info.events = [ TestLogEvent.FAILED ]
}
+ if (OperatingSystem.current().isMacOsX()) {
+ testTask.systemProperty "apple.awt.UIElement", "true"
+ testTask.environment "JAVA_TOOL_OPTIONS", "-Dapple.awt.UIElement=true"
+ }
ignoreFailures = true // Always try to run all tests for all modules
--paematrix=[label=pAE R4-M5]./examples/test_fab41.result/test_fab41_unrelaxed_rank_4_model_5_scores.json
--structure=./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1.pdb
--paematrix=[label=pAE R5-M1]./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1_scores.json
---image=output1.html
+--image=[textrenderer=text]output1.html
--- /dev/null
+--open=./examples/test_fab41.result/sample.a2m
+--colour=gecos:flower
+--gui
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3.pdb
+--paematrix=[label=pAE R1-M3]./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_2_model_4.pdb
+--paematrix=[label=pAE R2-M4]./examples/test_fab41.result/test_fab41_unrelaxed_rank_2_model_4_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_3_model_2.pdb
+--paematrix=[label=pAE R3-M2]./examples/test_fab41.result/test_fab41_unrelaxed_rank_3_model_2_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_4_model_5.pdb
+--paematrix=[label=pAE R4-M5]./examples/test_fab41.result/test_fab41_unrelaxed_rank_4_model_5_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1.pdb
+--paematrix=[label=pAE R5-M1]./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1_scores.json
+--image=[textrenderer=text]output1.html
-1.8.3-1.2.14_FJVL
+1.8.3-1.3.0_FJVL
-1.8.3-1.2.14_JVL
+1.8.3-1.3.0_JVL
<parent>
<groupId>com.threerings.getdown</groupId>
<artifactId>getdown</artifactId>
- <version>1.8.3-1.2.14_FJVL</version>
+ <version>1.8.3-1.3.0_FJVL</version>
</parent>
<artifactId>getdown-ant</artifactId>
<parent>
<groupId>com.threerings.getdown</groupId>
<artifactId>getdown</artifactId>
- <version>1.8.3-1.2.14_FJVL</version>
+ <version>1.8.3-1.3.0_FJVL</version>
</parent>
<artifactId>getdown-core</artifactId>
import java.security.MessageDigest;
+import jalview.util.LaunchUtils;
+
import static com.threerings.getdown.Log.log;
/**
return getJVMPath(appdir, false);
}
+ private static String jvmPath = null;
/**
* Reconstructs the path to the JVM used to launch this process.
*
*/
public static String getJVMPath (File appdir, boolean windebug)
{
- // first look in our application directory for an installed VM
- String vmpath = checkJVMPath(new File(appdir, LOCAL_JAVA_DIR).getAbsolutePath(), windebug);
- if (vmpath == null && isMacOS()) {
- vmpath = checkJVMPath(new File(appdir, LOCAL_JAVA_DIR + "/Contents/Home").getAbsolutePath(), windebug);
+ if (jvmPath != null) {
+ return jvmPath;
}
+
+ // first look in our application directory for an installed VM
+ final String appDir = isMacOS() ?
+ (new File(appdir, LOCAL_JAVA_DIR).getAbsolutePath()) + "/Contents/Home"
+ : new File(appdir, LOCAL_JAVA_DIR).getAbsolutePath();
+
+ String javaBin = LaunchUtils.findJavaBin(appDir, windebug, false);
// then fall back to the VM in which we're already running
- if (vmpath == null) {
- vmpath = checkJVMPath(System.getProperty("java.home"), windebug);
+ if (javaBin == null) {
+ javaBin = LaunchUtils.findJavaBin(System.getProperty("java.home"), windebug, false);
}
// then throw up our hands and hope for the best
- if (vmpath == null) {
+ if (javaBin == null) {
+ javaBin = LaunchUtils.findJavaBin(null, windebug, true);
log.warning("Unable to find java [appdir=" + appdir +
", java.home=" + System.getProperty("java.home") + "]!");
- vmpath = "java";
}
// Oddly, the Mac OS X specific java flag -Xdock:name will only work if java is launched
if (isMacOS()) {
try {
File localVM = new File("/usr/bin/java").getCanonicalFile();
- if (localVM.equals(new File(vmpath).getCanonicalFile())) {
- vmpath = "/usr/bin/java";
+ if (localVM.equals(new File(javaBin).getCanonicalFile())) {
+ javaBin = "/usr/bin/java";
}
} catch (IOException ioe) {
log.warning("Failed to check Mac OS canonical VM path.", ioe);
}
}
- return vmpath;
+ jvmPath = javaBin;
+ return jvmPath;
}
private static String _getMD5FileChecksum (File file) {
public class LaunchUtils
{
+ // setting these is LaunchUtils so don't need to import Platform
+ public final static boolean isMac = System.getProperty("os.name")
+ .indexOf("Mac") > -1;
+
+ public final static boolean isWindows = System.getProperty("os.name")
+ .indexOf("Win") > -1;
+
+ private static boolean isJS = /** @j2sNative true || */
+ false;
+
public static void loadChannelProps(File dir)
{
ChannelProperties.loadProps(dir);
public static int getJavaCompileVersion()
{
- if (JAVA_COMPILE_VERSION > 0)
+ if (LaunchUtils.isJS)
+ {
+ return -1;
+ }
+ else if (JAVA_COMPILE_VERSION > 0)
{
return JAVA_COMPILE_VERSION;
}
public static int getJavaVersion()
{
- if (JAVA_VERSION > 0)
+ if (LaunchUtils.isJS)
+ {
+ return -1;
+ }
+ else if (JAVA_VERSION > 0)
{
return JAVA_VERSION;
}
public static boolean checkJavaVersion()
{
+ if (LaunchUtils.isJS)
+ {
+ return true;
+ }
String buildDetails = "jar:".concat(LaunchUtils.class
.getProtectionDomain().getCodeSource().getLocation().toString()
.concat("!" + "/.build_properties"));
return true;
}
+
+ public static String findJavaBin(boolean winConsole)
+ {
+ return findJavaBin(System.getProperty("java.home"), winConsole, true);
+ }
+
+ /*
+ * Returns a string path to the most likely java binary wanted to run this
+ * installation of Jalview.
+ *
+ * @param winConsole whether to use java.exe (console) in preference to javaw.exe
+ * (only affects Windows).
+ * @param javaHome Try this javaHome dir (defaults to the running java.home).
+ * @param generic Return a generic java command if not found.
+ */
+ public static String findJavaBin(String javaHome, boolean winConsole,
+ boolean generic)
+ {
+ String javaBin = null;
+ final String javaExe = winConsole ? "java.exe" : "javaw.exe";
+ final String java = "java";
+
+ if (javaHome != null)
+ {
+ // property "channel.app_name" is set by install4j when launching getdown
+ String propertyAppName = System.getProperty("channel.app_name");
+ final String appName = (propertyAppName != null
+ && propertyAppName.length() > 0) ? propertyAppName
+ : ChannelProperties.getProperty("app_name");
+
+ final String javaBinDir = javaHome + File.separator + "bin"
+ + File.separator;
+
+ // appName and "Jalview" will not point to javaw.exe or java.exe but in
+ // this case that's okay because the taskbar display name problem doesn't
+ // manifest in Windows. See JAL-3820, JAL-4189.
+ for (String name : new String[] { appName, "Jalview", java, javaExe })
+ {
+ if (LaunchUtils.checkJVMSymlink(javaBinDir + name, winConsole))
+ {
+ javaBin = javaBinDir + name;
+ break;
+ }
+ }
+ }
+
+ if (javaBin == null && generic)
+ {
+ javaBin = LaunchUtils.isWindows ? javaExe : java;
+ }
+
+ return javaBin;
+ }
+
+ /*
+ * checkJVMSymlink returns true if the path in testBin *is* a java binary, or
+ * points to a java binary.
+ * @param testBin The binary or symbolic link to check
+ * @param winConsole whether we are in/want a Windows console (only relevant for Windows,
+ * determines whether we use java.exe or javaw.exe)
+ */
+ private static boolean checkJVMSymlink(String testBin, boolean winConsole)
+ {
+ File testBinFile = new File(testBin);
+ if (!testBinFile.exists())
+ {
+ return false;
+ }
+ File targetFile = null;
+ try
+ {
+ targetFile = testBinFile.getCanonicalFile();
+ } catch (IOException e)
+ {
+ return false;
+ }
+ final String javaExe = winConsole ? "java.exe" : "javaw.exe";
+ if (targetFile != null && ("java".equals(targetFile.getName())
+ || javaExe.equals(targetFile.getName())))
+ {
+ return true;
+ }
+ return false;
+ }
}
<parent>
<groupId>com.threerings.getdown</groupId>
<artifactId>getdown</artifactId>
- <version>1.8.3-1.2.14_FJVL</version>
+ <version>1.8.3-1.3.0_FJVL</version>
</parent>
<artifactId>getdown-launcher</artifactId>
if [ x$JVLVERSION != x ]; then
export VERSION=$JVLVERSION
else
- export VERSION=1.8.3-1.2.14_JVL
+ export VERSION=1.8.3-1.3.0_JVL
fi
if [ x${VERSION%_JVL} = x$VERSION ]; then
<groupId>com.threerings.getdown</groupId>
<artifactId>getdown</artifactId>
<packaging>pom</packaging>
- <version>1.8.3-1.2.14_FJVL</version>
+ <version>1.8.3-1.3.0_FJVL</version>
<name>getdown</name>
<description>An application installer and updater.</description>
<code>phylip</code> (<code>phy</code>),
<br/>
<code>jalview</code> (<code>jvp, jar</code>).
+ </p>
<p>
For example, to open a FASTA file, append another FASTA file and then save the concatenation as a Stockholm file, do
<pre>
</p>
<p>
- <em>Important!</em> If you use <code>--output</code> or any other argument that outputs a file, then it will be assumed you want to run Jalview in headless mode (as if you had specified <code>--headless</code>). To use Jalview with <code>--output</code> and not assume headless mode, use the <code>--gui</code> or <code>--noheadless</code> argument (the order doesn't matter).
+ <em>Important!</em> If you use <code>--output</code> or any other argument that outputs a file, then it will be assumed you want to run Jalview in headless mode (as if you had specified <code>--headless</code>). To use Jalview with <code>--output</code> and not assume headless mode, use the <code>--gui</code> argument (the order doesn't matter).
+ </p>
+
+ <p>
+ If you would like to output an alignment file directly to standard output (often referred to as STDOUT), then use the filename <code>-</code> (a single hyphen). In this case any messages that would normally appear on STDOUT will be diverted to STDERR to avoid invalidating the output file.
+ </p>
+ <p>
+ For example, to open a Stockholm file and pipe it to another command as a Block file, do
+ <pre>
+ jalview --open alignment1.stk --output - --format blc | another_command
+ </pre>
+ or equivalently
+ <pre>
+ jalview alignment1.stk --output=[format=blc]- | another_command
+ </pre>
</p>
<h3><a name="format"></a><code>--format</code></h3>
<tr valign="top"><td><code>‑‑help‑all</code></td><td>Help for all arguments</td></tr>
<tr valign="top">
- <td><code>‑‑headless / ‑‑noheadless</code></td>
- <td>Run Jalview in headless (/ or not in headless) mode. In headless mode, no GUI interface will be created and Jalview will quit after all arguments have been processed.
