.matchedFrom(s)
+ " : " + rg.matchedTo(s) + " : '"
+ rg.stringMatched(s) + "'");
}
}
if (calculator.workingInvolvedWith(alignmentAnnotation))
{
- // System.err.println("grey out ("+alignmentAnnotation.label+")");
+ // jalview.bin.Console.errPrintln("grey out ("+alignmentAnnotation.label+")");
return true;
}
return false;
{
if (sequenceSetID != null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning - overwriting a sequenceSetId for a viewport!");
}
sequenceSetID = new String(newid);
{
if (aa == null)
{
- System.err.println("Null annotation row: ignoring.");
+ jalview.bin.Console.errPrintln("Null annotation row: ignoring.");
continue;
}
if (!aa.visible)
if (aa.graph > 0)
{
- aa.height += aa.graphHeight;
+ aa.height += aa.graphHeight+20;
}
if (aa.height == 0)
{
if (this == av)
{
- System.err.println("Ignoring recursive setCodingComplement request");
+ jalview.bin.Console.errPrintln("Ignoring recursive setCodingComplement request");
}
else
{
*/
public void setStartEndSeq(int start, int end)
{
- // System.out.println("ViewportRange setStartEndSeq " + start + " " + end);
+ // jalview.bin.Console.outPrintln("ViewportRange setStartEndSeq " + start + " " + end);
int[] oldvalues = updateStartEndSeq(start, end);
int oldstartseq = oldvalues[0];
int oldendseq = oldvalues[1];
{
vpstart = visHeight - h;
}
- // System.out.println("ViewportRanges setviewportStartAndHeight " + vpstart
+ // jalview.bin.Console.outPrintln("ViewportRanges setviewportStartAndHeight " + vpstart
// + " " + start + " " + h + " " + getVisibleAlignmentHeight());
setStartEndSeq(vpstart, vpstart + h - 1);
*/
package jalview.viewmodel.styles;
-import jalview.api.ViewStyleI;
-
import java.awt.Color;
+import jalview.api.ViewStyleI;
+
/**
* A container for holding alignment view properties. View properties are
* data-independent, which means they can be safely copied between views
{
synchronized (inProgress)
{
- // System.err.println("Worker " + worker + " marked as complete.");
+ // jalview.bin.Console.errPrintln("Worker " + worker + " marked as complete.");
inProgress.remove(worker);
List<AlignCalcWorkerI> upd = updating.get(worker.getClass());
if (upd != null)
public boolean isWorking(AlignCalcWorkerI worker)
{
synchronized (inProgress)
- {// System.err.println("isWorking : worker "+(worker!=null ?
+ {// jalview.bin.Console.errPrintln("isWorking : worker "+(worker!=null ?
// worker.getClass():"null")+ " "+hashCode());
return worker != null && inProgress.contains(worker);
}
boolean working=false;
synchronized (inProgress)
{
- // System.err.println("isWorking "+hashCode());
+ // jalview.bin.Console.errPrintln("isWorking "+hashCode());
working |= inProgress.size() > 0;
}
synchronized (updating)
* {
*
* if (isPending(worker)) { worker.abortAndDestroy(); startWorker(worker); }
- * else { System.err.println("Pending exists for " + workerClass); } }
+ * else { jalview.bin.Console.errPrintln("Pending exists for " + workerClass); } }
*/
}
.getCurrentAlignFrame().alignPanel;
if (currentAlignFrame == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Can't register calculator as no alignment window has focus");
return;
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Can't register calculator as no alignment window has focus");
}
}
}
while (!calcMan.notifyWorking(this))
{
- // System.err.println("Thread
+ // jalview.bin.Console.errPrintln("Thread
// (Consensus"+Thread.currentThread().getName()+") Waiting around.");
try
{
{
Console.debug("Interrupted sleep waiting for next job poll.", e);
}
- // System.out.println("I'm alive "+alTitle);
+ // jalview.bin.Console.outPrintln("I'm alive "+alTitle);
}
}
if (jobComplete && jobs != null)
}
} catch (Exception e)
{
- System.err.println("Couldn't locate PICR service instance.\n");
+ jalview.bin.Console.errPrintln("Couldn't locate PICR service instance.\n");
e.printStackTrace();
}
while (sdataset.size() > 0 && db < dbSources.length)
{
int maxqlen = 1; // default number of queries made at one time
- System.out.println("Verifying against " + dbSources[db].getDbName());
+ jalview.bin.Console.outPrintln("Verifying against " + dbSources[db].getDbName());
// iterate through db for each remaining un-verified sequence
SequenceI[] currSeqs = new SequenceI[sdataset.size()];
true);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exception with Picr for '" + token + "'\n");
e.printStackTrace();
}
// present, and do a transferReferences
// otherwise transfer non sequence x-references directly.
}
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Validated ID against PICR... (for what its worth):"
+ token);
addSeqId(sequence, token);
else
{
// if ()
- // System.out.println("Not querying source with
+ // jalview.bin.Console.outPrintln("Not querying source with
// token="+token+"\n");
addSeqId(sequence, token);
queries.addElement(token.toUpperCase(Locale.ROOT));
DbSourceProxy dbSourceProxy, AlignmentI retrievedAl,
boolean trimDatasetSeqs, List<String> warningMessages)
{
- // System.out.println("trimming ? " + trimDatasetSeqs);
+ // jalview.bin.Console.outPrintln("trimming ? " + trimDatasetSeqs);
if (retrievedAl == null || retrievedAl.getHeight() == 0)
{
return false;
}
}
- System.out.println("Adding dbrefs to " + sequence.getName()
+ jalview.bin.Console.outPrintln("Adding dbrefs to " + sequence.getName()
+ " from " + dbSource + " sequence : "
+ retrievedSeq.getName());
sequence.transferAnnotation(retrievedSeq, mp);
}
// } catch (OutOfMemoryError e)
// {
- // System.err.println("Out of memory when displaying status. Squashing
+ // jalview.bin.Console.errPrintln("Out of memory when displaying status. Squashing
// error.");
// wsInfo.appendProgressText(j.jobnum,
// "..\n(Out of memory when displaying status)\n");
import jalview.util.MapUtils;
import jalview.ws.dbsources.EBIAlfaFold;
+/**
+ * routines and class for holding predicted alignment error matrices as produced
+ * by alphafold et al.
+ *
+ * getContactList(column) returns the vector of predicted alignment errors for
+ * reference position given by column getElementAt(column, i) returns the
+ * predicted superposition error for the ith position when column is used as
+ * reference
+ *
+ * Many thanks to Ora Schueler Furman for noticing that earlier development
+ * versions did not show the PAE oriented correctly
+ *
+ * @author jprocter
+ *
+ */
public class PAEContactMatrix extends
MappableContactMatrix<PAEContactMatrix> implements ContactMatrixI
{
Object d = scores.next();
if (d instanceof Double)
{
- elements[row][col++] = ((Double) d).longValue();
+ elements[col][row] = ((Double) d).longValue();
}
else
{
- elements[row][col++] = (float) ((Long) d).longValue();
+ elements[col][row] = (float) ((Long) d).longValue();
}
- if (maxscore < elements[row][col - 1])
+ if (maxscore < elements[col][row])
{
- maxscore = elements[row][col - 1];
+ maxscore = elements[col][row];
}
+ col++;
}
row++;
col = 0;
cols = ((List<Long>) pae_obj.get("residue2")).iterator();
Iterator<Double> scores = ((List<Double>) pae_obj.get("distance"))
.iterator();
- elements = new float[maxrow][maxcol];
+ elements = new float[maxcol][maxrow];
while (scores.hasNext())
{
float escore = scores.next().floatValue();
{
maxcol = col;
}
- elements[row - 1][col - 1] = escore;
+ elements[col - 1][row-1] = escore;
}
maxscore = ((Double) MapUtils.getFirst(pae_obj,
"max_predicted_aligned_error", "max_pae")).floatValue();
}
+ /**
+ * getContactList(column) @returns the vector of predicted alignment errors
+ * for reference position given by column
+ */
@Override
public ContactListI getContactList(final int column)
{
});
}
+ /**
+ * getElementAt(column, i) @returns the predicted superposition error for the
+ * ith position when column is used as reference
+ */
@Override
protected double getElementAt(int _column, int i)
{
if (!isValidReference(id))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"(AFClient) Ignoring invalid alphafold query: '" + id + "'");
stopQuery();
return null;
}
} catch (Exception e)
{
- System.err.println("Warning: problems reading temp file " + file);
+ jalview.bin.Console.errPrintln("Warning: problems reading temp file " + file);
return null;
}
return bf;
}
else
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"No record found for '" + emprefx + ":" + query + "'");
}
}
}
} catch (Exception e)
{
- System.err.println("EMBL Record Features parsing error!");
+ jalview.bin.Console.errPrintln("EMBL Record Features parsing error!");
System.err
.println("Please report the following to help@jalview.org :");
- System.err.println("EMBL Record " + accession);
- System.err.println("Resulted in exception: " + e.getMessage());
+ jalview.bin.Console.errPrintln("EMBL Record " + accession);
+ jalview.bin.Console.errPrintln("Resulted in exception: " + e.getMessage());
e.printStackTrace(System.err);
}
codonStart = Integer.parseInt(value.trim());
} catch (NumberFormatException e)
{
- System.err.println("Invalid codon_start in XML for "
+ jalview.bin.Console.errPrintln("Invalid codon_start in XML for "
+ entry.getAccession() + ": " + e.getMessage());
}
}
* workaround until we handle dna location for CDS sequence
* e.g. location="X53828.1:60..1058" correctly
*/
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Implementation Notice: EMBLCDS records not properly supported yet - Making up the CDNA region of this sequence... may be incorrect ("
+ sourceDb + ":" + entry.getAccession() + ")");
int dnaLength = dna.getLength();
if (translationLength * 3 == (1 - codonStart + dnaLength))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Not allowing for additional stop codon at end of cDNA fragment... !");
// this might occur for CDS sequences where no features are marked
exons = new int[] { dna.getStart() + (codonStart - 1),
}
if ((translationLength + 1) * 3 == (1 - codonStart + dnaLength))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Allowing for additional stop codon at end of cDNA fragment... will probably cause an error in VAMSAs!");
exons = new int[] { dna.getStart() + (codonStart - 1),
dna.getEnd() - 3 };
if (!isValidReference(id))
{
- System.err.println("Ignoring invalid pdb query: '" + id + "'");
+ jalview.bin.Console.errPrintln("Ignoring invalid pdb query: '" + id + "'");
stopQuery();
return null;
}
String database = parseIds(ids, querystring);
if (database == null)
{
- System.err.println("Invalid Query string : '" + ids + "'");
- System.err.println("Should be of form 'dbname:q1;q2;q3;q4'");
+ jalview.bin.Console.errPrintln("Invalid Query string : '" + ids + "'");
+ jalview.bin.Console.errPrintln("Should be of form 'dbname:q1;q2;q3;q4'");
return null;
}
}
return (String[]) arl.toArray();
}
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning: response code " + responseCode + " for " + url);
} catch (OutOfMemoryError er)
{
- System.out.println("OUT OF MEMORY DOWNLOADING QUERY FROM " + database
+ jalview.bin.Console.outPrintln("OUT OF MEMORY DOWNLOADING QUERY FROM " + database
+ ":\n" + ids);
throw er;
} catch (Exception ex)
if (!ex.getMessage().startsWith(
"uk.ac.ebi.jdbfetch.exceptions.DbfNoEntryFoundException"))
{
- System.err.println("Unexpected exception when retrieving from "
+ jalview.bin.Console.errPrintln("Unexpected exception when retrieving from "
+ database + "\nQuery was : '" + ids + "'");
ex.printStackTrace(System.err);
}
public Annotate3D()
{
- System.out.println("Annotate3D");
+ jalview.bin.Console.outPrintln("Annotate3D");
// try {
// Create a URL for the desired page
// String id = "1HR2";
// OutputStream out1 = null;
// out = new BufferedWriter(new OutputStreamWriter(out1, "temp.rnaml"));
// while ((str = in.readLine()) != null) {
- // System.out.println(str);
+ // jalview.bin.Console.outPrintln(str);
