--- /dev/null
+
+package org.forester.ws.hmmer;
+
+import java.io.BufferedReader;
+import java.io.DataOutputStream;
+import java.io.InputStreamReader;
+import java.net.HttpURLConnection;
+import java.net.URL;
+import java.net.URLEncoder;
+
+public class Test {
+
+ public static void main( final String[] args ) {
+ try {
+ final URL url = new URL( "http://hmmer.janelia.org/search/hmmscan" );
+ final HttpURLConnection connection = ( HttpURLConnection ) url.openConnection();
+ connection.setDoOutput( true );
+ connection.setDoInput( true );
+ connection.setInstanceFollowRedirects( false );
+ connection.setRequestMethod( "POST" );
+ connection.setRequestProperty( "Content-Type", "application/x-www-form-urlencoded" );
+ connection.setRequestProperty( "Accept", "application/json" );
+ //Add the database and the sequence. Add more options as you wish!
+ final String urlParameters = "hmmdb=" + URLEncoder.encode( "pfam", "UTF-8" ) + "&seq="
+ + ">seq\nEMGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPV"
+ + "NSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEG"
+ + "RVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAP";
+ connection.setRequestProperty( "Content-Length", "" + Integer.toString( urlParameters.getBytes().length ) );
+ //Send request
+ final DataOutputStream wr = new DataOutputStream( connection.getOutputStream() );
+ wr.writeBytes( urlParameters );
+ wr.flush();
+ wr.close();
+ //Now get the redirect URL
+ final URL respUrl = new URL( connection.getHeaderField( "Location" ) );
+ final HttpURLConnection connection2 = ( HttpURLConnection ) respUrl.openConnection();
+ connection2.setRequestMethod( "GET" );
+ connection2.setRequestProperty( "Accept", "text/x-yaml" );
+ //Get the response and print it to the screen
+ final BufferedReader in = new BufferedReader( new InputStreamReader( connection2.getInputStream() ) );
+ String inputLine;
+ while ( ( inputLine = in.readLine() ) != null ) {
+ System.out.println( inputLine );
+ }
+ in.close();
+ }
+ catch ( final Exception e ) {
+ throw new RuntimeException( e );
+ }
+ }
+}