+ <td><code>‑‑headless</code></td>
+ <td>Run Jalview in headless mode. In headless mode, no GUI interface will be created and Jalview will quit after all arguments have been processed.
<br/>
- If you use a command line argument to specify an output file of some kind (<code>--output</code>, <code>--image</code> or <code>--structureimage</code>) then <strong>headless mode will be assumed</strong>. If you don't want this behaviour use <code>--noheadless</code> or <code>--gui</code>.
+ If you use a command line argument to specify an output file of some kind (<code>--output</code>, <code>--image</code> or <code>--structureimage</code>) then <strong>headless mode will be assumed</strong>. If you don't want this behaviour use <code>--gui</code>.
</td>
</tr>
<code>phylip</code> (<code>phy</code>),
<br/>
<code>jalview</code> (<code>jvp, jar</code>).
+ <br/>
+ To output directly to STDOUT (console output) use the filename <code>-</code> (a single hyphen). In this case all STDOUT messages will instead go to STDERR. If no <code>format</code> is supplied then Fasta will be assumed.
</td>
<td><code>format=<em>name</em></code></td>
<td align="center">✓</td>
<strong>If you specify an argument for an output file</strong> (one or more of <code>--output</code>, <code>--image</code> or <code>--structureimage</code>) then it will be assumed that you wish to <strong>run in headless mode</strong>.
</p>
<p>
- You can force Jalview to run in graphical mode using the <code>--gui</code> or <code>--noheadless</code> arguments.
+ You can force Jalview to run in graphical mode using the <code>--gui</code> argument.
</p>
<p>
label.successfully_loaded_file = Successfully loaded file {0}
label.successfully_loaded_matrix = Successfully loaded score matrix {0}
label.successfully_saved_to_file_in_format = Successfully saved to file: {0} in {1} format.
+label.successfully_printed_to_stdout_in_format = Successfully printed to STDOUT in {0} format.
label.copied_sequences_to_clipboard = Copied {0} sequences to clipboard.
label.check_file_matches_sequence_ids_alignment = Check that the file matches sequence IDs in the alignment.
label.problem_reading_tcoffee_score_file = Problem reading T-COFFEE score file
action.cluster_matrix = Cluster matrix
action.clustering_matrix_for = Calculating tree for matrix {0} and clustering at {1}
action.cluster_matrix_tooltip = Computes an average distance tree for the matrix and displays it
-
+label.all_known_alignment_files = All known alignment files
label.successfully_loaded_file = Fichero cargado exitosamente {0}
label.successfully_loaded_matrix = Matriz cargada exitosamente {0}
label.successfully_saved_to_file_in_format = Guardado exitosamente en el fichero: {0} en formato {1}.
+label.successfully_printed_to_stdout_in_format = Impresso exitosamente al STDOUT en formato {0}.
label.copied_sequences_to_clipboard = Copiadas {0} secuencias en el portapapeles.
label.check_file_matches_sequence_ids_alignment = Comprobar que el fichero coincide con el ID de la secuencia en el alineamiento.
label.problem_reading_tcoffee_score_file = Problema de lectura del fichero de puntuaciones T-COFFEE
label.nothing_selected = Nada seleccionado
prompt.analytics_title = Jalview EstadÃsticas de Uso
prompt.analytics = ¿Quiere ayudar a mejorar Jalview habilitando la recopilación de estadÃsticas de uso con análisis Plausible?\nPuede habilitar o deshabilitar el seguimiento de uso en las preferencias.
+label.all_known_alignment_files = Todos los archivos de alineación conocidos
{
if (sequences[row] == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"WARNING: Consensus skipping null sequence - possible race condition.");
continue;
}
}
return new Profiles(result);
// long elapsed = System.currentTimeMillis() - now;
- // System.out.println(elapsed);
+ // jalview.bin.Console.outPrintln(elapsed);
}
/**
' ', value);
}
// long elapsed = System.currentTimeMillis() - now;
- // System.out.println(-elapsed);
+ // jalview.bin.Console.outPrintln(-elapsed);
}
/**
}
}
- System.out.println(max + " " + min);
+ jalview.bin.Console.outPrintln(max + " " + min);
for (int i = 0; i < n; i++)
{
int x = psize * i;
int y = psize * j;
- // System.out.println(mat[i][j]);
+ // jalview.bin.Console.outPrintln(mat[i][j]);
float score = (float) (mat[i][j] - min) / (float) (max - min);
g.setColor(new Color(score, 0, 0));
g.fillRect(x, y, psize, psize);
- // System.out.println(x + " " + y + " " + score);
+ // jalview.bin.Console.outPrintln(x + " " + y + " " + score);
}
}
}
bestm = msq;
}
}
- // System.out.println("Best Score for " + (matches.size() + 1) + " :"
+ // jalview.bin.Console.outPrintln("Best Score for " + (matches.size() + 1) + " :"
// + bestscore);
matches.add(bestm);
aligns.add(bestaseq);
if (tmp.size() != nSeq)
{
- System.err.println("WARNING: tmp.size()=" + tmp.size() + " != nseq="
+ jalview.bin.Console.errPrintln("WARNING: tmp.size()=" + tmp.size() + " != nseq="
+ nSeq
+ " in getOrderByTree - tree contains sequences not in alignment");
}
String msg = String.format(
"Implementation Error - sortByFeature method must be either '%s' or '%s'",
FEATURE_SCORE, FEATURE_DENSITY);
- System.err.println(msg);
+ jalview.bin.Console.errPrintln(msg);
return;
}
{
// int nf = (feats[i] == null) ? 0
// : ((SequenceFeature[]) feats[i]).length;
- // // System.err.println("Sorting on Score: seq " +
+ // // jalview.bin.Console.errPrintln("Sorting on Score: seq " +
// seqs[i].getName()
// + " Feats: " + nf + " Score : " + scores[i]);
}
int featureCount = feats[i] == null ? 0
: ((SequenceFeature[]) feats[i]).length;
scores[i] = featureCount;
- // System.err.println("Sorting on Density: seq "+seqs[i].getName()+
+ // jalview.bin.Console.errPrintln("Sorting on Density: seq "+seqs[i].getName()+
// " Feats: "+featureCount+" Score : "+scores[i]);
}
QuickSort.sortByDouble(scores, seqs, sortByFeatureAscending);
if (translated == null || !(aaRes == translated.charAt(0)))
{
// debug
- // System.out.println(("Mismatch at " + i + "/" + aaResidue + ": "
+ // jalview.bin.Console.outPrintln(("Mismatch at " + i + "/" + aaResidue + ": "
// + codon + "(" + translated + ") != " + aaRes));
return false;
}
* unmapped position; treat like a gap
*/
sourceGapMappedLength += ratio;
- // System.err.println("Can't align: no codon mapping to residue "
+ // jalview.bin.Console.errPrintln("Can't align: no codon mapping to residue "
// + sourceDsPos + "(" + sourceChar + ")");
// return;
continue;
{
if (protein.isNucleotide() || !dna.isNucleotide())
{
- System.err.println("Wrong alignment type in alignProteinAsDna");
+ jalview.bin.Console.errPrintln("Wrong alignment type in alignProteinAsDna");
return 0;
}
List<SequenceI> unmappedProtein = new ArrayList<>();
{
if (protein.isNucleotide() || !dna.isNucleotide())
{
- System.err.println("Wrong alignment type in alignProteinAsDna");
+ jalview.bin.Console.errPrintln("Wrong alignment type in alignProteinAsDna");
return 0;
}
// todo: implement this
.getLength() == mappedFromLength - 1);
if (cdsLength != mappedToLength && !addStopCodon)
{
- System.err.println(String.format(
+ jalview.bin.Console.errPrintln(String.format(
"Can't align cds as protein (length mismatch %d/%d): %s",
cdsLength, mappedToLength, cdsSeq.getName()));
}
AlignedCodon codon = sequenceCodon.getValue();
if (codon.peptideCol > 1)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Problem mapping protein with >1 unmapped start positions: "
+ seq.getName());
}
fromRange[i + 1]);
if (range == null)
{
- System.err.println("Error in mapping " + seqMap + " from "
+ jalview.bin.Console.errPrintln("Error in mapping " + seqMap + " from "
+ fromSeq.getName());
return false;
}
}
else
{
- System.out.println("SEQUENCE HAS BEEN DELETED!!!");
+ jalview.bin.Console.outPrintln("SEQUENCE HAS BEEN DELETED!!!");
}
}
else
{
// JBPNote INFO level debug
- System.err.println(
+ jalview.bin.Console.errPrintln(
"ERROR: calcSeqNum called with out of range sequence index for Alignment\n");
}
}
// tmp = ((max - tmp) * (size - cons2[j][23])) / size;
tmp = ((max - tmp) * (size - cons2GapCounts[j])) / size;
- // System.out.println(tmp+ " " + j);
+ // jalview.bin.Console.outPrintln(tmp+ " " + j);
quality.setElementAt(Double.valueOf(tmp), j);
if (tmp > newmax)
if (matchInDataset != null && xref.getMap().getTo() != null
&& matchInDataset != xref.getMap().getTo())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Implementation problem (reopen JAL-2154): CrossRef.findInDataset seems to have recovered a different sequence than the one explicitly mapped for xref."