// out.write(str);
// }
// in.close();
public Annotate3D(String path) throws InterruptedException
{
- System.out.println("Annotate3D");
+ jalview.bin.Console.outPrintln("Annotate3D");
try
{
// //URL url = new
// URL("http://paradise-ibmc.u-strasbg.fr/webservices/annotate3d?data="+inFile);
- // System.out.println("Step1");
+ // jalview.bin.Console.outPrintln("Step1");
// FileReader r = new FileReader(inFile);
// BufferedReader in = new BufferedReader(r);
// StringBuffer content = new StringBuffer();
- // System.out.println("Step2");
+ // jalview.bin.Console.outPrintln("Step2");
// while(in.readLine()!=null){
// content.append(in.readLine());
- // //System.out.println("Step3"+in.readLine());
+ // //jalview.bin.Console.outPrintln("Step3"+in.readLine());
// }
//
// String data = URLEncoder.encode("data", "UTF-8") + "=" +
// FileReader r = new FileReader(path);
// BufferedReader in = new BufferedReader(r);
// StringBuffer content = new StringBuffer();
- // System.out.println("Step1");
+ // jalview.bin.Console.outPrintln("Step1");
// while(in.readLine()!=null){
// content.append(in.readLine());
//
// }
- // System.out.println("Step2");
+ // jalview.bin.Console.outPrintln("Step2");
// String data = URLEncoder.encode("data", "UTF-8") + "=" +
// URLEncoder.encode(content.toString(), "UTF-8");
- // System.out.println("Step2");
+ // jalview.bin.Console.outPrintln("Step2");
// URL url = new
// URL("http://paradise-ibmc.u-strasbg.fr/webservices/annotate3d?data="+data);
// DataInputStream is = new DataInputStream(url.openStream());
// String str;
// while ((str = is.readLine()) != null) {
- // System.out.println(str);
+ // jalview.bin.Console.outPrintln(str);
// //out.write(str);
// }
FileReader r = new FileReader(path);
while ((str = in.readLine()) != null)
{
- // System.out.println(str);
+ // jalview.bin.Console.outPrintln(str);
content = content + str;
}
- System.out.println("pdbfile=" + content.toString());
- System.out.println("capacité=" + content.length());
+ jalview.bin.Console.outPrintln("pdbfile=" + content.toString());
+ jalview.bin.Console.outPrintln("capacité=" + content.length());
String paramfile = URLEncoder.encode(content.toString(), "UTF-8");
- System.out.println("param=" + paramfile);
+ jalview.bin.Console.outPrintln("param=" + paramfile);
URL url = new URL(
"http://paradise-ibmc.u-strasbg.fr/webservices/annotate3d?data="
+ content);
String str4;
while ((str4 = is.readLine()) != null)
{
- System.out.println(str4);
+ jalview.bin.Console.outPrintln(str4);
// out.write(str);
}
in.close();
// BufferedReader in1 = new BufferedReader(is);
// OutputStream out1 = null;
- // System.out.println("Step3");
+ // jalview.bin.Console.outPrintln("Step3");
// BufferedWriter out = new BufferedWriter(new OutputStreamWriter(out1,
// "temp.rnaml"));
//
// return;
- // System.out.println(data.length());
- // System.out.println("step2");
+ // jalview.bin.Console.outPrintln(data.length());
+ // jalview.bin.Console.outPrintln("step2");
// URL url = new
// URL("http://paradise-ibmc.u-strasbg.fr/webservices/annotate3d?data="+data);
- // System.out.println("step3");
+ // jalview.bin.Console.outPrintln("step3");
// URLConnection conn = url.openConnection();
// conn.setDoOutput(true);
// OutputStreamWriter writer = new
// //String line;
// while ((line = reader.readLine()) != null) {
// answer.append(line);
- // System.out.println(line);
+ // jalview.bin.Console.outPrintln(line);
// }
// writer.close();
// reader.close();
// out = new BufferedWriter(new FileWriter("temp.rnaml"));
// while ((str = in.readLine()) != null) {
- // System.out.println(str);
+ // jalview.bin.Console.outPrintln(str);
// out.write(str);
- // System.out.println(str);
+ // jalview.bin.Console.outPrintln(str);
// in.close();
// out.close();
// public BufferedWriter getReader()
// {
- // System.out.println("The buffer");
+ // jalview.bin.Console.outPrintln("The buffer");
// return out;
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"jalview.rootRegistry is not a proper url!\nWas set to "
+ RootServiceURL + "\n" + e);
}
WS1Client instance = serviceClientBindings.get(sh.getAbstractName());
if (instance == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"WARNING - POSSIBLE IMPLEMENTATION ERROR - cannot find WSClient implementation for "
+ sh.getAbstractName());
}
wsInfo.setProgressText(j.getJobnum(),
"Failed to submit the prediction. (Just close the window)\n"
+ "It is most likely that there is a problem with the server.\n");
- System.err.println(
+ jalview.bin.Console.errPrintln(
"JPredWS Client: Failed to submit the prediction. Quite possibly because of a server error - see below)\n"
+ e.getMessage() + "\n");
j.setJobId(jobsubmit.getJobId());
j.setSubmitted(true);
j.setSubjobComplete(false);
- // System.out.println(WsURL + " Job Id '" + jobId + "'");
+ // jalview.bin.Console.outPrintln(WsURL + " Job Id '" + jobId + "'");
}
else
{
{
// TODO: JBPNote catch timeout or other fault types explicitly
// For unexpected errors
- System.err.println(WebServiceName
+ jalview.bin.Console.errPrintln(WebServiceName
+ "Client: Failed to submit the sequences for alignment (probably a server side problem)\n"
+ "When contacting Server:" + WsUrl + "\n" + e.toString()
+ "\n");
results++;
// if (Cache.isDebugEnabled())
// {
- // System.out.println("Job lob for job
+ // jalview.bin.Console.outPrintln("Job lob for job
// "+jobs[j].getJobId()+":"+jobs[j].getJobnum());
- // System.out.println(jobs[j].getStatus());
+ // jalview.bin.Console.outPrintln(jobs[j].getStatus());
// }
vamsas.objects.simple.Alignment valign = ((MsaResult) ((MsaWSJob) jobs[j]).result)
}
else
{
- System.out.println("MERGE WITH OLD FRAME");
+ jalview.bin.Console.outPrintln("MERGE WITH OLD FRAME");
// TODO: modify alignment in original frame, replacing old for new
// alignment using the commands.EditCommand model to ensure the update can
// be undone
}
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to parse the annotation file associated with the alignment.");
- System.err.println(">>>EOF" + inFile + "\n<<<EOF\n");
+ jalview.bin.Console.errPrintln(">>>EOF" + inFile + "\n<<<EOF\n");
e.printStackTrace(System.err);
}
}
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to parse the Features file associated with the alignment.");
- System.err.println(">>>EOF" + inFile + "\n<<<EOF\n");
+ jalview.bin.Console.errPrintln(">>>EOF" + inFile + "\n<<<EOF\n");
e.printStackTrace(System.err);
}
jalview.io.NewickFile nf = null;
}
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to parse the treeFile associated with the alignment.");
- System.err.println(">>>EOF" + inFile + "\n<<<EOF\n");
+ jalview.bin.Console.errPrintln(">>>EOF" + inFile + "\n<<<EOF\n");
e.printStackTrace(System.err);
}
j.setJobId(jobsubmit.getJobId());
j.setSubmitted(true);
j.setSubjobComplete(false);
- // System.out.println(WsURL + " Job Id '" + jobId + "'");
+ // jalview.bin.Console.outPrintln(WsURL + " Job Id '" + jobId + "'");
}
else
{
{
// TODO: JBPNote catch timeout or other fault types explicitly
// For unexpected errors
- System.err.println(WebServiceName
+ jalview.bin.Console.errPrintln(WebServiceName
+ "Client: Failed to submit the sequences for alignment (probably a server side problem)\n"
+ "When contacting Server:" + WsUrl + "\n" + e.toString()
+ "\n");
{
if (!newFrame)
{
- System.err.println("MERGE WITH OLD FRAME NOT IMPLEMENTED");
+ jalview.bin.Console.errPrintln("MERGE WITH OLD FRAME NOT IMPLEMENTED");
return;
}
// each subjob is an independent alignment for the moment
{
if (cancelJob(rslt))
{
- System.err.println("Cancelled AACon job: " + rslt);
+ jalview.bin.Console.errPrintln("Cancelled AACon job: " + rslt);
}
else
{
- System.err.println("FAILED TO CANCEL AACon job: " + rslt);
+ jalview.bin.Console.errPrintln("FAILED TO CANCEL AACon job: " + rslt);
}
} catch (Exception x)
catch (JobSubmissionException x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"submission error with " + getServiceActionText() + " :");
x.printStackTrace();
calcMan.disableWorker(this);
} catch (ResultNotAvailableException x)
{
- System.err.println("collection error:\nJob ID: " + rslt);
+ jalview.bin.Console.errPrintln("collection error:\nJob ID: " + rslt);
x.printStackTrace();
calcMan.disableWorker(this);
String id = rslt;
if (cancelJob(rslt))
{
- System.err.println("Cancelled job " + id);
+ jalview.bin.Console.errPrintln("Cancelled job " + id);
}
else
{
- System.err.println("Job " + id + " couldn't be cancelled.");
+ jalview.bin.Console.errPrintln("Job " + id + " couldn't be cancelled.");
}
} catch (Exception q)
{
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning: Ignoring parameter set instance of type "
+ paramset.getClass()
+ " : Bound but not applicable for service at "
registry = Jws2Client.connectToRegistry(jwsserver);
if (registry != null)
{
- // System.err.println("Test Services Output\n"
+ // jalview.bin.Console.errPrintln("Test Services Output\n"
// + registry.testAllServices());
// TODO: enumerate services and test those that haven't been tested
// in the last n-days/hours/etc.
srv_set = registry.getSupportedServices();
// dan test
- System.out.println(
+ jalview.bin.Console.outPrintln(
"registry.getSupportedServices: " + srv_set.toString());
svccategories = registry.getServiceCategories();
// dan test
- // System.out.println("registry.getServiceCategories: " +
+ // jalview.bin.Console.outPrintln("registry.getServiceCategories: " +
// svccategories.toString());
}
} catch (Exception ex)
{
- System.err.println("Exception whilst trying to get at registry:");
+ jalview.bin.Console.errPrintln("Exception whilst trying to get at registry:");
ex.printStackTrace();
// if that failed, then we are probably working with a JABAWS1 server.
// in that case, look for each service endpoint
- System.err.println("JWS2 Discoverer: " + jwsserver
+ jalview.bin.Console.errPrintln("JWS2 Discoverer: " + jwsserver
+ " is a JABAWS1 server. Using hardwired list.");
for (Services srv : JABAWS1SERVERS)
{
service = Jws2Client.connect(jwsserver, srv);
} catch (Exception e)
{
- System.err.println("Jws2 Discoverer: Problem on " + jwsserver
+ jalview.bin.Console.errPrintln("Jws2 Discoverer: Problem on " + jwsserver
+ " with service " + srv + ":\n" + e.getMessage());
if (!(e instanceof javax.xml.ws.WebServiceException))
{
result = true;
} catch (MalformedURLException e)
{
- System.err.println("Invalid server URL: " + server);
+ jalview.bin.Console.errPrintln("Invalid server URL: " + server);
result = false;
} catch (IOException e)
{
- System.err.println("Error connecting to server: " + server + ": "
+ jalview.bin.Console.errPrintln("Error connecting to server: " + server + ": "
+ e.toString());
result = false;
}
List<AlignmentAnnotation> ourAnnot, String typeName,
String calcId, SequenceI dseq, int base, Score scr)
{
- System.out.println("Creating annotation on dseq:" + dseq.getStart()
+ jalview.bin.Console.outPrintln("Creating annotation on dseq:" + dseq.getStart()
+ " base is " + base + " and length=" + dseq.getLength()
+ " == " + scr.getScores().size());
// AlignmentAnnotation annotation = new AlignmentAnnotation(
List<AlignmentAnnotation> ourAnnot, String typeName,
String calcId, SequenceI dseq, int base, Score scr)
{
- System.out.println("Creating annotation on dseq:" + dseq.getStart()
+ jalview.bin.Console.outPrintln("Creating annotation on dseq:" + dseq.getStart()
+ " base is " + base + " and length=" + dseq.getLength()
+ " == " + scr.getScores().size());
// AlignmentAnnotation annotation = new AlignmentAnnotation(
.loadClass("compbio.ws.client.Jws2Client");
} catch (ClassNotFoundException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Not enabling JABA Webservices : client jar is not available."