+ "Found:" + matchInDataset + "\nExpected:"
+ xref.getMap().getTo() + "\nFor xref:"
retrieved = sftch.getSequences(sourceRefs, !fromDna);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Problem whilst retrieving cross references for Sequence : "
+ seq.getName());
e.printStackTrace();
String msg = "Mapping updated from " + ms.getName()
+ " to retrieved crossreference "
+ matched.getName();
- System.out.println(msg);
+ jalview.bin.Console.outPrintln(msg);
List<DBRefEntry> toRefs = map.getTo().getDBRefs();
if (toRefs != null)
cf.addMap(retrievedSequence, map.getTo(), map.getMap());
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exception when consolidating Mapped sequence set...");
e.printStackTrace(System.err);
}
}
if (dataset.getSequences() == null)
{
- System.err.println("Empty dataset sequence set - NO VECTOR");
+ jalview.bin.Console.errPrintln("Empty dataset sequence set - NO VECTOR");
return false;
}
List<SequenceI> ds = dataset.getSequences();
{
if (nxt.getDatasetSequence() != null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Implementation warning: CrossRef initialised with a dataset alignment with non-dataset sequences in it! ("
+ nxt.getDisplayId(true) + " has ds reference "
+ nxt.getDatasetSequence().getDisplayId(true)
if (rf != 0)
{
final String errMsg = "trimming contigs for incomplete terminal codon.";
- System.err.println(errMsg);
+ jalview.bin.Console.errPrintln(errMsg);
// map and trim contigs to ORF region
vc = scontigs.length - 1;
lastnpos = vismapping.shift(lastnpos); // place npos in context of
InputStream is = getClass().getResourceAsStream(fileName);
if (is == null)
{
- System.err.println("Resource file not found: " + fileName);
+ jalview.bin.Console.errPrintln("Resource file not found: " + fileName);
return;
}
BufferedReader dataIn = new BufferedReader(new InputStreamReader(is));
}
if (codeTables.isEmpty())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"No genetic code tables loaded, check format of file "
+ fileName);
}
InputStream is = getClass().getResourceAsStream(fileName);
if (is == null)
{
- System.err.println("Resource file not found: " + fileName);
+ jalview.bin.Console.errPrintln("Resource file not found: " + fileName);
return;
}
BufferedReader dataIn = new BufferedReader(new InputStreamReader(is));
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected data in " + fileName + ": " + line);
}
}
* seqs.length) { for (int i = 0; i < seqs.length; i++) { if (!hasScore[i])
* { scores[i] = (max + i); } else { int nf=(feats[i]==null) ? 0
* :((SequenceFeature[]) feats[i]).length;
- * System.err.println("Sorting on Score: seq "+seqs[i].getName()+
+ * jalview.bin.Console.errPrintln("Sorting on Score: seq "+seqs[i].getName()+
* " Feats: "+nf+" Score : "+scores[i]); } } }
*
* jalview.util.QuickSort.sort(scores, seqs); } else if
* (int i=0;i<seqs.length; i++) { double nf; scores[i] =
* (0.05+fr*i)+(nf=((feats[i]==null) ? 0.0 :1.0*((SequenceFeature[])
* feats[i]).length));
- * System.err.println("Sorting on Density: seq "+seqs[i].getName()+
+ * jalview.bin.Console.errPrintln("Sorting on Density: seq "+seqs[i].getName()+
* " Feats: "+nf+" Score : "+scores[i]); }
* jalview.util.QuickSort.sort(scores, seqs); } else { if
* (method==FEATURE_LABEL) { throw new Error("Not yet implemented."); } } if
ScoreNames[cols] + ((reps > 0) ? "_" + reps : ""),
ScoreDescriptions[cols], null);
an.setScore(score);
- System.out.println(seqs[i].getName() + " score: '"
+ jalview.bin.Console.outPrintln(seqs[i].getName() + " score: '"
+ ScoreNames[cols] + "' = " + score); // DEBUG
an.setSequenceRef(seqs[i]);
seqs[i].addAlignmentAnnotation(an);
final int open = basePair.getBP5();
final int close = basePair.getBP3();
- // System.out.println("open " + open + " close " + close);
- // System.out.println("lastclose " + lastclose + " lastopen " + lastopen);
+ // jalview.bin.Console.outPrintln("open " + open + " close " + close);
+ // jalview.bin.Console.outPrintln("lastclose " + lastclose + " lastopen " + lastopen);
// we're moving from right to left based on closing pair
/*
{
int popen = bps.get(j).getBP5();
- // System.out.println("j " + j + " popen " + popen + " lastopen "
+ // jalview.bin.Console.outPrintln("j " + j + " popen " + popen + " lastopen "
// +lastopen + " open " + open);
if ((popen < lastopen) && (popen > open))
{
{
if (sfeatures != null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Implementation error: setting dataset sequence for a sequence which has sequence features.\n\tDataset sequence features will not be visible.");
}
sq.setDatasetSequence(seqds);
{
if (!quiet)
{
- System.err.println("Can't find '" + ((String) key)
+ jalview.bin.Console.errPrintln("Can't find '" + ((String) key)
+ "' in uniquified alignment");
}
}
}
if (unmatched.size() > 0 && !quiet)
{
- System.err.println("Did not find matches for :");
+ jalview.bin.Console.errPrintln("Did not find matches for :");
for (Enumeration i = unmatched.elements(); i
.hasMoreElements(); System.out
.println(((SequenceI) i.nextElement()).getName()))
{
if (sequences[j] == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"WARNING: Consensus skipping null sequence - possible race condition.");
continue;
}
{
// if (_lycount<_lylimit)
// {
- // System.err.println("Warning: depth of _recount greater than number of
+ // jalview.bin.Console.errPrintln("Warning: depth of _recount greater than number of
// nodes.");
// }
if (nd == null)
if ((nd.left() == null) && (nd.right() == null))
{
- System.out.println("Leaf = " + ((SequenceI) nd.element()).getName());
- System.out.println("Dist " + nd.dist);
- System.out.println("Boot " + nd.getBootstrap());
+ jalview.bin.Console.outPrintln("Leaf = " + ((SequenceI) nd.element()).getName());
+ jalview.bin.Console.outPrintln("Dist " + nd.dist);
+ jalview.bin.Console.outPrintln("Boot " + nd.getBootstrap());
}
else
{
- System.out.println("Dist " + nd.dist);
+ jalview.bin.Console.outPrintln("Dist " + nd.dist);
printNode((BinaryNode) nd.left());
printNode((BinaryNode) nd.right());
}
}
else
{
- System.out.println(" name = " + ((SequenceI) nd.element()).getName());
+ jalview.bin.Console.outPrintln(" name = " + ((SequenceI) nd.element()).getName());
}
- System.out.println(
+ jalview.bin.Console.outPrintln(
" dist = " + nd.dist + " " + nd.count + " " + nd.height);
}
{
// if (_lycount<_lylimit)
// {
- // System.err.println("Warning: depth of _recount greater than number of
+ // jalview.bin.Console.errPrintln("Warning: depth of _recount greater than number of
// nodes.");
// }
if (nd == null)
return instance;
} catch (InstantiationException | IllegalAccessException e)
{
- System.err.println("Error in " + getClass().getName()
+ jalview.bin.Console.errPrintln("Error in " + getClass().getName()
+ ".getInstance(): " + e.getMessage());
return null;
} catch (ReflectiveOperationException roe)
{
if (c >= symbolIndex.length)
{
- System.err.println(String.format(BAD_ASCII_ERROR, c));
+ jalview.bin.Console.errPrintln(String.format(BAD_ASCII_ERROR, c));
return 0;
}
if (d >= symbolIndex.length)
{
- System.err.println(String.format(BAD_ASCII_ERROR, d));
+ jalview.bin.Console.errPrintln(String.format(BAD_ASCII_ERROR, d));
return 0;
}
return sm;
} catch (IOException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error reading " + resourcePath + ": " + e.getMessage());
}
return null;
ScoreModelI sm2 = models.get(sm.getName());
if (sm2 != null)
{
- System.err.println("Warning: replacing score model " + sm2.getName());
+ jalview.bin.Console.errPrintln("Warning: replacing score model " + sm2.getName());
}
models.put(sm.getName(), sm);
}
urlLink = new UrlLink(link);
} catch (Exception foo)
{
- System.err.println("Exception for URLLink '" + link + "': "
+ jalview.bin.Console.errPrintln("Exception for URLLink '" + link + "': "
+ foo.getMessage());
continue;
}
if (!urlLink.isValid())
{
- System.err.println(urlLink.getInvalidMessage());
+ jalview.bin.Console.errPrintln(urlLink.getInvalidMessage());
continue;
}
/*
* When we finally deprecate 1.1 compatibility, we can start to use
* URLEncoder.encode(url,"UTF-8") and then we'll need this catch: catch
- * (UnsupportedEncodingException ex) { System.err.println("WARNING -
+ * (UnsupportedEncodingException ex) { jalview.bin.Console.errPrintln("WARNING -
* IMPLEMENTATION ERROR - UNSUPPORTED ENCODING EXCEPTION FOR "+url);
* ex.printStackTrace(); }
*/
url = viewport.applet.getCodeBase() + url;
} catch (UnsupportedEncodingException ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"WARNING = IMPLEMENTATION ERROR - UNSUPPORTED ENCODING EXCEPTION FOR "
+ url);
ex.printStackTrace();
SequenceI[] oldOrder = viewport.getAlignment().getSequencesArray();
if (viewport.applet.debug)
{
- System.err.println("Sorting " + alorder.getOrder().size()
+ jalview.bin.Console.errPrintln("Sorting " + alorder.getOrder().size()
+ " in alignment '" + getTitle() + "'");
}
AlignmentSorter.sortBy(viewport.getAlignment(), alorder);
{
if (viewport.applet == null)
{
- System.out.println("Not running as applet - no browser available.");
+ jalview.bin.Console.outPrintln("Not running as applet - no browser available.");
}
else
{
viewer = (Viewer) jmolviewer;
} catch (ClassCastException ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unsupported viewer object :" + jmolviewer.getClass());
}
if (viewer == null)
{
- System.err.println("Can't use this object as a structure viewer:"
+ jalview.bin.Console.errPrintln("Can't use this object as a structure viewer:"
+ jmolviewer.getClass());
return null;
}
chains = (String[]) sqch[1];
if (seqs == null || seqs.length == 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"JalviewLite.AlignFrame:newStructureView: No sequence to bind structure to.");
}
if (protocol == null)
}
if (protocol == null)
{
- System.err.println("Couldn't work out protocol to open structure: "
+ jalview.bin.Console.errPrintln("Couldn't work out protocol to open structure: "
+ pdb.getId());
return;
}
.setMapping(seqs, chains, pdb.getFile(), protocol,
null) == null)
{
- System.err.println("Failed to map " + pdb.getFile() + " ("
+ jalview.bin.Console.errPrintln("Failed to map " + pdb.getFile() + " ("
+ protocol + ") to any sequences");
}
return;
}
if (ajm != null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Incremental adding and aligning structure to existing Jmol view not yet implemented.");
// try and add the pdb structure
// ajm.addS
SequenceI[][] seqs, String[][] chains, String[] protocols)
{
// TODO Auto-generated method stub
- System.err.println("Aligned Structure View: Not yet implemented.");
+ jalview.bin.Console.errPrintln("Aligned Structure View: Not yet implemented.");
}
/**
if (!file.isValid())
{
// TODO: raise dialog for gui
- System.err.println("Problems parsing T-Coffee scores: "
+ jalview.bin.Console.errPrintln("Problems parsing T-Coffee scores: "
+ file.getWarningMessage());
- System.err.println("Origin was:\n" + source);
+ jalview.bin.Console.errPrintln("Origin was:\n" + source);
return false;
}
|| aln.getWidth() != file.getWidth()))
{
// TODO: raise a dialog box here rather than bomb out.
- System.err.println(
+ jalview.bin.Console.errPrintln(
"The scores matrix does not match the alignment dimensions");
}
}
else
{
- System.err.println("Problems resolving T-Coffee scores:");
+ jalview.bin.Console.errPrintln("Problems resolving T-Coffee scores:");
if (file.getWarningMessage() != null)
{
- System.err.println(file.getWarningMessage());
+ jalview.bin.Console.errPrintln(file.getWarningMessage());
}
}
return false;
}
if (widthScale <= 1.0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Invalid alignment character width scaling factor ("
+ widthScale + "). Ignoring.");
widthScale = 1;
}
if (JalviewLite.debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Alignment character width scaling factor is now "
+ widthScale);
}
}
if (heightScale <= 1.0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Invalid alignment character height scaling factor ("
+ heightScale + "). Ignoring.");
heightScale = 1;
}
if (JalviewLite.debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Alignment character height scaling factor is now "
+ heightScale);
}
{
if (JalviewLite.debug)
{// DEBUG
- System.out.println(
+ jalview.bin.Console.outPrintln(
"DEBUG: scroll didn't happen - results not within alignment : "
+ seq.getStart() + "," + seq.getEnd());
}
{
// DEBUG
/*
- * System.out.println("DEBUG: scroll: start=" + r[0] +
+ * jalview.bin.Console.outPrintln("DEBUG: scroll: start=" + r[0] +
* " av.getStartRes()=" + av.getStartRes() + " end=" + r[1] +
* " seq.end=" + seq.getEnd() + " av.getEndRes()=" + av.getEndRes() +
* " hextent=" + hextent);
// this is called after loading new annotation onto alignment
if (alignFrame.getSize().height == 0)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"adjustAnnotationHeight frame size zero NEEDS FIXING");
}
fontChanged();
if ((hextent + x) > width)
{
- System.err.println("hextent was " + hextent + " and x was " + x);
+ jalview.bin.Console.errPrintln("hextent was " + hextent + " and x was " + x);
x = width - hextent;
}
if (x < 0)
{
- System.err.println("x was " + x);
+ jalview.bin.Console.errPrintln("x was " + x);
x = 0;
}
public void raiseOOMWarning(String string, OutOfMemoryError error)
{
// TODO: JAL-960
- System.err.println("Out of memory whilst '" + string + "'");
+ jalview.bin.Console.errPrintln("Out of memory whilst '" + string + "'");
error.printStackTrace();
}
"-applet", scriptWindow, null);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't create a jmol viewer. Args to allocate viewer were:\nDocumentBase="
+ ap.av.applet.getDocumentBase() + "\nCodebase="
+ ap.av.applet.getCodeBase());
{
if (jalview.bin.JalviewLite.debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"AppletJmol:Trying to reuse existing PDBfile IO parser.");
}
// re-use the one we opened earlier
{
if (jalview.bin.JalviewLite.debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"AppletJmol:Creating new PDBfile IO parser.");
}
FileParse fp = new FileParse(pdbentry.getFile(), protocol);
} catch (Exception e)
{
// give up!
- System.err.println("Couldn't access pdbentry id="
+ jalview.bin.Console.errPrintln("Couldn't access pdbentry id="
+ pdbentry.getId() + " and file=" + pdbentry.getFile()
+ " using protocol=" + protocol);
e.printStackTrace();
} catch (OutOfMemoryError ex)
{
frame.dispose();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Out of memory when trying to create dialog box with sequence-structure mapping.");
return;
}
{
// This never gets called because we haven't overriden the associated Jmol's
// console
- System.err.println(
+ jalview.bin.Console.errPrintln(
"WARNING: unexpected call to ExtJmol's showConsole method. (showConsole="
+ show);
}
top = pcaModel.getTop();
} catch (OutOfMemoryError x)
{
- System.err.println("Out of memory when calculating PCA.");
+ jalview.bin.Console.errPrintln("Out of memory when calculating PCA.");
return;
}
calcSettings.setEnabled(true);
if (count > 2)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Pairwise alignment scaled similarity score matrix\n");
for (int i = 0; i < count; i++)
("" + i) + " " + seqs[i].getName());
}
- System.out.println("\n");
+ jalview.bin.Console.outPrintln("\n");
for (int i = 0; i < count; i++)
{
}
}
- System.out.println("\n");
+ jalview.bin.Console.outPrintln("\n");
}
}
validate();
sliderValueChanged();
- // System.out.println("blob done "+ (System.currentTimeMillis()-start));
+ // jalview.bin.Console.outPrintln("blob done "+ (System.currentTimeMillis()-start));
}
void sliderValueChanged()
scale = findScale();
- // System.out.println("Scale factor = " + scale);
+ // jalview.bin.Console.outPrintln("Scale factor = " + scale);
addMouseListener(this);
addKeyListener(this);
scale = findScale();
- // System.out.println("New scale = " + scale);
+ // jalview.bin.Console.outPrintln("New scale = " + scale);
img = createImage(getSize().width, getSize().height);
ig = img.getGraphics();
}
else if (evt.getKeyChar() == 's')
{
- System.err.println("DEBUG: Rectangle selection"); // log.debug
+ jalview.bin.Console.errPrintln("DEBUG: Rectangle selection"); // log.debug
if (rectx2 != -1 && recty2 != -1)
{
rectSelect(rectx1, recty1, rectx2, recty2);
@Override
public void updateColours(SequenceI seq, int index)
{
- System.out.println("update the seqPanel colours");
+ jalview.bin.Console.outPrintln("update the seqPanel colours");
// repaint();
}
{
if (av.getAlignment() == null)
{
- System.out.println("Selection message: alignviewport av SeqSetId="
+ jalview.bin.Console.outPrintln("Selection message: alignviewport av SeqSetId="
+ av.getSequenceSetId() + " ViewId=" + av.getViewId()
+ " 's alignment is NULL! returning immediatly.");
return;
if (copycolsel && av.hasHiddenColumns()
&& (av.getColumnSelection() == null))
{
- System.err.println("Bad things");
+ jalview.bin.Console.errPrintln("Bad things");
}
if (repaint)
{
}
else
{
- System.out.println("Original Tree Data not available");
+ jalview.bin.Console.outPrintln("Original Tree Data not available");
}
}
fis = new URL(propertiesFile).openStream();
if (!Jalview.quiet())
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Loading jalview properties from : " + propertiesFile);
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Disabling Jalview writing to user's local properties file.");
}
propsAreReadOnly = true;
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println("Error reading properties file: " + ex);
+ jalview.bin.Console
+ .outPrintln("Error reading properties file: " + ex);
}
}
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println("Error reading author details: " + ex);
+ jalview.bin.Console
+ .outPrintln("Error reading author details: " + ex);
authorDetails = null;
}
if (authorDetails == null)
{
if (!Jalview.quiet())
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Non-fatal exception when checking version at "
+ remoteBuildPropertiesUrl + ":");
- System.out.println(ex);
+ jalview.bin.Console.printStackTrace(ex);
}
remoteVersion = getProperty("VERSION");
}
url = Cache.class.getResource(resourcePath).toString();
} catch (Exception ex)
{
- System.err.println("Failed to resolve resource " + resourcePath
+ jalview.bin.Console.errPrintln("Failed to resolve resource " + resourcePath
+ ": " + ex.getMessage());
}
}
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println("Error reading build details: " + ex);
+ jalview.bin.Console
+ .outPrintln("Error reading build details: " + ex);
applicationProperties.remove("VERSION");
}
String codeVersion = getProperty("VERSION");
new BuildDetails(codeVersion, null, codeInstallation);
if (printVersion && reportVersion)
{
- System.out.println(ChannelProperties.getProperty("app_name")
- + " version: " + codeVersion + codeInstallation);
+ jalview.bin.Console
+ .outPrintln(ChannelProperties.getProperty("app_name")
+ + " version: " + codeVersion + codeInstallation);
}
}
} catch (NumberFormatException e)
{
if (!Jalview.quiet())
- System.out.println("Error parsing int property '" + property
- + "' with value '" + string + "'");
+ jalview.bin.Console.outPrintln("Error parsing int property '"
+ + property + "' with value '" + string + "'");
}
}
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Error setting property: " + key + " " + obj + "\n" + ex);
}
return oldValue;
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println("Error saving properties: " + ex);
+ jalview.bin.Console.outPrintln("Error saving properties: " + ex);
}
}
}
return date_format.parse(val);
} catch (Exception ex)
{
- System.err.println("Invalid or corrupt date in property '"
+ jalview.bin.Console.errPrintln("Invalid or corrupt date in property '"
+ propertyName + "' : value was '" + val + "'");
}
}
return Integer.valueOf(val);
} catch (NumberFormatException x)
{
- System.err.println("Invalid integer in property '" + property
+ jalview.bin.Console.errPrintln("Invalid integer in property '" + property
+ "' (value was '" + val + "')");
}
}
} catch (Exception ex)
{
if (!Jalview.quiet())
- System.out.println("Error loading User ColourFile\n" + ex);
+ jalview.bin.Console
+ .outPrintln("Error loading User ColourFile\n" + ex);
}
}
if (!files.equals(coloursFound.toString()))
return null;
if (!file.exists())
{
- System.err.println("Could not load bootstrap preferences file '"
+ jalview.bin.Console.errPrintln("Could not load bootstrap preferences file '"
+ filename + "'");
return null;
}
}
} catch (FileNotFoundException e)
{
- System.err.println("Could not find bootstrap preferences file '"
+ jalview.bin.Console.errPrintln("Could not find bootstrap preferences file '"
+ file.getAbsolutePath() + "'");
} catch (IOException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IOException when loading bootstrap preferences file '"
+ file.getAbsolutePath() + "'");
}
import java.util.ArrayList;
import java.util.Arrays;
import java.util.Collections;
-import java.util.EnumSet;
import java.util.HashMap;
import java.util.Iterator;
import java.util.List;
theseArgsWereParsed &= processLinked(id);
processGroovyScript(id);
boolean processLinkedOkay = theseArgsWereParsed;
-
+
// wait around until alignFrame isn't busy
- AlignFrame af=afMap.get(id);
- while (af!=null && af.getViewport().isCalcInProgress())
+ AlignFrame af = afMap.get(id);
+ while (af != null && af.getViewport().isCalcInProgress())
{
- try {
+ try
+ {
Thread.sleep(25);
- } catch (Exception q) {};
+ } catch (Exception q)
+ {
+ }
+ ;
}
-
+
theseArgsWereParsed &= processImages(id);
if (processLinkedOkay)
theseArgsWereParsed &= processOutput(id);
if (avm == null)
return true;
- /*
- * // script to execute after all loading is completed one way or another String
- * groovyscript = m.get(Arg.GROOVY) == null ? null :
- * m.get(Arg.GROOVY).getValue(); String file = m.get(Arg.OPEN) == null ? null :
- * m.get(Arg.OPEN).getValue(); String data = null; FileFormatI format = null;
- * DataSourceType protocol = null;
- */
+ // set wrap scope here so it can be applied after structures are opened
+ boolean wrap = false;
+
if (avm.containsArg(Arg.APPEND) || avm.containsArg(Arg.OPEN))
{
commandArgsProvided = true;
af = fileLoader.LoadFileWaitTillLoaded(openFile, protocol,
format);
- // wrap alignment?
- boolean wrap = ArgParser.getFromSubValArgOrPref(avm, Arg.WRAP, sv,
- null, "WRAP_ALIGNMENT", false);
- af.getCurrentView().setWrapAlignment(wrap);
-
// colour alignment?