+ "\nPlease check that your webstart JNLP file is up to date!");
running = false;
{
services = new Vector<>();
}
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Discovered service: " + jwsservers + " " + service.toString());
// Jws2Instance service = new Jws2Instance(jwsservers, srv.toString(),
// service2);
{
if (getDiscoverer().services != null)
{
- System.out.println("Changesupport: There are now "
+ jalview.bin.Console.outPrintln("Changesupport: There are now "
+ getDiscoverer().services.size() + " services");
int i = 1;
for (Jws2Instance instance : getDiscoverer().services)
{
- System.out.println("Service " + i++ + " "
+ jalview.bin.Console.outPrintln("Service " + i++ + " "
+ instance.getClass() + "@" + instance.getHost()
+ ": " + instance.getActionText());
}
{
j.setSubmitted(true);
j.setSubjobComplete(false);
- // System.out.println(WsURL + " Job Id '" + jobId + "'");
+ // jalview.bin.Console.outPrintln(WsURL + " Job Id '" + jobId + "'");
return;
}
else
} catch (Error e)
{
// For unexpected errors
- System.err.println(WebServiceName
+ jalview.bin.Console.errPrintln(WebServiceName
+ "Client: Failed to submit the sequences for alignment (probably a server side problem)\n"
+ "When contacting Server:" + WsUrl + "\n");
e.printStackTrace(System.err);
} catch (Exception e)
{
// For unexpected errors
- System.err.println(WebServiceName
+ jalview.bin.Console.errPrintln(WebServiceName
+ "Client: Failed to submit the sequences for alignment (probably a server side problem)\n"
+ "When contacting Server:" + WsUrl + "\n");
e.printStackTrace(System.err);
if (Console.isDebugEnabled())
{
- System.out.println("Job Execution file for job: "
+ jalview.bin.Console.outPrintln("Job Execution file for job: "
+ msjob.getJobId() + " on server " + WsUrl);
- System.out.println(msjob.getStatus());
- System.out.println("*** End of status");
+ jalview.bin.Console.outPrintln(msjob.getStatus());
+ jalview.bin.Console.outPrintln("*** End of status");
}
try
else
{
// TODO 2.9.x feature
- System.out.println("MERGE WITH OLD FRAME");
+ jalview.bin.Console.outPrintln("MERGE WITH OLD FRAME");
// TODO: modify alignment in original frame, replacing old for new
// alignment using the commands.EditCommand model to ensure the update can
// be undone
Option o = options.getArgumentByOptionName(oname);
if (o == null)
{
- System.out.println("WARN ignoring unsuppoted parameter: " + oname);
+ jalview.bin.Console.outPrintln("WARN ignoring unsuppoted parameter: " + oname);
continue;
}
if (o instanceof Parameter)
: param);
} catch (WrongParameterException e)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Problem setting value for the parameter: " + param);
e.printStackTrace();
}
}
} catch (Exception ex)
{
- System.err.println("Exception when retrieving presets for service "
+ jalview.bin.Console.errPrintln("Exception when retrieving presets for service "
+ serviceType + " at " + hosturl);
}
}
* try { URL serviceurl = new URL(hosturl); if (serviceurl.getPort()!=80) {
* return serviceurl.getHost()+":"+serviceurl.getPort(); } return
* serviceurl.getHost(); } catch (Exception e) {
- * System.err.println("Failed to parse service URL '" + hosturl +
+ * jalview.bin.Console.errPrintln("Failed to parse service URL '" + hosturl +
* "' as a valid URL!"); } return null;
*/
}
: null));
} catch (Exception ex)
{
- System.err.println("Unexpected exception creating JabaParamStore.");
+ jalview.bin.Console.errPrintln("Unexpected exception creating JabaParamStore.");
ex.printStackTrace();
}
}
} catch (Exception ex)
{
- System.err.println("Couldn't transform string\n" + content
+ jalview.bin.Console.errPrintln("Couldn't transform string\n" + content
+ "\nException was :");
ex.printStackTrace(System.err);
}
@Override
public void cancelJob()
{
- System.err.println("Cannot cancel this job type: " + service);
+ jalview.bin.Console.errPrintln("Cannot cancel this job type: " + service);
}
@Override
}
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Serious - RSBS descriptions in user preferences are corrupt!");
ex.printStackTrace();
}
public void pollJob(AWsJob job) throws Exception
{
assert (job instanceof RestJob);
- System.err.println("Debug RestJob: Polling Job");
+ jalview.bin.Console.errPrintln("Debug RestJob: Polling Job");
doPoll((RestJob) job);
}
assert (job instanceof RestJob);
try
{
- System.err.println("Debug RestJob: Posting Job");
+ jalview.bin.Console.errPrintln("Debug RestJob: Posting Job");
doPost((RestJob) job);
} catch (NoValidInputDataException erex)
{
if (!rj.hasValidInput())
{
// invalid input for this job
- System.err.println("Job " + rj.getJobnum()
+ jalview.bin.Console.errPrintln("Job " + rj.getJobnum()
+ " has invalid input. ( " + rj.getStatus() + ")");
if (rj.hasStatus() && !_warnings.contains(rj.getStatus()))
{
seqset = fetcher.getSequenceRecords(qsb.toString());
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to retrieve the following from " + db);
- System.err.println(qsb);
+ jalview.bin.Console.errPrintln(qsb);
ex.printStackTrace(System.err);
}
// TODO: Merge alignment together - perhaps
{
if (fetcher.getRawRecords() != null)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"# Retrieved from " + db + ":" + qsb.toString());
StringBuffer rrb = fetcher.getRawRecords();
/*
/*
* } else { hdr = "# part "+rr; }
*/
- System.out.println(hdr);
+ jalview.bin.Console.outPrintln(hdr);
if (rrb != null)
{
- System.out.println(rrb);
+ jalview.bin.Console.outPrintln(rrb);
}
- System.out.println("# end of " + hdr);
+ jalview.bin.Console.outPrintln("# end of " + hdr);
}
}
}
if (queriesMade.size() > 0)
{
- System.out.println("# Adding " + queriesMade.size()
+ jalview.bin.Console.outPrintln("# Adding " + queriesMade.size()
+ " ids back to queries list for searching again (" + db
+ ")");
queriesLeft.addAll(queriesMade);
Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to retrieve the following references from " + db);
int n = 0;
for (String qv : queriesMade)
System.err.print(" " + qv + ";");
if (n++ > 10)
{
- System.err.println();
+ jalview.bin.Console.errPrintln();
n = 0;
}
}
- System.err.println();
+ jalview.bin.Console.errPrintln();
ex.printStackTrace();
}
import jalview.analysis.scoremodels.ScoreModels;
import jalview.api.DBRefEntryI;
import jalview.api.SiftsClientI;
+import jalview.bin.Console;
import jalview.datamodel.DBRefEntry;
import jalview.datamodel.DBRefSource;
import jalview.datamodel.SequenceI;
private static final String NOT_OBSERVED = "Not_Observed";
- private static final String SIFTS_FTP_BASE_URL = "http://ftp.ebi.ac.uk/pub/databases/msd/sifts/xml/";
+ private static final String SIFTS_SPLIT_FTP_BASE_URL = "https://ftp.ebi.ac.uk/pub/databases/msd/sifts/split_xml/";
private final static String NEWLINE = System.lineSeparator();
try (InputStream in = new FileInputStream(siftFile);
GZIPInputStream gzis = new GZIPInputStream(in);)
{
- // System.out.println("File : " + siftFile.getAbsolutePath());
+ // jalview.bin.Console.outPrintln("File : " + siftFile.getAbsolutePath());
JAXBContext jc = JAXBContext.newInstance("jalview.xml.binding.sifts");
XMLStreamReader streamReader = XMLInputFactory.newInstance()
.createXMLStreamReader(gzis);
if (siftsFile.exists())
{
// The line below is required for unit testing... don't comment it out!!!
- System.out.println(">>> SIFTS File already downloaded for " + pdbId);
+ jalview.bin.Console.outPrintln(">>> SIFTS File already downloaded for " + pdbId);
if (isFileOlderThanThreshold(siftsFile,
SiftsSettings.getCacheThresholdInDays()))
diffInDays = (int) ((new Date().getTime()
- attr.lastModifiedTime().toMillis())
/ (1000 * 60 * 60 * 24));
- // System.out.println("Diff in days : " + diffInDays);
+ // jalview.bin.Console.outPrintln("Diff in days : " + diffInDays);
} catch (IOException e)
{
e.printStackTrace();
pdbId = pdbId.replace(".cif", "");
}
String siftFile = pdbId + ".xml.gz";
- String siftsFileFTPURL = SIFTS_FTP_BASE_URL + siftFile;
+ String siftsFileFTPURL = getDownloadUrlFor(siftFile);
/*
* Download the file from URL to either
}
}
- // System.out.println(">> Download ftp url : " + siftsFileFTPURL);
+ // jalview.bin.Console.outPrintln(">> Download ftp url : " + siftsFileFTPURL);
// long now = System.currentTimeMillis();
URL url = new URL(siftsFileFTPURL);
URLConnection conn = url.openConnection();
}
outputStream.close();
inputStream.close();
- // System.out.println(">>> File downloaded : " + downloadedSiftsFile
+ // jalview.bin.Console.outPrintln(">>> File downloaded : " + downloadedSiftsFile
// + " took " + (System.currentTimeMillis() - now) + "ms");
return downloadTo;
}
+ public static String getDownloadUrlFor(String siftFile)
+ {
+ String durl = SIFTS_SPLIT_FTP_BASE_URL+siftFile.substring(1, 3)+"/"+siftFile;
+ Console.trace("SIFTS URL for "+siftFile+" is "+durl);
+ return durl;
+
+ }
+
/**
* Delete the SIFTs file for the given PDB Id in the local SIFTs download
* directory
seq = seq.getDatasetSequence();
}
structId = (chain == null) ? pdbId : pdbId + "|" + chain;
- System.out.println("Getting SIFTS mapping for " + structId + ": seq "
+ jalview.bin.Console.outPrintln("Getting SIFTS mapping for " + structId + ": seq "
+ seq.getName());
final StringBuilder mappingDetails = new StringBuilder(128);
{
List<Integer> omitNonObserved = new ArrayList<>();
int nonObservedShiftIndex = 0, pdbeNonObserved = 0;
- // System.out.println("Generating mappings for : " + entityId);
+ // jalview.bin.Console.outPrintln("Generating mappings for : " + entityId);
Entity entity = null;
entity = getEntityById(entityId);
String originalSeq = AlignSeq.extractGaps(
if (mapping.isEmpty())
{
- throw new SiftsException("SIFTS mapping failed");
+ throw new SiftsException("SIFTS mapping failed for "+entityId+" and "+seq.getName());
}
// also construct a mapping object between the seq-coord sys and the PDB
// seq's coord sys
int firstPDBResNum = UNASSIGNED;
for (Segment segment : segments)
{
- // System.out.println("Mapping segments : " + segment.getSegId() + "\\"s
+ // jalview.bin.Console.outPrintln("Mapping segments : " + segment.getSegId() + "\\"s
// + segStartEnd);
List<Residue> residues = segment.getListResidue().getResidue();
for (Residue residue : residues)
// Arrays.sort(keys);
int firstIndex = keys[0];
int lastIndex = keys[keys.length - 1];
- // System.out.println("Min value " + firstIndex);
- // System.out.println("Max value " + lastIndex);
+ // jalview.bin.Console.outPrintln("Min value " + firstIndex);
+ // jalview.bin.Console.outPrintln("Max value " + lastIndex);
for (int x = firstIndex; x <= lastIndex; x++)
{
if (!resNumMap.containsKey(x) && !omitNonObserved.contains(x))
*/
public Entity getEntityByMostOptimalMatchedId(String chainId)
{
- // System.out.println("---> advanced greedy entityId matching block
+ // jalview.bin.Console.outPrintln("---> advanced greedy entityId matching block
// entered..");
List<Entity> entities = siftsEntry.getEntity();
SiftsEntitySortPojo[] sPojo = new SiftsEntitySortPojo[entities.size()];
++count;
}
Arrays.sort(sPojo, Collections.reverseOrder());
- // System.out.println("highest matched entity : " + sPojo[0].entityId);
- // System.out.println("highest matched pid : " + sPojo[0].pid);
+ // jalview.bin.Console.outPrintln("highest matched entity : " + sPojo[0].entityId);
+ // jalview.bin.Console.outPrintln("highest matched pid : " + sPojo[0].pid);
if (sPojo[0].entityId != null)
{
}
} catch (IOException e)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Exception while closing download file output stream: "
+ e.getMessage());
}
}
} catch (IOException e)
{
- System.out.println("Exception while closing download channel: "
+ jalview.bin.Console.outPrintln("Exception while closing download channel: "
+ e.getMessage());
}
try
}
} catch (IOException e)
{
- System.out.println("Exception while deleting download temp file: "
+ jalview.bin.Console.outPrintln("Exception while deleting download temp file: "
+ e.getMessage());
}
}
--- /dev/null
+>101
+P.I...A..Q..I.....H.....I........L.......E........G.......R.......S....D.......E.......Q.....K....E.
+T..LI....RE...V.S.E...A...I......S.......R...S.......L........D....A.....P......L...................
+..........T......S.......V.......R......V...I....I.......T......E.....M........A....K.........G.....
+.H..........F..........G........I..........G........G......E........L....A...SK
+>UPI
+P.Hye.V..S..V.....T.....M........P.......T........G.......Wl......N....T.......V.......R.....K....Q.
+G..MI....DA...V.T.R...A...L......L.......E...A.......I........A....T.....P......F...................
+..........D......Essrfr..V.......R......C...L....I.......P......E.....I........P....D.........G.....
+.N..........W..........G........S..........G........Gya....L........P....L...S-
+>SRR
+P.H...V..A..V.....K.....L........Y.......P........G.......R.......T....E.......Q.......Q.....K....E.
+Q..LA....RA...I.A.D...D...V......M.......R...I.......L........G....S.....S......E...................
+..........A......S.......V.......S......V...S....I.......E......E.....V........D....A.........A.....
+.D..........W..........A........EkvyrplivegG........G......T........L....Y...KK
+>SRR
+P.H...V..I..V.....K.....L........W.......P........G.......R.......S....E.......P.......Q.....K....Q.
+K..LV....ES...V.T.K...A...V......T.......T...S.......L........G....Y.....S......D...................
+..........E......A.......V.......S......V...S....L.......Q......E.....V........P....S.........D.....
+.Q..........WtekvyrpdilG........T..........A........G......R........L....Y...KK
+>MGY
+P.I...V..R..I.....T.....M........F.......E........G.......R.......T....K.......E.......Q.....K....Q.
+E..LA....RV...I.T.E...A...V......V.......N...I.......A........K....T.....T......P...................
+..........D......A.......T.......E......VkdqI....L.......Q......K.....VllvrslrlP....PppasrrqvsG.....
+.A..........W..........S........A..........D........G......K........P....T...SE
+>446
+P.H...V..I..V.....K.....L........W.......P........G.......K.......S....E.......R.......E.....E....T.
+Q..LA....EA...I.T.K...S...V......T.......E...T.......L........N....F.....G......P...................
+..........E......S.......V.......S......V...A....F.......E......E.....I........P....A.........K.....
+.D..........W..........AskvyhadiI..........Gne......G......K........L....Y...KK
+>SRR
+P.L...V..R..I.....T.....Y........P.......R........Ga......L.......S....P.......E.......H.....K....T.
+R..IA....RA...L.T.E...I...V......L.......D...Vevdaa..T........D....A.....G......R...................
+..........M......V.......T.......V......V...H....F.......N......E.....A........A....P.........D.....
+.D..........W..........A........V..........G........G......Eirs.....T....A...AE
+>SRR
+P.L...V..R..I.....T.....Y........P.......R........Ga......L.......S....P.......D.......H.....K....R.
+R..IA....RE...L.T.E...I...V......L.......D...Vevdaa..T........D....A.....G......R...................
+..........M......V.......T.......V......I...H....F.......N......E.....A........A....A.........D.....
+.D..........W..........A........V..........G........G......Eirs.....T....A...AE
+>SRR
+P.R...Y..R..Vip...T.....V........P.......E........G.......Qy......S....N.......E.......S.....R....K.
+A..LV....KD...V.T.E...A...V......V.......R...A.......D........G....G.....K......Y...................
+..........E......Dvapr...V.......W......V...F....P.......T......E.....I........P....D.........G.....
+.Q..........W..........G........S..........R........Gvi....R........P....L...PE
+>SRR
+P.R...Y..R..Iip...T.....V........P.......E........G.......Qy......S....N.......E.......S.....R....K.
+A..LV....KD...V.T.E...A...V......V.......R...A.......D........G....G.....K......Y...................
+..........E......Dvapr...V.......W......V...F....P.......T......E.....I........P....D.........G.....
+.Q..........W..........G........S..........R........Gvi....R........P....L...PE
+>SRR
+P.V...I..E..M.....F.....V........P.......E........G.......La......D....A.......E.......A.....K....R.
+A..LH....DR...V.S.R...Q...V......L.......E...V.......E........G....AtydesP......L...................
+..........A......Qsi.....T.......W......M...L....I.......Q......E.....V........L....E.........C.....
+.G..........W..........S........V..........G........S......K........Avw..A...SE
+>SRR
+P.I...I..E..M.....H.....V........Q.......E........Gv......L.......D....E.......E.......T.....K....R.
+T..LH....ER...V.G.R...Q...V......L.......E...I.......E........G....Any...D......E...................
+..........N......D.......Varllt..F......M...F....I.......R......E.....H........P....E.........G.....