String colour = ArgParser.getFromSubValArgOrPref(avm, av,
Arg.COLOUR, sv, null, "DEFAULT_COLOUR_PROT", "");
if ("" != colour)
{
ColourSchemeI cs = ColourSchemeProperty.getColourScheme(
- af.getViewport(), af.getViewport().getAlignment(), colour);
-
- if (cs==null && !"None".equals(colour))
+ af.getViewport(), af.getViewport().getAlignment(),
+ colour);
+
+ if (cs == null && !"None".equals(colour))
+ {
+ Console.warn(
+ "Couldn't parse '" + colour + "' as a colourscheme.");
+ }
+ else
{
- Console.warn("Couldn't parse '"+colour+"' as a colourscheme.");
- } else {
af.changeColour(cs);
}
Jalview.testoutput(argParser, Arg.COLOUR, "zappo", colour);
false, false);
}
+ // wrap alignment? do this last for formatting reasons
+ wrap = ArgParser.getFromSubValArgOrPref(avm, Arg.WRAP, sv, null,
+ "WRAP_ALIGNMENT", false);
+ // af.setWrapFormat(wrap) is applied after structures are opened for
+ // annotation reasons
+
// store the AlignFrame for this id
afMap.put(id, af);
String sViewer = ArgParser.getFromSubValArgOrPref(avm,
Arg.STRUCTUREVIEWER, Position.AFTER, av, subVals, null,
null, "jmol");
- ViewerType viewerType = null;
- if (!"none".equals(sViewer))
- {
- for (ViewerType v : EnumSet.allOf(ViewerType.class))
- {
- String name = v.name().toLowerCase(Locale.ROOT)
- .replaceAll(" ", "");
- if (sViewer.equals(name))
- {
- viewerType = v;
- break;
- }
- }
- }
+ ViewerType viewerType = ViewerType.getFromString(sViewer);
// TODO use ssFromStructure
StructureViewer sv = StructureChooser
structureFilepath, tft, paeFilepath, false,
ssFromStructure, false, viewerType);
- if (sv==null)
+ if (sv == null)
{
Console.error("Failed to import and open structure view.");
continue;
}
try
{
- long tries=1000;
- while (sv.isBusy() && tries>0)
+ long tries = 1000;
+ while (sv.isBusy() && tries > 0)
{
Thread.sleep(25);
if (sv.isBusy())
"Waiting for viewer for " + structureFilepath);
}
}
- if (tries==0 && sv.isBusy())
+ if (tries == 0 && sv.isBusy())
{
- Console.warn("Gave up waiting for structure viewer to load. Something may have gone wrong.");
+ Console.warn(
+ "Gave up waiting for structure viewer to load. Something may have gone wrong.");
}
} catch (Exception x)
{
- Console.warn("Exception whilst waiting for structure viewer "+structureFilepath,x);
+ Console.warn("Exception whilst waiting for structure viewer "
+ + structureFilepath, x);
}
- Console.debug("Successfully opened viewer for "+structureFilepath);
+ Console.debug(
+ "Successfully opened viewer for " + structureFilepath);
String structureImageFilename = ArgParser.getValueFromSubValOrArg(
avm, av, Arg.STRUCTUREIMAGE, subVals);
if (sv != null && structureImageFilename != null)
if (sview instanceof AppJmol)
{
AppJmol jmol = (AppJmol) sview;
- try {
- Console.debug("Rendering image to "+structureImageFile);
+ try
+ {
+ Console.debug("Rendering image to " + structureImageFile);
jmol.makePDBImage(structureImageFile, imageType, renderer,
- userBis);
- Console.debug("Finished Rendering image to "+structureImageFile);
+ userBis);
+ Console.debug("Finished Rendering image to "
+ + structureImageFile);
- }
- catch (ImageOutputException ioexc)
+ } catch (ImageOutputException ioexc)
{
- Console.warn("Unexpected error whilst exporting image to "+structureImageFile,ioexc);
+ Console.warn("Unexpected error whilst exporting image to "
+ + structureImageFile, ioexc);
}
}
}
}
+ if (wrap)
+ {
+ AlignFrame af = afMap.get(id);
+ if (af != null)
+ {
+ af.setWrapFormat(wrap, true);
+ }
+ }
+
/*
boolean doShading = avm.getBoolean(Arg.TEMPFAC_SHADING);
if (doShading)
Cache.setProperty("EXPORT_EMBBED_BIOJSON", "false");
Console.info("Writing " + file);
- try {
- switch (type)
+ try
{
-
- case "svg":
- Console.debug("Outputting type '" + type + "' to " + fileName);
- af.createSVG(file, renderer);
- break;
-
- case "png":
- Console.debug("Outputting type '" + type + "' to " + fileName);
- af.createPNG(file, null, userBis);
- break;
-
- case "html":
- Console.debug("Outputting type '" + type + "' to " + fileName);
- HtmlSvgOutput htmlSVG = new HtmlSvgOutput(af.alignPanel);
- htmlSVG.exportHTML(fileName, renderer);
- break;
-
- case "biojs":
- Console.debug("Creating BioJS MSA Viwer HTML file: " + fileName);
- try
- {
- BioJsHTMLOutput.refreshVersionInfo(
- BioJsHTMLOutput.BJS_TEMPLATES_LOCAL_DIRECTORY);
- } catch (URISyntaxException e)
+ switch (type)
{
- e.printStackTrace();
+
+ case "svg":
+ Console.debug("Outputting type '" + type + "' to " + fileName);
+ af.createSVG(file, renderer);
+ break;
+
+ case "png":
+ Console.debug("Outputting type '" + type + "' to " + fileName);
+ af.createPNG(file, null, userBis);
+ break;
+
+ case "html":
+ Console.debug("Outputting type '" + type + "' to " + fileName);
+ HtmlSvgOutput htmlSVG = new HtmlSvgOutput(af.alignPanel);
+ htmlSVG.exportHTML(fileName, renderer);
+ break;
+
+ case "biojs":
+ Console.debug(
+ "Outputting BioJS MSA Viwer HTML file: " + fileName);
+ try
+ {
+ BioJsHTMLOutput.refreshVersionInfo(
+ BioJsHTMLOutput.BJS_TEMPLATES_LOCAL_DIRECTORY);
+ } catch (URISyntaxException e)
+ {
+ e.printStackTrace();
+ }
+ BioJsHTMLOutput bjs = new BioJsHTMLOutput(af.alignPanel);
+ bjs.exportHTML(fileName);
+ break;
+
+ case "eps":
+ Console.debug("Outputting EPS file: " + fileName);
+ af.createEPS(file, renderer);
+ break;
+
+ case "imagemap":
+ Console.debug("Outputting ImageMap file: " + fileName);
+ af.createImageMap(file, name);
+ break;
+
+ default:
+ Console.warn(Arg.IMAGE.argString() + " type '" + type
+ + "' not known. Ignoring");
+ break;
}
- BioJsHTMLOutput bjs = new BioJsHTMLOutput(af.alignPanel);
- bjs.exportHTML(fileName);
- break;
-
- case "eps":
- Console.debug("Creating EPS file: " + fileName);
- af.createEPS(file, name);
- break;
-
- case "imagemap":
- Console.debug("Creating ImageMap file: " + fileName);
- af.createImageMap(file, name);
- break;
-
- default:
- Console.warn(Arg.IMAGE.argString() + " type '" + type
- + "' not known. Ignoring");
- break;
- }
- } catch (Exception ioex) {
- Console.warn("Unexpected error during export",ioex);
+ } catch (Exception ioex)
+ {
+ Console.warn("Unexpected error during export", ioex);
}
}
}
String val = av.getValue();
SubVals subVals = av.getSubVals();
String fileName = subVals.getContent();
+ boolean stdout = ArgParser.STDOUTFILENAME.equals(fileName);
File file = new File(fileName);
boolean overwrite = ArgParser.getFromSubValArgOrPref(avm,
Arg.OVERWRITE, subVals, null, "OVERWRITE_OUTPUT", false);
!Platform.isHeadless());
// if backups is not true then --overwrite must be specified
- if (file.exists() && !(overwrite || backups))
+ if (file.exists() && !(overwrite || backups || stdout))
{
Console.error("Won't overwrite file '" + fileName + "' without "
+ Arg.OVERWRITE.argString() + " or "
}
if (ff == null)
{
- StringBuilder validSB = new StringBuilder();
- for (String f : validFormats)
- {
- if (validSB.length() > 0)
- validSB.append(", ");
- validSB.append(f);
- FileFormatI tff = ffs.forName(f);
- validSB.append(" (");
- validSB.append(tff.getExtensions());
- validSB.append(")");
+ if (stdout)
+ {
+ ff = FileFormat.Fasta;
}
+ else
+ {
+ StringBuilder validSB = new StringBuilder();
+ for (String f : validFormats)
+ {
+ if (validSB.length() > 0)
+ validSB.append(", ");
+ validSB.append(f);
+ FileFormatI tff = ffs.forName(f);
+ validSB.append(" (");
+ validSB.append(tff.getExtensions());
+ validSB.append(")");
+ }
- Jalview.exit("No valid format specified for "
- + Arg.OUTPUT.argString() + ". Valid formats are "
- + validSB.toString() + ".", 1);
- // this return really shouldn't happen
- return false;
+ Jalview.exit("No valid format specified for "
+ + Arg.OUTPUT.argString() + ". Valid formats are "
+ + validSB.toString() + ".", 1);
+ // this return really shouldn't happen
+ return false;
+ }
}
String savedBackupsPreference = Cache
Console.info("Writing " + fileName);
- af.saveAlignment(fileName, ff);
+ af.saveAlignment(fileName, ff, stdout);
Console.debug("Returning backups to " + savedBackupsPreference);
if (savedBackupsPreference != null)
Cache.applicationProperties.put(BackupFiles.ENABLED,
*/
package jalview.bin;
+import java.io.PrintStream;
import java.util.Locale;
import jalview.log.JLogger;
}
else
{
- System.out.println(message);
- t.printStackTrace();
+ outPrintln(message);
+ Console.printStackTrace(t);
}
}
}
else
{
- System.out.println(message);
+ outPrintln(message);
}
}
}
else
{
- System.out.println(message);
- t.printStackTrace();
+ outPrintln(message);
+ Console.printStackTrace(t);
}
}
}
else
{
- System.out.println(message);
+ outPrintln(message);
}
}
}
else
{
- System.out.println(message);
- t.printStackTrace();
+ outPrintln(message);
+ Console.printStackTrace(t);
}
}
}
else
{
- System.out.println(message);
+ outPrintln(message);
}
}
}
else
{
- System.out.println(message);
+ outPrintln(message);
}
}
}
else
{
- System.out.println(message);
- t.printStackTrace();
+ outPrintln(message);
+ Console.printStackTrace(t);
}
}
}
else
{
- System.err.println(message);
+ jalview.bin.Console.errPrintln(message);
}
}
}
else
{
- System.err.println(message);
- t.printStackTrace(System.err);
+ jalview.bin.Console.errPrintln(message);
+ Console.printStackTrace(t);
}
}
}
else
{
- System.err.println(message);
+ jalview.bin.Console.errPrintln(message);
}
}
}
else
{
- System.err.println(message);
- t.printStackTrace(System.err);
+ jalview.bin.Console.errPrintln(message);
+ Console.printStackTrace(t);
}
}
{
if (!Jalview.quiet())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Setting initial log level to " + logLevel.name());
}
Log4j.init(logLevel);
log = JLoggerLog4j.getLogger(Cache.JALVIEW_LOGGER_NAME, logLevel);
} catch (NoClassDefFoundError e)
{
- System.err.println("Could not initialise the logger framework");
- e.printStackTrace();
+ jalview.bin.Console
+ .errPrintln("Could not initialise the logger framework");
+ Console.printStackTrace(e);
}
// Test message
}
}
+ public static void outPrint()
+ {
+ outPrint("");
+ }
+
+ public static void outPrintln()
+ {
+ outPrintln("");
+ }
+
+ public static void outPrint(Object message)
+ {
+ outPrintMessage(message, false, false);
+ }
+
+ public static void outPrint(Object message, boolean forceStdout)
+ {
+ outPrintMessage(message, false, forceStdout);
+ }
+
+ public static void outPrintln(Object message)
+ {
+ outPrintMessage(message, true, false);
+ }
+
+ public static PrintStream outputStream(boolean forceStdout)
+ {
+ // send message to stderr if an output file to stdout is expected
+ if (!forceStdout && Jalview.getInstance() != null
+ && Jalview.getInstance().bootstrapArgs != null
+ && Jalview.getInstance().bootstrapArgs.outputToStdout())
+ {
+ return System.err;
+ }
+ else
+ {
+ return System.out;
+ }
+ }
+
+ public static void outPrintMessage(Object message, boolean newline,
+ boolean forceStdout)
+ {
+ PrintStream ps = outputStream(forceStdout);
+ if (newline)
+ {
+ ps.println(message);
+ }
+ else
+ {
+ ps.print(message);
+ }
+ }
+
+ public static void errPrint()
+ {
+ errPrint("");
+ }
+
+ public static void errPrintln()
+ {
+ errPrintln("");
+ }
+
+ public static void errPrint(Object message)
+ {
+ System.err.print(message);
+ }
+
+ public static void errPrintln(Object message)
+ {
+ System.err.println(message);
+ }
+
+ public static void printStackTrace(Throwable t)
+ {
+ // send message to stderr if output to stdout is expected
+ t.printStackTrace(System.err);
+ }
+
public final static String LOGGING_TEST_MESSAGE = "Logging to STDERR";
-}
+}
\ No newline at end of file
} catch (NoClassDefFoundError e)
{
// com.sun.management.OperatingSystemMXBean doesn't exist in this JVM
- System.err.println(
+ jalview.bin.Console.errPrintln(
"No com.sun.management.OperatingSystemMXBean: cannot get total physical memory size");
}
*/
package jalview.bin;
-import java.util.Locale;
-
import java.awt.HeadlessException;
+import java.util.Locale;
public class HiDPISetting
{
}
} catch (NumberFormatException e)
{
- System.err.println(setHiDPIScalePropertyName + " property give ("
- + setHiDPIScaleProperty + ") but not parseable as integer");
+ jalview.bin.Console.errPrintln(setHiDPIScalePropertyName
+ + " property give (" + setHiDPIScaleProperty
+ + ") but not parseable as integer");
}
}
if (setHiDPI && setHiDPIScale > 0)
try
{
int existingPropertyVal = Integer.parseInt(existingProperty);
- System.out.println("Existing " + scalePropertyName + " is "
- + existingPropertyVal);
+ jalview.bin.Console.outPrintln("Existing " + scalePropertyName
+ + " is " + existingPropertyVal);
if (existingPropertyVal > 1)
{
setHiDPIScale(existingPropertyVal);
}
} catch (NumberFormatException e)
{
- System.out.println("Could not convert property " + scalePropertyName
- + " vale '" + existingProperty + "' to number");
+ jalview.bin.Console.outPrintln(
+ "Could not convert property " + scalePropertyName
+ + " vale '" + existingProperty + "' to number");
}
}
dpi = screenInfo.getScreenResolution();
} catch (HeadlessException e)
{
- System.err.println("Cannot get screen resolution: " + e.getMessage());
+ if (isLinux)
+ {
+ jalview.bin.Console.errPrintln(
+ "Cannot get screen resolution: " + e.getMessage());
+ }
}
// try and get screen size height and width
mindimension = Math.min(height, width);
} catch (HeadlessException e)
{
- System.err.println(
- "Cannot get screen size height and width:" + e.getMessage());
+ if (isLinux)
+ {
+ jalview.bin.Console
+ .errPrintln("Cannot get screen size height and width:"
+ + e.getMessage());
+ }
}
// attempt at a formula for scaling based on screen dpi and mindimension.
*
*/
{
- System.out.println("not in js");
+ Console.outPrintln("not in js");
}
// BH - for event debugging in JavaScript (Java mode only)
}.start();
}
- if (!quiet() || bootstrapArgs.contains(Arg.VERSION))
+ if (!quiet() || !bootstrapArgs.outputToStdout()
+ || bootstrapArgs.contains(Arg.VERSION))
{
- System.out.println(
+ Console.outPrintln(
"Java version: " + System.getProperty("java.version"));
- System.out.println("Java home: " + System.getProperty("java.home"));
- System.out.println("Java arch: " + System.getProperty("os.arch") + " "
+ Console.outPrintln("Java home: " + System.getProperty("java.home"));
+ Console.outPrintln("Java arch: " + System.getProperty("os.arch") + " "
+ System.getProperty("os.name") + " "
+ System.getProperty("os.version"));
String val = System.getProperty("sys.install4jVersion");
if (val != null)
{
- System.out.println("Install4j version: " + val);
+ Console.outPrintln("Install4j version: " + val);
}
val = System.getProperty("installer_template_version");
if (val != null)
{
- System.out.println("Install4j template version: " + val);
+ Console.outPrintln("Install4j template version: " + val);
}
val = System.getProperty("launcher_version");
if (val != null)
{
- System.out.println("Launcher version: " + val);
+ Console.outPrintln("Launcher version: " + val);
}
}
// register SIGTERM listener
Runtime.getRuntime().addShutdownHook(new Thread()
{
+ @Override
public void run()
{
Console.debug("Running shutdown hook");
Cache.loadProperties(usrPropsFile);
if (usrPropsFile != null)
{
- System.out.println(
+ Console.outPrintln(
"CMD [-props " + usrPropsFile + "] executed successfully!");
testoutput(bootstrapArgs, Arg.PROPS,
"test/jalview/bin/testProps.jvprops", usrPropsFile);
{
List<Map.Entry<Type, String>> helpArgs = bootstrapArgs
.getList(Arg.HELP);
- System.out.println(Arg.usage(helpArgs.stream().map(e -> e.getKey())
+ Console.outPrintln(Arg.usage(helpArgs.stream().map(e -> e.getKey())
.collect(Collectors.toList())));
Jalview.exit(null, 0);
}
* Now using new usage statement.
showUsage();
*/
- System.out.println(Arg.usage());
+ Console.outPrintln(Arg.usage());
Jalview.exit(null, 0);
}
try
{
Jws2Discoverer.getDiscoverer().setPreferredUrl(jabawsUrl);
- System.out.println(
+ Console.outPrintln(
"CMD [-jabaws " + jabawsUrl + "] executed successfully!");
testoutput(bootstrapArgs, Arg.JABAWS,
"http://www.compbio.dundee.ac.uk/jabaws", jabawsUrl);
} catch (MalformedURLException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Invalid jabaws parameter: " + jabawsUrl + " ignored");
}
}
}
else
{
- System.out.println("Executing setprop argument: " + setprop);
+ jalview.bin.Console
+ .errPrintln("Executing setprop argument: " + setprop);
if (Platform.isJS())
{
Cache.setProperty(setprop.substring(0, p),
}
else
{
- System.out.println("CMD [-nousagestats] executed successfully!");
+ Console.outPrintln("CMD [-nousagestats] executed successfully!");
testoutput(argparser, Arg.NOUSAGESTATS);
}
// questionnaire
Console.debug("Starting questionnaire url at " + url);
desktop.checkForQuestionnaire(url);
- System.out.println("CMD questionnaire[-" + url
+ Console.outPrintln("CMD questionnaire[-" + url
+ "] executed successfully!");
}
else
}
else
{
- System.out
- .println("CMD [-noquestionnaire] executed successfully!");
+ Console.outPrintln(
+ "CMD [-noquestionnaire] executed successfully!");
testoutput(argparser, Arg.QUESTIONNAIRE);
}
.getString("status.processing_commandline_args"),
progress = System.currentTimeMillis());
}
- System.out.println("CMD [-open " + file + "] executed successfully!");
+ Console.outPrintln("CMD [-open " + file + "] executed successfully!");
if (!Platform.isJS())
/**
format);
if (af == null)
{
- System.out.println("error");
+ Console.outPrintln("error");
}
else
{
if (cs != null)
{
- System.out.println(
+ Console.outPrintln(
"CMD [-colour " + data + "] executed successfully!");
}
af.changeColour(cs);
{
af.parseFeaturesFile(data,
AppletFormatAdapter.checkProtocol(data));
- // System.out.println("Added " + data);
- System.out.println(
+ // Console.outPrintln("Added " + data);
+ Console.outPrintln(
"CMD groups[-" + data + "] executed successfully!");
}
data = aparser.getValue("features", true);
{
af.parseFeaturesFile(data,
AppletFormatAdapter.checkProtocol(data));
- // System.out.println("Added " + data);
- System.out.println(
+ // Console.outPrintln("Added " + data);
+ Console.outPrintln(
"CMD [-features " + data + "] executed successfully!");
}
if (data != null)
{
af.loadJalviewDataFile(data, null, null, null);
- // System.out.println("Added " + data);
- System.out.println(
+ // Console.outPrintln("Added " + data);
+ Console.outPrintln(
"CMD [-annotations " + data + "] executed successfully!");
}
// set or clear the sortbytree flag.
af.getViewport().setSortByTree(true);
if (af.getViewport().getSortByTree())
{
- System.out.println("CMD [-sortbytree] executed successfully!");
+ Console.outPrintln("CMD [-sortbytree] executed successfully!");
}
}
if (aparser.contains("no-annotation"))
af.getViewport().setShowAnnotation(false);
if (!af.getViewport().isShowAnnotation())
{
- System.out.println("CMD no-annotation executed successfully!");
+ Console.outPrintln("CMD no-annotation executed successfully!");
}
}
if (aparser.contains("nosortbytree"))
af.getViewport().setSortByTree(false);
if (!af.getViewport().getSortByTree())
{
- System.out
- .println("CMD [-nosortbytree] executed successfully!");
+ Console.outPrintln(
+ "CMD [-nosortbytree] executed successfully!");
}
}
data = aparser.getValue("tree", true);
{
try
{
- System.out.println(
+ Console.outPrintln(
"CMD [-tree " + data + "] executed successfully!");
NewickFile nf = new NewickFile(data,
AppletFormatAdapter.checkProtocol(data));
.setCurrentTree(af.showNewickTree(nf, data).getTree());
} catch (IOException ex)
{
- System.err.println("Couldn't add tree " + data);
+ jalview.bin.Console.errPrintln("Couldn't add tree " + data);
ex.printStackTrace(System.err);
}
}
{
// Execute the groovy script after we've done all the rendering stuff
// and before any images or figures are generated.