+.G..........F..........S........I..........G........G......E........M....It..SE
+>SRR
+P.Lyr.V..D..V.....T.....V........P.......E........Gsmihg..Q.......G....Pwal....S.......R.....R....R.
+A..IV....RE...V.T.E...I...V......L.......E...A.......E........G....S.....D......P...................
+..........Slgeaw.R.......V.......W......V...V....L.......R......E.....V........G....D.........A.....
+.F..........W..........G........A..........A........G......E........L....-...--
+>SRR
+P.Lyr.V..Q..I.....T.....V........P.......E........Gsmlhg..Q.......G....Pwai....E.......R.....R....R.
+E..LV....RA...V.S.K...A...V......L.......D...A.......E........G....Teyn..P......A...................
+..........Saw....R.......V.......W......V...L....M.......S......E.....I........S....E.........T.....
+.H..........W..........G........A..........A........G......E........-....-...--
+>SRR
+P.L...V..E..M.....S.....F........P.......V........Gv......L.......T....L.......D.......Q.....K....A.
+A..MI....KS...V.T.D...V...V......R.......G...A.......M........K....L.....P......P...................
+..........Dpar...K.......L.......F......V...E....I.......F......E.....T........P....G.........G.....
+.G..........F..........G........Vtakvvvvp..G........Gky....R........P....A...P-
+>SRR
+P.L...V..E..I.....D.....L........L.......E........A.......W.......A....P.......D.......Q.....I....D.
+A..IA....DA...I.H.E...A...M......V.......E...T.......L........G....V.....P......Eraagrdsatkqhfysrfaa
+llaeratvqsA......D.......L.......T......A...V....L.......V......E.....N........S....R.........D.....
+.D..........W..........S........F..........Gm.......G......Q........-....-...--
--- /dev/null
+--nonews
+--nosplash
+--open=./test/files/annotation_label_width/sample.a2m
+--colour=gecos:flower
+--gui
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3.pdb
+--paematrix=./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_2_model_4.pdb
+--paematrix=./examples/test_fab41.result/test_fab41_unrelaxed_rank_2_model_4_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_3_model_2.pdb
+--paematrix=./examples/test_fab41.result/test_fab41_unrelaxed_rank_3_model_2_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_4_model_5.pdb
+--paematrix=./examples/test_fab41.result/test_fab41_unrelaxed_rank_4_model_5_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1.pdb
+--paematrix=./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1_scores.json
+ matrix.getMin());
long start = System.currentTimeMillis();
AverageDistanceEngine clusterer = new AverageDistanceEngine(
- af.getViewport(), null, matrix);
+ af.getViewport(), null, matrix, false);
System.out.println("built a tree in "
+ (System.currentTimeMillis() - start) * 0.001 + " seconds.");
StringBuffer sb = new StringBuffer();
import jalview.gui.JvOptionPane;
import java.io.PrintStream;
+import java.nio.charset.Charset;
+import java.util.Locale;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.BeforeMethod;
import org.testng.annotations.Test;
+import com.google.common.base.Charsets;
+
/**
* Test the alignment -> Mapping routines
*
assertEquals(as.getAStr1(), as.getAStr2());
Mapping s1tos2 = as.getMappingFromS1(false);
+ checkMapping(s1tos2,s1,s2);
+ }
+
+ public void checkMapping(Mapping s1tos2,SequenceI _s1,SequenceI _s2)
+ {
System.out.println(s1tos2.getMap().toString());
- for (int i = s2.getStart(); i < s2.getEnd(); i++)
+ for (int i = _s2.getStart(); i < _s2.getEnd(); i++)
{
- System.out.println("Position in s2: " + i
- + " maps to position in s1: " + s1tos2.getPosition(i));
- // TODO fails: getCharAt doesn't allow for the start position??
- // assertEquals(String.valueOf(s2.getCharAt(i)),
- // String.valueOf(s1.getCharAt(s1tos2.getPosition(i))));
+ int p=s1tos2.getPosition(i);
+ char s2c=_s2.getCharAt(i-_s2.getStart());
+ char s1c=_s1.getCharAt(p-_s1.getStart());
+ System.out.println("Position in s2: " + i +s2c
+ + " maps to position in s1: " +p+s1c);
+ assertEquals(s1c,s2c);
}
}
+ @Test(groups = { "Functional" })
+ /**
+ * simple test that mapping from alignment corresponds identical positions.
+ */
+ public void testGetMappingForS1_withLowerCase()
+ {
+ // make one of the sequences lower case
+ SequenceI ns2 = new Sequence(s2);
+ ns2.replace('D', 'd');
+ AlignSeq as = AlignSeq.doGlobalNWAlignment(s1, ns2, AlignSeq.PEP);
+ System.out.println("s1: " + as.getAStr1());
+ System.out.println("s2: " + as.getAStr2());
+
+ // aligned results match
+ assertEquals("ASDFA", as.getAStr1());
+ assertEquals(as.getAStr1(), as.getAStr2().toUpperCase(Locale.ROOT));
+
+ Mapping s1tos2 = as.getMappingFromS1(false);
+ assertEquals("ASdFA",as.getAStr2());
+ // verify mapping is consistent between original all-caps sequences
+ checkMapping(s1tos2,s1,s2);
+ }
@Test(groups = { "Functional" })
public void testExtractGaps()
String ln = null;
while ((ln = worker.getOutputReader().readLine()) != null)
{
- System.out.println(ln);
+ System.out.println("STDOUT: " + ln);
successfulCMDs.add(ln);
}
while ((ln = worker.getErrorReader().readLine()) != null)
{
- System.err.println(ln);
+ System.err.println("STDERR: " + ln);
+ successfulCMDs.add(ln);
}
}
// number of lines expected on STDERR when Jalview starts up normally
// may need to adjust this if Jalview is excessively noisy ?
+ final int STDOUT_SETUPLINES = 50;
final int STDERR_SETUPLINES = 50;
// thread monitors stderr - bails after SETUP_TIMEOUT or when
public void run()
{
String ln = null;
- int count = 0;
+ int stdoutcount = 0;
+ int stderrcount = 0;
try
{
while ((ln = worker.getOutputReader().readLine()) != null)
{
System.out.println(ln);
successfulCMDs.add(ln);
- if (++count > STDERR_SETUPLINES)
+ if (++stdoutcount > STDOUT_SETUPLINES)
+ {
+ break;
+ }
+ }
+ while ((ln = worker.getErrorReader().readLine()) != null)
+ {
+ System.err.println(ln);
+ successfulCMDs.add(ln);
+ if (++stderrcount > STDERR_SETUPLINES)
{
break;
}
import java.io.File;
import java.io.IOException;
import java.io.InputStreamReader;
+import java.nio.file.Files;
import java.nio.file.Path;
import java.nio.file.Paths;
import java.util.ArrayList;
private Worker getJalviewDesktopRunner(boolean withAwt, String cmd,
int timeout)
{
+ return getJalviewDesktopRunner(withAwt, cmd, timeout, true);
+ }
+
+ private Worker getJalviewDesktopRunner(boolean withAwt, String cmd,
+ int timeout, boolean testoutput)
+ {
/*
boolean win = System.getProperty("os.name").indexOf("Win") >= 0;
String pwd = "";
Worker worker = null;
try
{
- cmd = " --testoutput " + cmd;
+ cmd = cmd + (testoutput ? " --testoutput " : "");
System.out.println("Running '" + _cmd + cmd + "'");
ls2_proc = Runtime.getRuntime().exec(_cmd + cmd);
} catch (Throwable e1)
file.delete();
}
+ @Test(
+ groups =
+ { "Functional", "testTask1" },
+ dataProvider = "headlessModeOutputToStdout")
+ public void testHeadlessModeOutputToStdout(String args,
+ String comparisonFile, int timeout)
+ {
+ String cmd = args;
+ File file = new File(comparisonFile);
+ Worker worker = getJalviewDesktopRunner(true, cmd, timeout, false);
+ int b = -1;
+ StringBuilder sb = new StringBuilder();
+ try
+ {
+ while ((b = worker.getOutputReader().read()) != -1)
+ {
+ sb.append(Character.toChars(b));
+ }
+ } catch (IOException e)
+ {
+ Assert.fail("IOException whilst trying to read from jalview process");
+ }
+
+ String comparisonContent = null;
+ try
+ {
+ comparisonContent = new String(Files.readAllBytes(file.toPath()));
+ } catch (IOException e)
+ {
+ Assert.fail("IOException whilst trying to read comparison file");
+ }
+
+ Assert.assertEquals(sb.toString(), comparisonContent,
+ "STDOUT from jalview command did not match the comparison file");
+ }
+
@DataProvider(name = "allInputOperationsData")
public Object[][] getHeadlessModeInputParams()
{
//
};
}
+
+ @DataProvider(name = "headlessModeOutputToStdout")
+ public static Object[][] getHeadlessModeOutputToStdout()
+ {
+ // JBPNote: I'm not clear why need to specify full path for output file
+ // when running tests on build server, but we will keep this patch for now
+ // since it works.
+ // https://issues.jalview.org/browse/JAL-1889?focusedCommentId=21609&page=com.atlassian.jira.plugin.system.issuetabpanels:comment-tabpanel#comment-21609
+ String workingDir = "test/jalview/bin";
+ return new Object[][] {
+ //
+ { "--open=examples/uniref50.fa --output=-",
+ workingDir + "/uniref50-output.fa", TEST_TIMEOUT },
+ { "--open examples/uniref50.fa --output -",
+ workingDir + "/uniref50-output.fa", TEST_TIMEOUT },
+ { "--open examples/uniref50.fa --output=[format=blc]-",
+ workingDir + "/uniref50-output.blc", TEST_TIMEOUT },
+ { "--open examples/uniref50.fa --output - --format blc",
+ workingDir + "/uniref50-output.blc", TEST_TIMEOUT },
+ { "./examples/uniref50.fa --output=-",
+ workingDir + "/uniref50-output.fa", TEST_TIMEOUT },
+ { "./examples/uniref50.fa --output - --format blc",
+ workingDir + "/uniref50-output.blc", TEST_TIMEOUT },
+ // remember you can't use shell wildcards for filenames in a test
+ { "./test/jalview/bin/argparser/testfiles/test1.fa ./test/jalview/bin/argparser/testfiles/test2.fa ./test/jalview/bin/argparser/testfiles/test3.fa --all --output -",
+ workingDir + "/test1-3.fa", TEST_TIMEOUT },
+ // but you can use java wildcards when using an equals sign
+ { "--open=./test/jalview/bin/argparser/testfiles/test*.fa --all --output -",
+ workingDir + "/test1-3.fa", TEST_TIMEOUT },
+ //
+ };
+ }
}
import jalview.gui.JvOptionPane;
import jalview.util.ArrayUtils;
-@Test
public class CommandsTest
{
private static final String testfiles = "test/jalview/bin/argparser/testfiles";
{
Desktop.closeDesktop();
}
-
- public static void callJalviewMain(String[] args) {
- if (Jalview.getInstance()!=null) {
+
+ public static void callJalviewMain(String[] args)
+ {
+ if (Jalview.getInstance() != null)
+ {
Jalview.getInstance().doMain(args);
- } else {
+ }
+ else
+ {
Jalview.main(args);
}
}
public void commandsOpenTest(String cmdLine, boolean cmdArgs,
int numFrames, String[] sequences)
{
- String[] args = (cmdLine + " --gui").split("\\s+");
- callJalviewMain(args);
- Commands cmds = Jalview.getInstance().getCommands();
- Assert.assertNotNull(cmds);
- Assert.assertEquals(cmds.commandArgsProvided(), cmdArgs,
- "Commands were not provided in the args");
- Assert.assertEquals(cmds.argsWereParsed(), cmdArgs,
- "Overall command parse and operation is false");
+ try
+ {
+ String[] args = (cmdLine + " --gui").split("\\s+");
+ callJalviewMain(args);
+ Commands cmds = Jalview.getInstance().getCommands();
+ Assert.assertNotNull(cmds);
+ Assert.assertEquals(cmds.commandArgsProvided(), cmdArgs,
+ "Commands were not provided in the args");
+ Assert.assertEquals(cmds.argsWereParsed(), cmdArgs,
+ "Overall command parse and operation is false");
- Assert.assertEquals(Desktop.getAlignFrames().length, numFrames,
- "Wrong number of AlignFrames");
+ Assert.assertEquals(Desktop.getAlignFrames().length, numFrames,
+ "Wrong number of AlignFrames");
- if (sequences != null)
- {
- Set<String> openedSequenceNames = new HashSet<>();
- AlignFrame[] afs = Desktop.getAlignFrames();
- for (AlignFrame af : afs)
+ if (sequences != null)
{
- openedSequenceNames
- .addAll(af.getViewport().getAlignment().getSequenceNames());
- }
- for (String sequence : sequences)
- {
- Assert.assertTrue(openedSequenceNames.contains(sequence),
- "Sequence '" + sequence
- + "' was not found in opened alignment files: "
- + cmdLine + ".\nOpened sequence names are:\n"
- + String.join("\n", openedSequenceNames));
+ Set<String> openedSequenceNames = new HashSet<>();
+ AlignFrame[] afs = Desktop.getAlignFrames();
+ for (AlignFrame af : afs)
+ {
+ openedSequenceNames.addAll(
+ af.getViewport().getAlignment().getSequenceNames());
+ }
+ for (String sequence : sequences)
+ {
+ Assert.assertTrue(openedSequenceNames.contains(sequence),
+ "Sequence '" + sequence
+ + "' was not found in opened alignment files: "
+ + cmdLine + ".\nOpened sequence names are:\n"
+ + String.join("\n", openedSequenceNames));
+ }
}
- }
- Assert.assertFalse(
- lookForSequenceName("THIS_SEQUENCE_ID_DOESN'T_EXIST"));
+ Assert.assertFalse(
+ lookForSequenceName("THIS_SEQUENCE_ID_DOESN'T_EXIST"));
+ } catch (Exception x)
+ {
+ Assert.fail("Unexpected exception during commandsOpenTest", x);
+ } finally
+ {
+ tearDown();
+
+ }
}
- @Test(groups = "Functional", dataProvider = "structureImageOutputFiles")
+ @Test(
+ groups =
+ { "Functional", "testTask1" },
+ dataProvider = "structureImageOutputFiles")
public void structureImageOutputTest(String cmdLine, String[] filenames)
throws IOException
{
cleanupFiles(filenames);
String[] args = (cmdLine + " --gui").split("\\s+");
- callJalviewMain(args);
- Commands cmds = Jalview.getInstance().getCommands();
- Assert.assertNotNull(cmds);
- File lastFile = null;
- for (String filename : filenames)
+ try
{
- File file = new File(filename);
- Assert.assertTrue(file.exists(), "File '" + filename
- + "' was not created by '" + cmdLine + "'");
- Assert.assertTrue(file.isFile(), "File '" + filename
- + "' is not a file from '" + cmdLine + "'");
- Assert.assertTrue(Files.size(file.toPath()) > 0, "File '" + filename
- + "' has no content from '" + cmdLine + "'");
- // make sure the successive output files get bigger!