- System.out.println("Executing script " + groovyscript);
+ Console.outPrintln("Executing script " + groovyscript);
executeGroovyScript(groovyscript, af);
- System.out.println("CMD groovy[" + groovyscript
+ Console.outPrintln("CMD groovy[" + groovyscript
+ "] executed successfully!");
groovyscript = null;
}
if (outputFormat.equalsIgnoreCase("png"))
{
- System.out.println("Creating PNG image: " + file);
+ Console.outPrintln("Creating PNG image: " + file);
af.createPNG(new File(file));
imageName = (new File(file)).getName();
continue;
}
else if (outputFormat.equalsIgnoreCase("svg"))
{
- System.out.println("Creating SVG image: " + file);
+ Console.outPrintln("Creating SVG image: " + file);
File imageFile = new File(file);
imageName = imageFile.getName();
af.createSVG(imageFile);
imageName = imageFile.getName();
HtmlSvgOutput htmlSVG = new HtmlSvgOutput(af.alignPanel);
- System.out.println("Creating HTML image: " + file);
+ Console.outPrintln("Creating HTML image: " + file);
htmlSVG.exportHTML(file);
continue;
}
{
if (file == null)
{
- System.err.println("The output html file must not be null");
+ jalview.bin.Console.errPrintln(
+ "The output html file must not be null");
return;
}
try
e.printStackTrace();
}
BioJsHTMLOutput bjs = new BioJsHTMLOutput(af.alignPanel);
- System.out.println(
+ Console.outPrintln(
"Creating BioJS MSA Viwer HTML file: " + file);
bjs.exportHTML(file);
continue;
}
else if (outputFormat.equalsIgnoreCase("imgMap"))
{
- System.out.println("Creating image map: " + file);
+ Console.outPrintln("Creating image map: " + file);
af.createImageMap(new File(file), imageName);
continue;
}
else if (outputFormat.equalsIgnoreCase("eps"))
{
File outputFile = new File(file);
- System.out.println(
+ Console.outPrintln(
"Creating EPS file: " + outputFile.getAbsolutePath());
af.createEPS(outputFile);
continue;
outFormat = FileFormats.getInstance().forName(outputFormat);
} catch (Exception formatP)
{
- System.out.println("Couldn't parse " + outFormat
+ Console.outPrintln("Couldn't parse " + outFormat
+ " as a valid Jalview format string.");
}
if (outFormat != null)
{
if (!outFormat.isWritable())
{
- System.out.println(
+ Console.outPrintln(
"This version of Jalview does not support alignment export as "
+ outputFormat);
}
af.saveAlignment(file, outFormat);
if (af.isSaveAlignmentSuccessful())
{
- System.out.println("Written alignment in "
+ Console.outPrintln("Written alignment in "
+ outFormat.getName() + " format to " + file);
}
else
{
- System.out.println("Error writing file " + file + " in "
+ Console.outPrintln("Error writing file " + file + " in "
+ outFormat.getName() + " format!!");
}
}
}
} catch (ImageOutputException ioexc)
{
- System.out.println(
+ Console.outPrintln(
"Unexpected error whilst exporting image to " + file);
ioexc.printStackTrace();
}
while (aparser.getSize() > 0)
{
- System.out.println("Unknown arg: " + aparser.nextValue());
+ Console.outPrintln("Unknown arg: " + aparser.nextValue());
}
}
}
{
if (Cache.groovyJarsPresent())
{
- System.out.println("Executing script " + groovyscript);
+ Console.outPrintln("Executing script " + groovyscript);
executeGroovyScript(groovyscript, startUpAlframe);
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Sorry. Groovy Support is not available, so ignoring the provided groovy script "
+ groovyscript);
}
UIManager.put("TabbedPane.tabType", "card");
UIManager.put("TabbedPane.showTabSeparators", true);
UIManager.put("TabbedPane.showContentSeparator", true);
- UIManager.put("TabbedPane.tabSeparatorsFullHeight", true);
+ // UIManager.put("TabbedPane.tabSeparatorsFullHeight", true);
UIManager.put("TabbedPane.tabsOverlapBorder", true);
UIManager.put("TabbedPane.hasFullBorder", true);
UIManager.put("TabbedPane.tabLayoutPolicy", "scroll");
/*
private static void showUsage()
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Usage: jalview -open [FILE] [OUTPUT_FORMAT] [OUTPUT_FILE]\n\n"
+ "-nodisplay\tRun Jalview without User Interface.\n"
+ "-props FILE\tUse the given Jalview properties file instead of users default.\n"
} catch (Exception ex)
{
- System.err.println("Failed to read from STDIN into tempfile "
- + ((tfile == null) ? "(tempfile wasn't created)"
- : tfile.toString()));
+ jalview.bin.Console
+ .errPrintln("Failed to read from STDIN into tempfile "
+ + ((tfile == null) ? "(tempfile wasn't created)"
+ : tfile.toString()));
ex.printStackTrace();
return;
}
sfile = tfile.toURI().toURL();
} catch (Exception x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected Malformed URL Exception for temporary file created from STDIN: "
+ tfile.toURI());
x.printStackTrace();
tfile = new File(groovyscript);
if (!tfile.exists())
{
- System.err.println("File '" + groovyscript + "' does not exist.");
+ jalview.bin.Console.errPrintln(
+ "File '" + groovyscript + "' does not exist.");
return;
}
if (!tfile.canRead())
{
- System.err.println("File '" + groovyscript + "' cannot be read.");
+ jalview.bin.Console.errPrintln(
+ "File '" + groovyscript + "' cannot be read.");
return;
}
if (tfile.length() < 1)
{
- System.err.println("File '" + groovyscript + "' is empty.");
+ jalview.bin.Console
+ .errPrintln("File '" + groovyscript + "' is empty.");
return;
}
try
sfile = tfile.getAbsoluteFile().toURI().toURL();
} catch (Exception ex)
{
- System.err.println("Failed to create a file URL for "
+ jalview.bin.Console.errPrintln("Failed to create a file URL for "
+ tfile.getAbsoluteFile());
return;
}
}
} catch (Exception e)
{
- System.err.println("Exception Whilst trying to execute file " + sfile
- + " as a groovy script.");
+ jalview.bin.Console
+ .errPrintln("Exception Whilst trying to execute file " + sfile
+ + " as a groovy script.");
e.printStackTrace(System.err);
}
{
if (exitcode == 0)
{
- System.out.println(message);
+ Console.outPrintln(message);
}
else
{
- System.err.println(message);
+ jalview.bin.Console.errPrintln(message);
}
}
}
if (yes && ((s1 == null && s2 == null)
|| (s1 != null && s1.equals(s2))))
{
- System.out.println("[TESTOUTPUT] arg " + a.argString() + "='" + s1
+ Console.outPrintln("[TESTOUTPUT] arg " + a.argString() + "='" + s1
+ "' was set");
}
}
{
message = a.argString() + (yes ? " was set" : " was not set");
}
- System.out.println("[TESTOUTPUT] arg " + message);
+ Console.outPrintln("[TESTOUTPUT] arg " + message);
}
}
{
if (debug)
{
- System.err.println("Selecting region using separator string '"
+ jalview.bin.Console.errPrintln("Selecting region using separator string '"
+ separator + "'");
}
}
from--;
} catch (NumberFormatException ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"ERROR: Couldn't parse first integer in range element column selection string '"
+ cl + "' - format is 'from-to'");
return;
to--;
} catch (NumberFormatException ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"ERROR: Couldn't parse second integer in range element column selection string '"
+ cl + "' - format is 'from-to'");
return;
}
if (debug)
{
- System.err.println("Range '" + cl + "' deparsed as [" + from
+ jalview.bin.Console.errPrintln("Range '" + cl + "' deparsed as [" + from
+ "," + to + "]");
}
}
else
{
- System.err.println("ERROR: Invalid Range '" + cl
+ jalview.bin.Console.errPrintln("ERROR: Invalid Range '" + cl
+ "' deparsed as [" + from + "," + to + "]");
}
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"ERROR: Couldn't parse integer from point selection element of column selection string '"
+ cl + "'");
return;
csel.addElement(r);
if (debug)
{
- System.err.println("Point selection '" + cl
+ jalview.bin.Console.errPrintln("Point selection '" + cl
+ "' deparsed as [" + r + "]");
}
}
else
{
- System.err.println("ERROR: Invalid Point selection '" + cl
+ jalview.bin.Console.errPrintln("ERROR: Invalid Point selection '" + cl
+ "' deparsed as [" + r + "]");
}
}
listener = listener.trim();
if (listener.length() == 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"jalview Javascript error: Ignoring empty function for mouseover listener.");
return;
}
.addStructureViewerListener(mol);
if (debug)
{
- System.err.println("Added a mouseover listener for "
+ jalview.bin.Console.errPrintln("Added a mouseover listener for "
+ ((af == null) ? "All frames"
: "Just views for "
+ af.getAlignViewport().getSequenceSetId()));
- System.err.println("There are now " + javascriptListeners.size()
+ jalview.bin.Console.errPrintln("There are now " + javascriptListeners.size()
+ " listeners in total.");
}
}
listener = listener.trim();
if (listener.length() == 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"jalview Javascript error: Ignoring empty function for selection listener.");
return;
}
.addSelectionListener(mol);
if (debug)
{
- System.err.println("Added a selection listener for "
+ jalview.bin.Console.errPrintln("Added a selection listener for "
+ ((af == null) ? "All frames"
: "Just views for "
+ af.getAlignViewport().getSequenceSetId()));
- System.err.println("There are now " + javascriptListeners.size()
+ jalview.bin.Console.errPrintln("There are now " + javascriptListeners.size()
+ " listeners in total.");
}
}
listener = listener.trim();
if (listener.length() == 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"jalview Javascript error: Ignoring empty function for selection listener.");
return;
}
.addStructureViewerListener(mol);
if (debug)
{
- System.err.println("Added a javascript structure viewer listener '"
+ jalview.bin.Console.errPrintln("Added a javascript structure viewer listener '"
+ listener + "'");
- System.err.println("There are now " + javascriptListeners.size()
+ jalview.bin.Console.errPrintln("There are now " + javascriptListeners.size()
+ " listeners in total.");
}
}
rprt = debug;
if (debug)
{
- System.err.println("Removed listener '" + listener + "'");
+ jalview.bin.Console.errPrintln("Removed listener '" + listener + "'");
}
}
else
}
if (rprt)
{
- System.err.println("There are now " + javascriptListeners.size()
+ jalview.bin.Console.errPrintln("There are now " + javascriptListeners.size()
+ " listeners in total.");
}
}
@Override
public void stop()
{
- System.err.println("Applet " + getName() + " stop().");
+ jalview.bin.Console.errPrintln("Applet " + getName() + " stop().");
tidyUp();
}
@Override
public void destroy()
{
- System.err.println("Applet " + getName() + " destroy().");
+ jalview.bin.Console.errPrintln("Applet " + getName() + " destroy().");
tidyUp();
}
}
} catch (NumberFormatException e)
{
- System.err.println("Ignoring invalid residue number string '"
+ jalview.bin.Console.errPrintln("Ignoring invalid residue number string '"
+ pdbResNum + "'");
}
} catch (Exception ex)
{
- System.err.println("Couldn't parse integer arguments (topRow='"
+ jalview.bin.Console.errPrintln("Couldn't parse integer arguments (topRow='"
+ topRow + "' and leftHandColumn='" + leftHandColumn
+ "')");
ex.printStackTrace();
} catch (Exception ex)
{
- System.err.println("Couldn't parse integer arguments (topRow='"
+ jalview.bin.Console.errPrintln("Couldn't parse integer arguments (topRow='"
+ topRow + "')");
ex.printStackTrace();
}
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't parse integer arguments (leftHandColumn='"
+ leftHandColumn + "')");
ex.printStackTrace();
{
if (debug)
{
- System.err.println("Applet context is '"
+ jalview.bin.Console.errPrintln("Applet context is '"
+ getAppletContext().getClass().toString() + "'");
}
JSObject scriptObject = JSObject.getWindow(this);
if (debug && scriptObject != null)
{
- System.err.println("Applet has Javascript callback support.");
+ jalview.bin.Console.errPrintln("Applet has Javascript callback support.");
}
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning: No JalviewLite javascript callbacks available.");
if (debug)
{
if (debug)
{
- System.err.println("JalviewLite Version " + getVersion());
- System.err.println("Build Date : " + getBuildDate());
- System.err.println("Installation : " + getInstallation());
+ jalview.bin.Console.errPrintln("JalviewLite Version " + getVersion());
+ jalview.bin.Console.errPrintln("Build Date : " + getBuildDate());
+ jalview.bin.Console.errPrintln("Installation : " + getInstallation());
}
String externalsviewer = getParameter("externalstructureviewer");
if (externalsviewer != null)
separator = sep;
if (debug)
{
- System.err.println("Separator set to '" + separator + "'");
+ jalview.bin.Console.errPrintln("Separator set to '" + separator + "'");
}
}
else
{
if (tries > 0)
{
- System.err.println("LiveConnect request thread going to sleep.");
+ jalview.bin.Console.errPrintln("LiveConnect request thread going to sleep.");
}
try
{
;
if (tries++ > 0)
{
- System.err.println("LiveConnect request thread woken up.");
+ jalview.bin.Console.errPrintln("LiveConnect request thread woken up.");
}
try
{
}
} catch (Exception jsex)
{
- System.err.println("Attempt " + tries
+ jalview.bin.Console.errPrintln("Attempt " + tries
+ " to access LiveConnect javascript failed.");
}
}
"Calling oninit callback '" + initjscallback + "'.");
} catch (Exception e)
{
- System.err.println("Exception when executing _oninit callback '"
+ jalview.bin.Console.errPrintln("Exception when executing _oninit callback '"
+ initjscallback + "'.");
e.printStackTrace();
}
}
else
{
- System.err.println("Not executing _oninit callback '"
+ jalview.bin.Console.errPrintln("Not executing _oninit callback '"
+ initjscallback + "' - no scripting allowed.");
}
}
((AlignFrame) frame).viewport.applet.currentAlignFrame = (AlignFrame) frame;
if (debug)
{
- System.err.println("Activated window " + frame);
+ jalview.bin.Console.errPrintln("Activated window " + frame);
}
}
// be good.