- if (lastFile != null)
- Assert.assertTrue(
- Files.size(file.toPath()) > Files.size(lastFile.toPath()));
+ callJalviewMain(args);
+ Commands cmds = Jalview.getInstance().getCommands();
+ Assert.assertNotNull(cmds);
+ File lastFile = null;
+ for (String filename : filenames)
+ {
+ File file = new File(filename);
+ Assert.assertTrue(file.exists(), "File '" + filename
+ + "' was not created by '" + cmdLine + "'");
+ Assert.assertTrue(file.isFile(), "File '" + filename
+ + "' is not a file from '" + cmdLine + "'");
+ Assert.assertTrue(Files.size(file.toPath()) > 0, "File '" + filename
+ + "' has no content from '" + cmdLine + "'");
+ // make sure the successive output files get bigger!
+ if (lastFile != null)
+ Assert.assertTrue(Files.size(file.toPath()) > Files
+ .size(lastFile.toPath()));
+ }
+ } catch (Exception x)
+ {
+ Assert.fail("Unexpected exception during structureImageOutputTest",
+ x);
+ } finally
+ {
+ cleanupFiles(filenames);
+ tearDown();
}
- cleanupFiles(filenames);
- tearDown();
}
@Test(groups = "Functional", dataProvider = "argfileOutputFiles")
{
cleanupFiles(filenames);
String[] args = (cmdLine + " --gui").split("\\s+");
- callJalviewMain(args);
- Commands cmds = Jalview.getInstance().getCommands();
- Assert.assertNotNull(cmds);
- File lastFile = null;
- for (String filename : filenames)
+ try
{
- File file = new File(filename);
- Assert.assertTrue(file.exists(), "File '" + filename
- + "' was not created by '" + cmdLine + "'");
- Assert.assertTrue(file.isFile(), "File '" + filename
- + "' is not a file from '" + cmdLine + "'");
- Assert.assertTrue(Files.size(file.toPath()) > 0, "File '" + filename
- + "' has no content from '" + cmdLine + "'");
- // make sure the successive output files get bigger!
- if (lastFile != null)
- Assert.assertTrue(
- Files.size(file.toPath()) > Files.size(lastFile.toPath()));
+ callJalviewMain(args);
+ Commands cmds = Jalview.getInstance().getCommands();
+ Assert.assertNotNull(cmds);
+ File lastFile = null;
+ for (String filename : filenames)
+ {
+ File file = new File(filename);
+ Assert.assertTrue(file.exists(), "File '" + filename
+ + "' was not created by '" + cmdLine + "'");
+ Assert.assertTrue(file.isFile(), "File '" + filename
+ + "' is not a file from '" + cmdLine + "'");
+ Assert.assertTrue(Files.size(file.toPath()) > 0, "File '" + filename
+ + "' has no content from '" + cmdLine + "'");
+ // make sure the successive output files get bigger!
+ if (lastFile != null)
+ Assert.assertTrue(Files.size(file.toPath()) > Files
+ .size(lastFile.toPath()));
+ }
+ } catch (Exception x)
+ {
+ Assert.fail(
+ "Unexpected exception during argFilesGlobAndSubstitutions",
+ x);
+ } finally
+ {
+ cleanupFiles(filenames);
+ tearDown();
}
- cleanupFiles(filenames);
- tearDown();
}
@DataProvider(name = "structureImageOutputFiles")
{ testfiles + "/structureimage1.png",
testfiles + "/structureimage2.png",
testfiles + "/structureimage3.png" } },
- /*
{ "--headless --noquit --open=./examples/test_fab41.result/sample.a2m "
+ "--structure=./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3.pdb "
+ "--structureimage=" + testfiles + "/structureimage1.png "
{ testfiles + "/structureimage1.png",
testfiles + "/structureimage2.png",
testfiles + "/structureimage3.png" } },
+ /*
*/
//
};
--- /dev/null
+>TEST1/1-4
+AAAA
+>TEST2/1-4
+LLLL
+>TEST3/1-5
+AAARG
--- /dev/null
+>FER_CAPAA/1-97 Ferredoxin
+>FER_CAPAN/1-144 Ferredoxin, chloroplast precursor
+>FER1_SOLLC/1-144 Ferredoxin-1, chloroplast precursor
+>Q93XJ9_SOLTU/1-144 Ferredoxin I precursor
+>FER1_PEA/1-149 Ferredoxin-1, chloroplast precursor
+>Q7XA98_TRIPR/1-152 Ferredoxin I
+>FER1_MESCR/1-148 Ferredoxin-1, chloroplast precursor
+>FER1_SPIOL/1-147 Ferredoxin-1, chloroplast precursor
+>FER3_RAPSA/1-96 Ferredoxin, leaf L-A
+>FER2_ARATH/1-148 Ferredoxin-2, chloroplast precursor
+>FER_BRANA/1-96 Ferredoxin
+>FER1_ARATH/1-148 Ferredoxin-1, chloroplast precursor
+>Q93Z60_ARATH/1-118 At1g10960/T19D16_12
+>FER1_MAIZE/1-150 Ferredoxin-1, chloroplast precursor
+>O80429_MAIZE/1-140 Ferredoxin
+* iteration 1
+-MMMMMMM-M-MMMM
+-AAAAAAA-A-AAAA
+----TTAA-S-SSTA
+----TTTT-T-TTVT
+-------------L-
+-------------G-
+------TT-----S-
+----PPAT-----P-
+-SSSAAAT-A-AAR-
+-VIILLLM-L-LLA-
+-SSSYYSM-S-SSP-
+-AGGGGGG-S-SSA-
+-TTTTTA--A-AAF-
+-MMMAAT--I-IIFA
+-IIIVVMM-V-VVFL
+-SSSSSSA-G-SSSS
+-TTTTTTT-T-TTSM
+-SSSSSAT-S-SSSS
+-FFFFFFF-F-FFSI
+-MLLLMAV-I-LLLL
+-PPPRRPP-R-RRRR
+-RRRTRKK-R-RRA-
+-KKKQQ-P-S-QQA-
+-PPPPP-Q-P-QQP-
+-AAVMVTA-A-TTAA
+-VVVPPPP-P-PPPP
+-TTTMMPP-I-IITP
+-SSSSSMM-S-SSAP
+-LLLVVTM-L-LLVC
+------AA-R-RR-F
+-KKKTAAA-S-SS-S
+-PAATTLL-L-LLAS
+-IIITTPP-P-PPLP
+-PSSKTTS-S-FFPL
+-NNNATNN-A-AAAR
+-VVVFTVT-N-NNAL
+-GGGSKGG-T-TTKR
+-EEENARR-Q-QQVV
+-----F---------
+-----P---------
+-AAAGSAS-S-SSGA
+-LLLFGLL-L-LLIV
+-FFFLFFF-F-FFMA
+-GGGGGGG-G-GGGK
+-LLLLLLL-L-LLRP
+-KKKKKKK-K-KKSL
+-SSSTSST-S-SSAA
+-----V---------
+-AGGSSSG-G-SSSA
+----LTAS-T-TTSP
+----KKSR-A-AARM
+-NRRRRR--R-RRRR
+-GNNGG---G-GG-R
+-GGGDDGG-G-GG-Q
+-KRRLLRG-R-RRRL
+-VIIAAVR-V-VVLL
+-TTTVVTM-T-TTRR
+-CCCAAAT-A-AAAA
+-MMMMMMM-M-MMQQ
+AAAAAAAAAAAAAAA
+SSSSSTAATTTTTTT
+YYYYYYYYYYYYYYY
+KKKKKKKKKKKKKNN
+VVVVVVVVVVVVVVV
+KKKKKKTTKKKKKKK
+LLLLLLLLFFFFFLL
+IIIIVIVVIIIIIII
+TTTTTTTTTTTTTTT
+PPPPPPPPPPPPPPP
+DDEDDEETEEEEEEE
+GGGGGGGGGGGGGGG
+PPPPTPKNEEEEEEE
+IIIIQQQVQLQQQVV
+EEEEEEEEEEEEEEE
+FFFFFFLFVVVVVLL
+DDEEEDEQEEEEEQQ
+CCCCCCCCCCCCCVV
+PPPPPPPPDDDEEPP
+DDDDSDDDDDDEEDD
+DNDDDDDDDDDDDDD
+VVVVVVVVVVVVVVV
+YYYYYYYYYYYYYYY
+IIIIIIIIVVVVVII
+LLLLLLLLLLLLLLL
+DDDDDDDDDDDDDDD
+QQQQHHAAAAAAAQF
+AAAAAAAAAAAAAAA
+EEEEEEEEEEEEEEE
+EEEEEEEEEEEEEEE
+AAEEVVAEAAAAADE
+GGGGGGGGGGGGGGG
+HHHHIIIIIIILLII
+DDDDDEDDDDDDDDD
+LLLLLLLLLLLLLLL
+PPPPPPPPPPPPPPP
+YYYYYYYYYYYYYYF
+SSSSSSSSSSSSSSS
+CCCCCCCCCCCCCCC
+RRRRRRRRRRRRRRR
+AAAAAAAAAAAAAAA
+GGGGGGGGGGGGGGG
+SSSSSSSSSSSSSSS
+CCCCCCCCCCCCCCC
+SSSSSSSSSSSSSSS
+SSSSSSSSSSSSSSS
+CCCCCCCCCCCCCCC
+AAAAAAAAAAAAAAA
+GGGGGGGGGGGGGGG
+KKKKKKKKKKKKKKK
+IIVVVVVLVVVVVVV
+AATTVVTKVVVVVVV
+GGAAGNSTSSSSSSS
+GGGGGGGGGGGGGGG
+AASTENSSSSFSSSS
+VVVVVVVLVVVIIVV
+DDDDDNNNDDDDDDD
+QQQQQQQQQQQQQQQ
+TTSSSEDDSSSSSSS
+DDDDDDDDDDDDDDD
+GGGGGGGQQQEQQQQ
+NNNKSSSSSSSSSSS
+FFFFFFFFFFFFFYF
+LLLLLLLLLLLLLLL
+DDDDDDDDDDDDDDN
+DDEDDDDDDDDDDDD
+DDDDEEDDDEDE-GN
+QQQQQQQQQQQQ-QQ
+LLEEIIIIIIIM-IV
+EEAAEEKDAGAS-AA
+EEAAAGEEEEEE-DD
+GGGGGGGGGGGG-GG
+WWFFFWWWFFFY-WW
+VVVVVVVVVVVV-VV
+LLLLLLLLLLLL-LL
+TTTTTTTTTTTT-TT
+CCCCCCCCCCCC-CC
+VVVVVVVAAAAV-HA
+AAAAAAAAAAAA-AA
+YYYYYFYYYYYY-YY
+PPPPPPPPPPPP-PP
+QQKKTTTVTTTT-TT
+SSGCSSGSSSSS-SS
+DDDDDDDDDDDD-DD
+VVVVVVVVVVVV-VV
+TTTTVTTTTTTV-VV
+IIIIIIIIIIII-II
+EEEEEEEEEEEE-EE
+TTTTTTTTTTTT-TT
+HHHHHHHHHHHH-HH
+KKKKKKKKRKKK-KK
+EEEEEEEEEEEE-EE
+AAEEEEEEEEEE-ED
+EEEEDEEEDDEA-ED
+LLLLLLLLMILI-LL
+VVTTTTTTVVVM-TL
+GGAAAAAA-----G-
+-------------A-
+*
--- /dev/null
+>FER_CAPAA/1-97 Ferredoxin
+-----------------------------------------------------------ASYKVKLITPDGP
+IEFDCPDDVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLEEGWVLTCVAYPQSDV
+TIETHKEAELVG-
+>FER_CAPAN/1-144 Ferredoxin, chloroplast precursor
+MA------SVSATMISTSFMPRKPAVTSL-KPIPNVGE--ALFGLKS-A--NGGKVTCMASYKVKLITPDGP
+IEFDCPDNVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLEEGWVLTCVAYPQSDV
+TIETHKEAELVG-
+>FER1_SOLLC/1-144 Ferredoxin-1, chloroplast precursor
+MA------SISGTMISTSFLPRKPAVTSL-KAISNVGE--ALFGLKS-G--RNGRITCMASYKVKLITPEGP
+IEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGSVDQSDGNFLDEDQEAAGFVLTCVAYPKGDV
+TIETHKEEELTA-
+>Q93XJ9_SOLTU/1-144 Ferredoxin I precursor
+MA------SISGTMISTSFLPRKPVVTSL-KAISNVGE--ALFGLKS-G--RNGRITCMASYKVKLITPDGP
+IEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGKFLDDDQEAAGFVLTCVAYPKCDV
+TIETHKEEELTA-
+>FER1_PEA/1-149 Ferredoxin-1, chloroplast precursor
+MATT---PALYGTAVSTSFLRTQPMPMSV-TTTKAFSN--GFLGLKT-SLKRGDLAVAMASYKVKLVTPDGT
+QEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDDEQIEAGFVLTCVAYPTSDV
+VIETHKEEDLTA-
+>Q7XA98_TRIPR/1-152 Ferredoxin I
+MATT---PALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGFGLKSVSTKRGDLAVAMATYKVKLITPEGP
+QEFDCPDDVYILDHAEEVGIELPYSCRAGSCSSCAGKVVNGNVNQEDGSFLDDEQIEGGWVLTCVAFPTSDV
+TIETHKEEELTA-
+>FER1_MESCR/1-148 Ferredoxin-1, chloroplast precursor
+MAAT--TAALSGATMSTAFAPK--TPPMTAALPTNVGR--ALFGLKS-SASR-GRVTAMAAYKVTLVTPEGK
+QELECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVTSGSVNQDDGSFLDDDQIKEGWVLTCVAYPTGDV
+TIETHKEEELTA-
+>FER1_SPIOL/1-147 Ferredoxin-1, chloroplast precursor
+MAAT--TTTMMG--MATTFVPKPQAPPMMAALPSNTGR--SLFGLKT-GSR--GGRMTMAAYKVTLVTPTGN
+VEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDV
+TIETHKEEELTA-
+>FER3_RAPSA/1-96 Ferredoxin, leaf L-A
+-----------------------------------------------------------ATYKVKFITPEGE
+QEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQIAEGFVLTCAAYPTSDV
+TIETHREEDMV--
+>FER2_ARATH/1-148 Ferredoxin-2, chloroplast precursor
+MAST----ALSSAIVGTSFIRRSPAPISLRSLPSANTQ--SLFGLKS-GTARGGRVTAMATYKVKFITPEGE
+LEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDV
+TIETHKEEDIV--
+>FER_BRANA/1-96 Ferredoxin
+-----------------------------------------------------------ATYKVKFITPEGE
+QEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFVDQSDESFLDDDQIAEGFVLTCAAYPTSDV
+TIETHKEEELV--
+>FER1_ARATH/1-148 Ferredoxin-1, chloroplast precursor
+MAST----ALSSAIVSTSFLRRQQTPISLRSLPFANTQ--SLFGLKS-STARGGRVTAMATYKVKFITPEGE
+QEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDV
+VIETHKEEAIM--
+>Q93Z60_ARATH/1-118 At1g10960/T19D16_12
+MAST----ALSSAIVSTSFLRRQQTPISLRSLPFANTQ--SLFGLKS-STARGGRVTAMATYKVKFITPEGE
+QEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDD-------------------
+-------------
+>FER1_MAIZE/1-150 Ferredoxin-1, chloroplast precursor
+MATVLGSPRAPAFFFSSSSLRAAPAPTAV--ALPAAKV--GIMGRSA-SSRR--RLRAQATYNVKLITPEGE
+VELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDV
+VIETHKEEELTGA
+>O80429_MAIZE/1-140 Ferredoxin
+MAAT---------ALSMSILR---APPPCFSSPLRLRV--AVAKPLA-APMRRQLLRAQATYNVKLITPEGE
+VELQVPDDVYILDFAEEEGIDLPFSCRAGSCSSCAGKVVSGSVDQSDQSFLNDNQVADGWVLTCAAYPTSDV
+VIETHKEDDLL--
verifyPAEmatrix(seq, aa, 0, 0, 4);
// test clustering
- paematrix.setGroupSet(GroupSet.makeGroups(paematrix, 0.1f, false));
+ paematrix.setGroupSet(GroupSet.makeGroups(paematrix, false,0.1f, false));
// remap - test the MappableContactMatrix.liftOver method
SequenceI newseq = new Sequence("Seq", "ASDQEASDQEASDQE");
{
Sequence origSeq = new Sequence("MYSEQ", "THISISASEQ");
Sequence toSeq = new Sequence("MYSEQ", "THISISASEQ");
+ origSeq.setDescription("DESCRIPTION");
origSeq.addDBRef(new DBRefEntry("UNIPROT", "0", "Q12345", null, true));
+
+ toSeq.transferAnnotation(origSeq, null);
+ assertEquals("DESCRIPTION",toSeq.getDescription());
+ toSeq = new Sequence("MYSEQ", "THISISASEQ");
+ toSeq.setDescription("unchanged");
toSeq.transferAnnotation(origSeq, null);
+ assertEquals("unchanged",toSeq.getDescription());
+
assertTrue(toSeq.getDBRefs().size() == 1);
assertTrue(toSeq.getDBRefs().get(0).isCanonical());
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.gui;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertTrue;
+
+import java.io.File;
+
+import org.testng.annotations.AfterMethod;
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.BeforeMethod;
+import org.testng.annotations.DataProvider;
+import org.testng.annotations.Test;
+
+import jalview.bin.Cache;
+import jalview.bin.Jalview;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.SequenceI;
+import jalview.gui.StructureViewer.ViewerType;
+import jalview.io.DataSourceType;
+import jalview.io.FileLoader;
+import jalview.structure.StructureImportSettings.TFType;
+
+public class AnnotationLabelsTest2
+{
+ @BeforeClass(alwaysRun = true)
+ public static void setUpBeforeClass() throws Exception
+ {
+ if (Desktop.instance != null)
+ Desktop.instance.closeAll_actionPerformed(null);
+
+ setUpJvOptionPane();
+ /*
+ * use read-only test properties file
+ */
+ Cache.loadProperties("test/jalview/io/testProps.jvprops");
+ Jalview.main(new String[] { "--nonews", "--nosplash", });
+ }
+
+ @AfterMethod(alwaysRun = true)
+ public void tearDown()
+ {
+ if (Desktop.instance != null)
+ Desktop.instance.closeAll_actionPerformed(null);
+ }
+
+ /**
+ * configure (read-only) properties for test to ensure Consensus is computed
+ * for colour Above PID testing
+ */
+ @BeforeMethod(alwaysRun = true)
+ public void setUp()
+ {
+ Cache.loadProperties("test/jalview/io/testProps.jvprops");
+ Cache.applicationProperties.setProperty("SHOW_IDENTITY",
+ Boolean.TRUE.toString());
+
+ }
+
+ public static void setUpJvOptionPane()
+ {
+ JvOptionPane.setInteractiveMode(false);
+ JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
+ }
+
+ @Test(
+ groups =
+ { "Functional", "testTask1" },
+ dataProvider = "openFilesWithIdWidthChanges")
+ public void testIdWidthChanges(String alignmentFilename, boolean wrap,
+ int idWidth1min, int idWidth1max, int manualWidth,
+ String structureFilename, String paeFilename,
+ boolean secondaryStructureView, TFType temperatureFactorType,
+ ViewerType viewerType, int idWidth2min, int idWidth2max)
+ {
+ AlignFrame af = new FileLoader()
+ .LoadFileWaitTillLoaded(alignmentFilename, DataSourceType.FILE);
+ try
+ {
+ Thread.sleep(200); // to allow alignment annotations to open
+ } catch (InterruptedException e)
+ {
+ // TODO Auto-generated catch block
+ e.printStackTrace();
+ }
+ AlignViewport av = af.getCurrentView();
+
+ int idWidth = 0;
+
+ idWidth = av.getIdWidth();
+ assertTrue(idWidth > idWidth1min,
+ "idWidth (" + idWidth + ") is not greater than " + idWidth1min);
+ assertTrue(idWidth < idWidth1max,
+ "idWidth (" + idWidth + ") is not narrower than" + idWidth1max);
+
+ // set wrap
+ if (wrap)
+ {
+ af.setWrapFormat(true, false);
+ idWidth = av.getIdWidth();
+ assertTrue(idWidth > idWidth1min, "After wrap idWidth (" + idWidth
+ + ") is not greater than " + idWidth1min);
+ assertTrue(idWidth < idWidth1max, "After wrap idWidth (" + idWidth
+ + ") is not narrower than" + idWidth1max);
+ }
+
+ AlignmentI al = av.getAlignment();
+ SequenceI s = al.getSequenceAt(0);
+ AlignmentPanel ap = af.alignPanel;
+
+ File structureFile = new File(structureFilename);
+ File paeFile = new File(paeFilename);
+
+ StructureViewer sv = StructureChooser.openStructureFileForSequence(null,
+ null, ap, s, false, structureFile.getAbsolutePath(),
+ temperatureFactorType, paeFile.getAbsolutePath(), true,
+ secondaryStructureView, false, viewerType);
+ // give time for annotations to open
+ try
+ {
+ Thread.sleep(200); // to allow alignment annotations to open
+ } catch (InterruptedException e)
+ {
+ // TODO Auto-generated catch block
+ e.printStackTrace();
+ }
+
+ // idWidth = ap.getIdPanel().getWidth();
+ idWidth = av.getIdWidth();
+ assertTrue(idWidth > idWidth2min,
+ "idWidth (" + idWidth + ") is not greater than " + idWidth2min);
+ assertTrue(idWidth < idWidth2max,
+ "idWidth (" + idWidth + ") is not narrower than" + idWidth2max);
+ }
+
+ @Test(
+ groups =
+ { "Functional", "testTask1" },
+ dataProvider = "openFilesWithIdWidthChanges")
+ public void testIdWidthNoChanges(String alignmentFilename, boolean wrap,
+ int idWidth1min, int idWidth1max, int manualWidth,
+ String structureFilename, String paeFilename,
+ boolean secondaryStructureView, TFType temperatureFactorType,
+ ViewerType viewerType, int idWidth2min, int idWidth2max)
+ {
+ AlignFrame af = new FileLoader()
+ .LoadFileWaitTillLoaded(alignmentFilename, DataSourceType.FILE);
+ try
+ {
+ Thread.sleep(200); // to allow alignment annotations to open
+ } catch (InterruptedException e)
+ {
+ // TODO Auto-generated catch block
+ e.printStackTrace();
+ }
+ AlignViewport av = af.getCurrentView();
+
+ int idWidth = 0;
+
+ idWidth = av.getIdWidth();
+ assertTrue(idWidth > idWidth1min,
+ "idWidth (" + idWidth + ") is not greater than " + idWidth1min);
+ assertTrue(idWidth < idWidth1max,
+ "idWidth (" + idWidth + ") is not narrower than" + idWidth1max);
+
+ AlignmentI al = av.getAlignment();
+ SequenceI s = al.getSequenceAt(0);
+ AlignmentPanel ap = af.alignPanel;
+
+ // set width manually
+ av.setIdWidth(manualWidth);
+ ap.validateAnnotationDimensions(false);
+ ap.paintAlignment(true, false);
+ ap.getIdPanel().getIdCanvas().setManuallyAdjusted(true);
+
+ idWidth = av.getIdWidth();
+ assertEquals(idWidth, manualWidth,
+ "idWidth is not set to the manually set width " + manualWidth);
+
+ File structureFile = new File(structureFilename);
+ File paeFile = new File(paeFilename);
+
+ StructureViewer sv = StructureChooser.openStructureFileForSequence(null,
+ null, ap, s, false, structureFile.getAbsolutePath(),
+ temperatureFactorType, paeFile.getAbsolutePath(), false,
+ secondaryStructureView, false, viewerType);
+
+ idWidth = ap.getIdPanel().getWidth();// av.getIdWidth();
+ idWidth = av.getIdWidth();
+ assertEquals(idWidth, manualWidth,
+ "idWidth is not set to the manually set width " + manualWidth
+ + " after adding structure annotations");
+ assertFalse(idWidth > idWidth2min,
+ "idWidth (" + idWidth + ") is greater than " + idWidth2min);
+ }
+
+ @DataProvider(name = "openFilesWithIdWidthChanges")
+ public Object[][] openFilesWithIdWidthChanges()
+ {
+ /*
+ String alignmentFilename,
+ boolean wrap,
+ int idWidth1min,
+ int idWidth1max,
+ int manualWidth, // ignored by testIdWidthChanges()
+ String structureFilename,
+ String paeFilename,
+ boolean secondaryStructureView,
+ TFType temperatureFactorType,
+ ViewerType viewerType,
+ int idWidth2min,
+ int idWidth2max,
+ */
+ return new Object[][] {
+ //
+ /*
+ */
+ { "./test/files/annotation_label_width/sample.a2m", false, 50, 70,
+ 100,
+ "./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3.pdb",
+ "./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3_scores.json",
+ true, TFType.PLDDT, null, 115, 130 },
+ { "./test/files/annotation_label_width/sample.a2m", true, 50, 70,
+ 100,
+ "./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3.pdb",
+ "./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3_scores.json",
+ true, TFType.PLDDT, null, 115, 130 },
+ /*
+ */
+ };
+ }
+
+}
*/
package jalview.io;
+import jalview.datamodel.SequenceI;
import jalview.gui.JvOptionPane;
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertNotNull;
+
import java.io.File;
+import java.io.IOException;
import org.testng.annotations.AfterClass;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
+import fr.orsay.lri.varna.utils.RNAMLParser;
+import groovy.lang.Sequence;
+
public class RNAMLfileTest
{
}
+ @Test(groups= {"Functional"})
+ public void testRnamlSeqImport() throws IOException
+ {
+ RnamlFile parser = new RnamlFile("examples/testdata/7WKP-rna1.xml", DataSourceType.FILE);
+ SequenceI[] seqs = parser.getSeqsAsArray();
+ assertNotNull(seqs);
+ assertEquals(seqs.length,1);
+ assertEquals(seqs[0].getEnd()-seqs[0].getStart()+1,seqs[0].getSequence().length);
+ }
+
}
*/
package jalview.io.cache;
+import java.lang.reflect.InvocationTargetException;
import java.util.LinkedHashSet;
+import javax.swing.SwingUtilities;
+
import org.junit.Assert;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
try
{
- // This delay is essential to prevent the
- // assertion below from executing before
- // swing thread finishes updating the combo-box
- Thread.sleep(350);
- } catch (InterruptedException e)
+ // fix for JAL-4153
+ // This delay is essential to prevent the assertion below from executing
+ // before swing thread finishes updating the combo-box
+ SwingUtilities.invokeAndWait(() -> {
+ try
+ {
+ Thread.sleep(1);
+ } catch (InterruptedException e)
+ {
+ e.printStackTrace();
+ }
+ });
+ } catch (InvocationTargetException | InterruptedException e)
{
e.printStackTrace();
}
cacheBox.addItem(testInput);
cacheBox.setSelectedItem(testInput);
cacheBox.updateCache();
+
try
{
- // This delay is to let
- // cacheBox.updateCache() finish updating the cache
- Thread.sleep(350);
- } catch (InterruptedException e)
+ // fix for JAL-4153
+ // This delay is to let cacheBox.updateCache() finish updating the cache
+ SwingUtilities.invokeAndWait(() -> {
+ try
+ {
+ Thread.sleep(1);
+ } catch (InterruptedException e)
+ {
+ e.printStackTrace();
+ }
+ });
+ } catch (InvocationTargetException | InterruptedException e)
{
e.printStackTrace();
}
{
paevals[i][j] = ((i - j < 2)
|| ((i > 1 && i < 5) && (j > 1 && i < 5))) ? 1 : 0f;
- paevals[j][i] = paevals[i][j];
+ paevals[j][i] = -paevals[i][j];
}
}
PAEContactMatrix dummyMat = new PAEContactMatrix(sq, paevals);
float[][] vals = ContactMatrix.fromFloatStringToContacts(content,
sq.getLength(), sq.getLength());
assertEquals(vals[3][4], paevals[3][4]);
- dummyMat.setGroupSet(GroupSet.makeGroups(dummyMat, 0.5f, false));
+ assertEquals(vals[4][3], paevals[4][3]);
+ dummyMat.setGroupSet(GroupSet.makeGroups(dummyMat, false,0.5f, false));
Assert.assertNotSame(dummyMat.getNewick(), "");
AlignmentAnnotation paeCm = sq.addContactList(dummyMat);
al.addAnnotation(paeCm);
SiftsSettings.setCacheThresholdInDays("2");
SiftsSettings.setFailSafePIDThreshold("70");
PDBfile pdbFile;
+
pdbFile = new PDBfile(false, false, false,
"test/jalview/io/" + testPDBId + ".pdb", DataSourceType.FILE);
+ // TODO: this uses a network connection - we should mock the sifts testPDBId.xml.gz
siftsClient = new SiftsClient(pdbFile);
}
{
siftsClient = null;
}
+
+ @Test(groups= {"Functional"})
+ public void testSIFTsDownloadURL() {
+ String expectedUrl = "https://ftp.ebi.ac.uk/pub/databases/msd/sifts/split_xml/xy/1xyz.sifts.xml.gz";
+ Assert.assertEquals(SiftsClient.getDownloadUrlFor("1xyz.sifts.xml.gz"), expectedUrl);
+ }
@Test(groups = { "Network" })
public void getSIFTsFileTest() throws SiftsException, IOException
long t1 = siftsFile.lastModified();
// re-read file should be returned from cache
- siftsFile = SiftsClient.downloadSiftsFile(testPDBId);
+ siftsFile = SiftsClient.getSiftsFile(testPDBId);
FileAssert.assertFile(siftsFile);
long t2 = siftsFile.lastModified();
assertEquals(t1, t2);
{
SequenceI invalidTestSeq = new Sequence("testSeq", "ABCDEFGH");
DBRefEntry invalidDBRef = new DBRefEntry();
- invalidDBRef.setAccessionId("BLAR");
+ invalidDBRef.setAccessionId("BLAR"); // note no version is set, so also invalid
invalidTestSeq.addDBRef(invalidDBRef);
siftsClient.getValidSourceDBRef(invalidTestSeq);
}
--- /dev/null
+{
+ "name": "Jalview",
+ "description": "Jalview is a free program for multiple sequence alignment editing, visualisation and analysis. Use it to view and edit sequence alignments, analyse them with phylogenetic trees and principal components analysis (PCA) plots and explore molecular structures and annotation.",
+ "homepage": "https://www.jalview.org/",
+ "biotoolsID": "Jalview",
+ "biotoolsCURIE": "biotools:Jalview",
+ "version": [
+ "2.11.2.7"
+ ],
+ "relation": [
+ {
+ "biotoolsID": "jabaws",
+ "type": "uses"
+ },
+ {
+ "biotoolsID": "chimera",
+ "type": "uses"
+ },
+ {
+ "biotoolsID": "chimerax",
+ "type": "uses"
+ },
+ {
+ "biotoolsID": "pymol",
+ "type": "uses"
+ },
+ {
+ "biotoolsID": "bioconda",
+ "type": "includedIn"
+ },
+ {
+ "biotoolsID": "3d-beacons",
+ "type": "uses"
+ },
+ {
+ "biotoolsID": "uniprot",
+ "type": "uses"
+ },
+ {
+ "biotoolsID": "pfam",
+ "type": "uses"
+ },
+ {
+ "biotoolsID": "ensembl",
+ "type": "uses"
+ },
+ {
+ "biotoolsID": "pdb",
+ "type": "uses"
+ },
+ {
+ "biotoolsID": "rfam",
+ "type": "uses"
+ }
+ ],
+ "function": [
+ {
+ "operation": [
+ {
+ "uri": "http://edamontology.org/operation_0564",
+ "term": "Sequence visualisation"
+ },
+ {
+ "uri": "http://edamontology.org/operation_0324",
+ "term": "Phylogenetic tree analysis"
+ },
+ {
+ "uri": "http://edamontology.org/operation_3081",
+ "term": "Sequence alignment editing"
+ }
+ ],
+ "input": [
+ {
+ "data": {
+ "uri": "http://edamontology.org/data_0863",
+ "term": "Sequence alignment"
+ },
+ "format": [
+ {
+ "uri": "http://edamontology.org/format_1939",
+ "term": "GFF3-seq"
+ },
+ {
+ "uri": "http://edamontology.org/format_1982",
+ "term": "ClustalW format"
+ },
+ {
+ "uri": "http://edamontology.org/format_1961",
+ "term": "Stockholm format"
+ },
+ {
+ "uri": "http://edamontology.org/format_1984",
+ "term": "FASTA-aln"
+ },
+ {
+ "uri": "http://edamontology.org/format_1938",
+ "term": "GFF2-seq"
+ },
+ {
+ "uri": "http://edamontology.org/format_1929",
+ "term": "FASTA"
+ },
+ {
+ "uri": "http://edamontology.org/format_1948",
+ "term": "nbrf/pir"
+ },
+ {
+ "uri": "http://edamontology.org/format_3774",
+ "term": "BioJSON (Jalview)"
+ },
+ {
+ "uri": "http://edamontology.org/format_1997",
+ "term": "PHYLIP format"
+ },
+ {
+ "uri": "http://edamontology.org/format_3313",
+ "term": "BLC"
+ },
+ {
+ "uri": "http://edamontology.org/format_3311",
+ "term": "RNAML"
+ },
+ {
+ "uri": "http://edamontology.org/format_1947",
+ "term": "GCG MSF"
+ },
+ {
+ "uri": "http://edamontology.org/format_3015",
+ "term": "Pileup"
+ },
+ {
+ "uri": "http://edamontology.org/format_1477",
+ "term": "mmCIF"
+ },
+ {
+ "uri": "http://edamontology.org/format_3016",
+ "term": "VCF"
+ },
+ {
+ "uri": "http://edamontology.org/format_1915",
+ "term": "Format"
+ }
+ ]
+ },
+ {
+ "data": {
+ "uri": "http://edamontology.org/data_0886",
+ "term": "Structure alignment"
+ },
+ "format": [
+ {
+ "uri": "http://edamontology.org/format_1476",
+ "term": "PDB"
+ }
+ ]
+ }
+ ],
+ "output": [
+ {
+ "data": {
+ "uri": "http://edamontology.org/data_0863",
+ "term": "Sequence alignment"
+ },
+ "format": [
+ {
+ "uri": "http://edamontology.org/format_1948",
+ "term": "nbrf/pir"
+ },
+ {
+ "uri": "http://edamontology.org/format_3464",
+ "term": "JSON"
+ },
+ {
+ "uri": "http://edamontology.org/format_1961",
+ "term": "Stockholm format"
+ },
+ {
+ "uri": "http://edamontology.org/format_1929",
+ "term": "FASTA"
+ },
+ {
+ "uri": "http://edamontology.org/format_1997",
+ "term": "PHYLIP format"
+ },
+ {
+ "uri": "http://edamontology.org/format_3313",
+ "term": "BLC"
+ },
+ {
+ "uri": "http://edamontology.org/format_3774",
+ "term": "BioJSON (Jalview)"
+ },
+ {
+ "uri": "http://edamontology.org/format_1947",
+ "term": "GCG MSF"
+ },
+ {
+ "uri": "http://edamontology.org/format_3015",
+ "term": "Pileup"
+ },
+ {
+ "uri": "http://edamontology.org/format_1982",
+ "term": "ClustalW format"
+ }
+ ]
+ },
+ {
+ "data": {
+ "uri": "http://edamontology.org/data_2884",
+ "term": "Plot"
+ },
+ "format": [
+ {
+ "uri": "http://edamontology.org/format_3603",
+ "term": "PNG"
+ },
+ {
+ "uri": "http://edamontology.org/format_2331",
+ "term": "HTML"
+ },
+ {
+ "uri": "http://edamontology.org/format_3466",
+ "term": "EPS"
+ },
+ {
+ "uri": "http://edamontology.org/format_3604",
+ "term": "SVG"
+ },
+ {
+ "uri": "http://edamontology.org/format_1915",
+ "term": "Format"
+ }
+ ]
+ }
+ ],
+ "note": "Other Input formats:\nAMSA (.amsa);\nJnetFile (.concise, .jnet);\nPFAM (.pfam);\nSubstitution matrix (.matrix);\nJalview Project File (.jvp);\nJalview Feature File (.features, .jvfeatures);\nJalview Annotations File (.annotations, .jvannotations);\n\n...\nOther Output formats:\nPFAM (.pfam);\nBioJS (.biojs) (interactive HTML/Javascript);\nJalview Project File (.jvp);"
+ }
+ ],
+ "toolType": [
+ "Desktop application"
+ ],
+ "topic": [
+ {
+ "uri": "http://edamontology.org/topic_0080",
+ "term": "Sequence analysis"
+ },
+ {
+ "uri": "http://edamontology.org/topic_0092",
+ "term": "Data visualisation"
+ }
+ ],
+ "operatingSystem": [
+ "Linux",
+ "Windows",
+ "Mac"
+ ],
+ "license": "GPL-3.0",
+ "maturity": "Mature",
+ "cost": "Free of charge",
+ "accessibility": "Open access",
+ "elixirPlatform": [
+ "Tools"
+ ],
+ "elixirNode": [
+ "UK"
+ ],
+ "link": [
+ {
+ "url": "https://discourse.jalview.org/",
+ "type": [
+ "Discussion forum"
+ ]
+ },
+ {
+ "url": "https://issues.jalview.org/",
+ "type": [
+ "Issue tracker"
+ ]
+ },
+ {
+ "url": "https://www.jalview.org/development/jalview_develop/",
+ "type": [
+ "Other"
+ ],
+ "note": "Latest development version"
+ },
+ {
+ "url": "https://source.jalview.org/crucible/browse/jalview",
+ "type": [
+ "Repository"
+ ]
+ },
+ {
+ "url": "https://twitter.com/Jalview",
+ "type": [
+ "Social media"
+ ],
+ "note": "Twitter feed"
+ },
+ {
+ "url": "https://www.youtube.com/channel/UCIjpnvZB770yz7ftbrJ0tfw",
+ "type": [
+ "Social media"
+ ],
+ "note": "YouTube training videos"
+ }
+ ],
+ "download": [
+ {
+ "url": "https://www.jalview.org/download",
+ "type": "Downloads page"
+ },
+ {
+ "url": "https://www.jalview.org/download/source/",
+ "type": "Source code"
+ },
+ {
+ "url": "https://www.jalview.org/download/?os=all",
+ "type": "Binaries",
+ "note": "Binaries for all platforms"
+ },
+ {
+ "url": "https://www.jalview.org/favicon.svg",
+ "type": "Icon"
+ },
+ {
+ "url": "https://www.jalview.org/download/other/jar/",
+ "type": "Binaries",
+ "note": "Executable JAR file"
+ }
+ ],
+ "documentation": [
+ {
+ "url": "https://www.jalview.org/about/citation",
+ "type": [
+ "Citation instructions"
+ ]
+ },
+ {
+ "url": "https://www.jalview.org/training/",
+ "type": [
+ "Training material"
+ ],
+ "note": "Hands-on exercises, Training courses and Training videos"
+ },
+ {
+ "url": "https://www.jalview.org/help/faq",
+ "type": [
+ "FAQ"
+ ]
+ },
+ {
+ "url": "https://www.jalview.org/help/documentation/",
+ "type": [
+ "User manual"
+ ]
+ }
+ ],
+ "publication": [
+ {
+ "doi": "10.1093/bioinformatics/btp033",
+ "metadata": {
+ "title": "Jalview Version 2-A multiple sequence alignment editor and analysis workbench",
+ "abstract": "Summary: Jalview Version 2 is a system for interactive WYSIWYG editing, analysis and annotation of multiple sequence alignments. Core features include keyboard and mouse-based editing, multiple views and alignment overviews, and linked structure display with Jmol. Jalview 2 is available in two forms: a lightweight Java applet for use in web applications, and a powerful desktop application that employs web services for sequence alignment, secondary structure prediction and the retrieval of alignments, sequences, annotation and structures from public databases and any DAS 1.53 compliant sequence or annotation server. © 2009 The Author(s).",
+ "date": "2009-05-07T00:00:00Z",
+ "citationCount": 5999,
+ "authors": [
+ {
+ "name": "Waterhouse A.M."
+ },
+ {
+ "name": "Procter J.B."
+ },
+ {
+ "name": "Martin D.M.A."
+ },
+ {
+ "name": "Clamp M."
+ },
+ {
+ "name": "Barton G.J."
+ }
+ ],
+ "journal": "Bioinformatics"
+ }
+ }
+ ],
+ "credit": [
+ {
+ "name": "Jim Procter",
+ "url": "http://www.lifesci.dundee.ac.uk/people/jim-procter",
+ "orcidid": "https://orcid.org/0000-0002-7865-7382",
+ "typeEntity": "Person",
+ "typeRole": [
+ "Primary contact"
+ ]
+ },
+ {
+ "name": "Geoff Barton",
+ "url": "https://www.lifesci.dundee.ac.uk/people/geoff-barton",
+ "orcidid": "https://orcid.org/0000-0002-9014-5355"
+ }
+ ],
+ "owner": "ben_s",
+ "additionDate": "2019-02-13T17:01:40Z",
+ "lastUpdate": "2023-07-22T09:24:44.755337Z",
+ "editPermission": {
+ "type": "group",
+ "authors": [
+ "ben_s",
+ "jimprocter"
+ ]
+ },
+ "validated": 1,
+ "homepage_status": 0,
+ "elixir_badge": 0
+}
--- /dev/null
+This is the JSON representation of the latest Jalview release's record on bio.tools
+
+To update:
+1. go to https://bio.tools/Jalview
+2. log in and scroll down to the 'Update Record' button to open the edit interface.
+3. Make any chances to the entry - press Validate to ensure all is good
+4. Select the JSON tab and copy paste into
+
+``
+cat > utils/biotools/Jalview.json
+``
+
+Thanks to Herve Menager for the tutorial on storing bio.tools records with the tool's software repository at [CoFest 2023](https://www.open-bio.org/events/bosc-2023/obf-bosc-collaborationfest-2023)
\ No newline at end of file
--- /dev/null
+#!/usr/bin/env bash
+
+###############################
+# Wrapper for Jalview
+#
+# 2023-08-16 Jalview 2.11.3.0 has new command line arguments
+# Old command line arguments are currently detected and actioned
+# but are no longer supported and will be removed at a later date.
+#
+# See
+# Jalview -> Help -> Documentation -> Command Line -> introduction and reference
+# or
+# https://www.jalview.org/help/html/features/clarguments.html
+# for details of the new command line arguments.
+#
+# Note, in order to run commandline-only calls use
+# --headless
+#
+# By default, this wrapper executes java -version to determine the JRE version
+# Set JALVIEW_JRE=j1.8 or JALVIEW_JRE=j11 to skip the version check.
+#
+# By default, this wrapper does NOT restrict the memory consumption of Jalview.
+# Set eg. JALVIEW_MAXMEM=1g to set the maximal memory of Jalview's VM
+#
+# This script is maintained in the Jalview repository in utils/conda/jalview.sh
+###############################
+
+declare -a ARGS=("${@}")
+ARG1=$1
+
+# this function is because there's no readlink -f in Darwin/macOS
+function readlinkf() {
+ FINDFILE="$1"
+ FILE="${FINDFILE}"
+ PREVFILE=""
+ C=0
+ MAX=100 # just in case we end up in a loop
+ FOUND=0
+ while [ "${C}" -lt "${MAX}" -a "${FILE}" != "${PREVFILE}" -a "${FOUND}" -ne 1 ]; do
+ PREVFILE="${FILE}"
+ FILE="$(readlink "${FILE}")"
+ if [ -z "${FILE}" ]; then
+ # the readlink is empty means we've arrived at the script, let's canonicalize with pwd
+ FILE="$(cd "$(dirname "${PREVFILE}")" &> /dev/null && pwd -P)"/"$(basename "${PREVFILE}")"
+ FOUND=1
+ elif [ "${FILE#/}" = "${FILE}" ]; then
+ # FILE is not an absolute path link, we need to add the relative path to the previous dir
+ FILE="$(dirname "${PREVFILE}")/${FILE}"
+ fi
+ C=$((C+1))
+ done
+ if [ "${FOUND}" -ne 1 ]; then
+ echo "Could not determine path to actual file '$(basename "${FINDFILE}")'" >&2
+ exit 1
+ fi
+ echo "${FILE}"
+}
+
+ISMACOS=0
+if [ "$( uname -s )" = "Darwin" ]; then
+ ISMACOS=1
+fi
+
+# check for headless mode
+HEADLESS=0
+GUI=0
+HELP=0
+DEBUG=0
+for RAWARG in "${@}"; do
+ ARG="${RAWARG%%=*}"
+ case "${ARG}" in
+ --headless|--output|--image|--structureimage)
+ HEADLESS=1
+ ;;
+ --help|--help-*|--version)
+ HELP=1
+ ;;
+ --gui)
+ GUI=1
+ ;;
+ --debug)
+ DEBUG=1
+ ;;
+ esac
+
+ if [ "${HELP}" = 1 ]; then
+ # --help takes precedence
+ HEADLESS=1
+ GUI=0
+ elif [ "${GUI}" = 1 ]; then
+ # --gui takes precedence over --headless
+ HEADLESS=0
+ fi
+done
+
+declare -a JVMARGS=()
+
+# set vars for being inside the macos App Bundle
+if [ "${ISMACOS}" = 1 ]; then
+# MACOS ONLY
+ DIR="$(dirname "$(readlinkf "$0")")"
+ JVMARGS=( "${JVMARGS[@]}" "-Xdock:icon=${DIR}/jalview_logo.png" )
+else
+# NOT MACOS
+ DIR="$(dirname "$(readlink -f "$0")")"
+fi
+
+if [ "${HEADLESS}" = 1 ]; then
+ # this suppresses the Java icon appearing in the macOS Dock and maybe other things in other OSes
+ JVMARGS=( "${JVMARGS[@]}" "-Djava.awt.headless=true" )
+fi
+
+JAVA=java
+
+# decide which jalview jar to launch - either 'j11' or 'j1.8'
+if [[ "$JALVIEW_JRE" != "j11" && "$JALVIEW_JRE" != "j1.8" ]]; then
+ JALVIEW_JRE="j11"
+ # if java 8 is installed we pick the j1.8 build
+ if [[ $( "${JAVA}" -version 2>&1 | grep '"1.8' ) != "" ]]; then
+ JALVIEW_JRE="j1.8"
+ fi
+fi
+
+JARPATH="${DIR}/jalview-all-${JALVIEW_JRE}.jar"
+
+# check if memory maximum is set and if so forward to java-based jalview call
+if [ \! -z "$JALVIEW_MAXMEM" ]; then
+ JVMARGS=( "${JVMARGS[@]}" "-Xmx${JALVIEW_MAXMEM}" )
+fi
+
+# WINDOWS ONLY (Cygwin or WSL)
+# change paths for Cygwin or Windows Subsystem for Linux (WSL)
+if [ "${ISMACOS}" != 1 ]; then # older macos doesn't like uname -o, best to avoid
+ if [ "$(uname -o)" = "Cygwin" ]; then
+ # CYGWIN
+ JARPATH="$(cygpath -pw "${JARPATH}")"
+ # now for some arg paths fun. only translating paths starting with './', '../', '/' or '~'
+ ARGS=()
+ for ARG in "${@}"; do
+ if [ "${ARG}" != "${ARG#@(/|./|../|~)}" ]; then
+ ARGS=( "${ARGS[@]}" "$(cygpath -aw "${ARG}")" )
+ else
+ ARGS=( "${ARGS[@]}" "${ARG}" )
+ fi
+ done
+ elif uname -r | grep -i microsoft | grep -i wsl >/dev/null; then
+ # WSL
+ JARPATH="$(wslpath -aw "${JARPATH}")"
+ ARGS=()
+ for ARG in "${@}"; do
+ if [ "${ARG}" != "${ARG#@(/|./|../|~)}" ]; then
+ # annoyingly wslpath does not work if the file doesn't exist!
+ ARGBASENAME="$(basename "${ARG}")"
+ ARGDIRNAME="$(dirname "${ARG}")"
+ ARGS=( "${ARGS[@]}" "$(wslpath -aw "${ARGDIRNAME}")\\${ARGBASENAME}" )
+ else
+ ARGS=( "${ARGS[@]}" "${ARG}" )
+ fi
+ done
+ JAVA="${JAVA}.exe"
+ fi
+fi
+
+# get console width -- three ways to try, just in case
+if command -v tput 2>&1 >/dev/null; then
+ COLUMNS=$(tput cols) 2>/dev/null
+elif command -v stty 2>&1 >/dev/null; then
+ COLUMNS=$(stty size | cut -d" " -f2) 2>/dev/null
+elif command -v resize 2>&1 >/dev/null; then
+ COLUMNS=$(resize -u | grep COLUMNS= | sed -e 's/.*=//;s/;//') 2>/dev/null
+fi
+JVMARGS=( "${JVMARGS[@]}" "-DCONSOLEWIDTH=${COLUMNS}" )
+
+if [ "${DEBUG}" = 1 ]; then
+ echo Shell running: "${JAVA}" "${JVMARGS[@]}" -jar \""${JARPATH}"\" "${ARGS[@]}"
+fi
+
+"${JAVA}" "${JVMARGS[@]}" -jar "${JARPATH}" "${ARGS[@]}"
ISMACOS=1
fi
+# check for headless mode
+HEADLESS=0
+GUI=0
+HELP=0
+DEBUG=0
+for RAWARG in "${@}"; do
+ ARG="${RAWARG%%=*}"
+ case "${ARG}" in
+ --headless|--output|--image|--structureimage)
+ HEADLESS=1
+ ;;
+ --help|--help-*|--version)
+ HELP=1
+ ;;
+ --gui)
+ GUI=1
+ ;;
+ --debug)
+ DEBUG=1
+ ;;
+ esac
+
+ if [ "${HELP}" = 1 ]; then
+ # --help takes precedence
+ HEADLESS=1
+ GUI=0
+ elif [ "${GUI}" = 1 ]; then
+ # --gui takes precedence over --headless
+ HEADLESS=0
+ fi
+done
+
declare -a JVMARGS=()
# set vars for being inside the macos App Bundle
if [ "${ISMACOS}" = 1 ]; then
# MACOS ONLY
DIR="$(dirname "$(readlinkf "$0")")"
- APP="${DIR%.app/Contents/*}".app
- if [ "${APP}" = "${APP%.app}" ]; then
- echo "Could not find Jalview.app" >&2
- exit 2
- fi
- APPDIR="${APP}/Contents/Resources/app"
+ APPDIR="${DIR%/bin}"
JAVA="${APPDIR}/jre/Contents/Home/bin/java"
JVMARGS=( "${JVMARGS[@]}" "-Xdock:icon=${APPDIR}/resource/jalview_logo.png" )
else
JAVA="${APPDIR}/jre/bin/java"
fi
+if [ "${HEADLESS}" = 1 ]; then
+ # this suppresses the Java icon appearing in the macOS Dock and maybe other things in other OSes
+ JVMARGS=( "${JVMARGS[@]}" "-Djava.awt.headless=true" )
+fi
+
SYSJAVA=java
GETDOWNTXT="${APPDIR}/getdown.txt"
echo "Cannot find bundled java, using system ${JAVA} and hoping for the best!" >&2
fi
+if [ "${DEBUG}" = 1 ]; then
+ echo Shell running: \""${JAVA}"\" \""${JVMARGS[@]}"\" -cp \""${CLASSPATH}"\" jalview.bin.Launcher "${ARGS[@]}"
+fi
+
"${JAVA}" "${JVMARGS[@]}" -cp "${CLASSPATH}" jalview.bin.Launcher "${ARGS[@]}"
<?xml version="1.0" encoding="UTF-8"?>
-<install4j version="10.0.5" transformSequenceNumber="10">
+<install4j version="10.0.6" transformSequenceNumber="10">
<directoryPresets config="bin/Jalview" />
<application name="${compiler:JALVIEW_APPLICATION_NAME}" applicationId="${compiler:WINDOWS_APPLICATION_ID}" mediaDir="${compiler:BUILD_DIR}" lzmaCompression="true" shortName="${compiler:INTERNAL_ID}" publisher="University of Dundee" publisherWeb="https://www.jalview.org/" version="${compiler:JALVIEW_VERSION}" allPathsRelative="true" macVolumeId="5aac4968c304f65" javaMinVersion="${compiler:JAVA_MIN_VERSION}" javaMaxVersion="${compiler:JAVA_MAX_VERSION}" allowBetaVM="true" jdkMode="jdk" jdkName="JDK 11.0">
<searchSequence>
</exclude>
<jreBundle jreBundleSource="preCreated" includedJre="${compiler:WINDOWS_X64_JAVA_VM_TGZ}" manualJreEntry="true" />
</windows>
- <macosArchive name="macOS x64 Disk Image" id="878" customizedId="MACOS-X64-DMG" mediaFileName="${compiler:APPLICATION_FOLDER}-${compiler:JALVIEW_VERSION}-${compiler:sys.platform}-x64-java_${compiler:JAVA_INTEGER_VERSION}" volumeName="${compiler:INSTALLER_NAME}" launcherId="737" setupAppId="2746">
+ <macosArchive name="macOS x64 (intel) Disk Image" id="878" customizedId="MACOS-X64-DMG" mediaFileName="${compiler:APPLICATION_FOLDER}-${compiler:JALVIEW_VERSION}-${compiler:sys.platform}-x64-java_${compiler:JAVA_INTEGER_VERSION}" volumeName="${compiler:INSTALLER_NAME}" launcherId="737" setupAppId="2746">
<exclude>
<entry defaultFileset="true" />
<entry filesetId="2803" />
<symlink name="${compiler:JALVIEW_APPLICATION_NAME}.app/Contents/Resources/app/jre/Contents/Home/bin/${compiler:JALVIEW_NAME}" target="java" />
</topLevelFiles>
</macosArchive>
- <macosArchive name="macOS aarch64 Disk Image" id="2796" customizedId="MACOS-AARCH64-DMG" mediaFileName="${compiler:APPLICATION_FOLDER}-${compiler:JALVIEW_VERSION}-${compiler:sys.platform}-aarch64-java_${compiler:JAVA_INTEGER_VERSION}" volumeName="${compiler:INSTALLER_NAME}" architecture="aarch64" launcherId="737" setupAppId="2746">
+ <macosArchive name="macOS aarch64 (Apple Silicon) Disk Image" id="2796" customizedId="MACOS-AARCH64-DMG" mediaFileName="${compiler:APPLICATION_FOLDER}-${compiler:JALVIEW_VERSION}-${compiler:sys.platform}-aarch64-java_${compiler:JAVA_INTEGER_VERSION}" volumeName="${compiler:INSTALLER_NAME}" architecture="aarch64" launcherId="737" setupAppId="2746">
<exclude>
<entry defaultFileset="true" />
<entry filesetId="2801" />