*
* public void windowDeactivated(WindowEvent e) { if (currentAlignFrame ==
* frame) { currentAlignFrame = null; if (debug) {
- * System.err.println("Deactivated window "+frame); } }
+ * jalview.bin.Console.errPrintln("Deactivated window "+frame); } }
* super.windowDeactivated(e); }
*/
});
}
if (!jmolAvailable)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Jmol not available - Using mc_view for structures");
}
} catch (java.lang.ClassNotFoundException ex)
jmolAvailable = false;
if (debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Skipping Jmol check. Will use mc_view (probably)");
}
}
{
if (JalviewLite.debug)
{
- System.err.println(msg);
+ jalview.bin.Console.errPrintln(msg);
}
}
{
if (debug)
{
- System.err.println("Prepended document base '" + documentBase
+ jalview.bin.Console.errPrintln("Prepended document base '" + documentBase
+ "' to make: '" + withDocBase + "'");
}
protocol = DataSourceType.URL;
protocol = DataSourceType.URL;
if (debug)
{
- System.err.println("Prepended codebase '" + codeBase
+ jalview.bin.Console.errPrintln("Prepended codebase '" + codeBase
+ "' to make: '" + withCodeBase + "'");
}
return withCodeBase;
+ " as "
+ (al1.isNucleotide() ? "protein product" : "cDNA")
+ " for " + af.getTitle();
- System.err.println(msg);
+ jalview.bin.Console.errPrintln(msg);
}
}
dbgMsg(">>>Dump finished.");
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exception when trying to dump the content of the file parameter.");
e.printStackTrace();
}
{
// this may not really be a problem but we give a warning
// anyway
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning: Possible input parsing error: Null sequence for attachment of PDB (sequence "
+ i + ")");
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Annotations were not added from annotation file '"
+ param + "'");
}
{
if (debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Attempting to load T-COFFEE score file from the scoreFile parameter");
}
result = alignFrame.loadScoreFile(sScoreFile);
if (!result)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to parse T-COFFEE parameter as a valid score file ('"
+ sScoreFile + "')");
}
boolean rtn = (getClass().getResourceAsStream("/" + f) != null);
if (debug)
{
- System.err.println("Resource '" + f + "' was "
+ jalview.bin.Console.errPrintln("Resource '" + f + "' was "
+ (rtn ? "" : "not ") + "located by classloader.");
}
return rtn;
} catch (Exception ex)
{
- System.out.println("Exception checking resources: " + f + " " + ex);
+ jalview.bin.Console.outPrintln("Exception checking resources: " + f + " " + ex);
return false;
}
}
{
return initialAlignFrame;
}
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Implementation error: Jalview Applet API cannot work out which AlignFrame to use.");
return null;
}
jv.removeAllElements();
if (debug)
{
- System.err.println("Array from '" + separator
+ jalview.bin.Console.errPrintln("Array from '" + separator
+ "' separated List:\n" + v.length);
for (int i = 0; i < v.length; i++)
{
- System.err.println("item " + i + " '" + v[i] + "'");
+ jalview.bin.Console.errPrintln("item " + i + " '" + v[i] + "'");
}
}
return v;
}
if (debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Empty Array from '" + separator + "' separated List");
}
return null;
{
System.err
.println("Returning '" + separator + "' separated List:\n");
- System.err.println(v);
+ jalview.bin.Console.errPrintln(v);
}
return v.toString();
}
if (debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Returning empty '" + separator + "' separated List\n");
}
return "" + separator;
this.separator = separator;
if (debug)
{
- System.err.println("Default Separator now: '" + separator + "'");
+ jalview.bin.Console.errPrintln("Default Separator now: '" + separator + "'");
}
}
Color col = ColorUtils.parseColourString(colprop);
if (col == null)
{
- System.err.println("Couldn't parse '" + colprop + "' as a colour for "
+ jalview.bin.Console.errPrintln("Couldn't parse '" + colprop + "' as a colour for "
+ colparam);
}
return (col == null) ? defcolour : col;
}
if (debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"resolveUrlForLocalOrAbsolute returning " + resolvedPath);
}
return resolvedPath;
: getDocumentBase());
if (debug)
{
- System.err.println("Show url (prepended " + prepend
+ jalview.bin.Console.errPrintln("Show url (prepended " + prepend
+ " - toggle resolvetocodebase if code/docbase resolution is wrong): "
+ url);
}
{
if (debug)
{
- System.err.println("Show url: " + url);
+ jalview.bin.Console.errPrintln("Show url: " + url);
}
}
if (url.indexOf("javascript:") == 0)
DataSourceType protocol = null;
try
{
- System.out.println("Loading thread started with:\n>>file\n" + file
+ jalview.bin.Console.outPrintln("Loading thread started with:\n>>file\n" + file
+ ">>endfile");
// This might throw a security exception in certain browsers
// Netscape Communicator for instance.
rtn = true;
is.close();
}
- System.err.println("Resource '" + file + "' was "
+ jalview.bin.Console.errPrintln("Resource '" + file + "' was "
+ (rtn ? "" : "not") + " located by classloader.");
if (rtn)
{
} catch (Exception ex)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Exception checking resources: " + file + " " + ex);
}
if (file.indexOf("://") > -1)
protocol = DataSourceType.FILE;
}
- System.out.println("Trying to get contents of resource:");
+ jalview.bin.Console.outPrintln("Trying to get contents of resource:");
FileParse fp = new FileParse(file, protocol);
if (fp.isValid())
{
}
else
{
- System.out.println("Resource at " + file
+ jalview.bin.Console.outPrintln("Resource at " + file
+ " cannot be read with protocol==" + protocol);
return;
}
if (format == null)
{
format = new IdentifyFile().identify(file, protocol);
- System.out.println("Format is " + format);
+ jalview.bin.Console.outPrintln("Format is " + format);
}
else
{
- System.out.println("User specified Format is " + format);
+ jalview.bin.Console.outPrintln("User specified Format is " + format);
}
AlignmentI al = null;
try
al = new AppletFormatAdapter().readFile(file, protocol, format);
} catch (java.io.IOException ex)
{
- System.err.println("Failed to open the file.");
+ jalview.bin.Console.errPrintln("Failed to open the file.");
ex.printStackTrace();
}
if (al != null)
{
- System.out.println(new AppletFormatAdapter()
+ jalview.bin.Console.outPrintln(new AppletFormatAdapter()
.formatSequences(FileFormat.Fasta, al, false));
}
} catch (Exception e)
{
- System.err.println("bailing out : Unexpected exception:");
+ jalview.bin.Console.errPrintln("bailing out : Unexpected exception:");
e.printStackTrace();
}
}
}
else
{
- System.out.println("Unable to setIconImage()");
+ Console.outPrintln("Unable to setIconImage()");
}
}
}
{
private final static String startClass = "jalview.bin.Jalview";
- private static boolean checkJVMSymlink(String testBin)
- {
- File testBinFile = new File(testBin);
- if (!testBinFile.exists())
- {
- return false;
- }
- File targetFile = null;
- try
- {
- targetFile = testBinFile.getCanonicalFile();
- } catch (IOException e)
- {
- return false;
- }
- if (targetFile != null && ("java".equals(targetFile.getName())
- || "java.exe".equals(targetFile.getName())))
- {
- return true;
- }
- return false;
- }
+ private final static String headlessProperty = "java.awt.headless";
/**
* main method for jalview.bin.Launcher. This restarts the same JRE's JVM with
{
if (!LaunchUtils.checkJavaVersion())
{
- System.err.println("WARNING - The Java version being used (Java "
- + LaunchUtils.getJavaVersion()
- + ") may lead to problems. This installation of Jalview should be used with Java "
- + LaunchUtils.getJavaCompileVersion() + ".");
- }
- final String appName = ChannelProperties.getProperty("app_name");
- final String javaBinDir = System.getProperty("java.home")
- + File.separator + "bin" + File.separator;
- String javaBin = null;
- if (javaBin == null && checkJVMSymlink(javaBinDir + appName))
- {
- javaBin = javaBinDir + appName;
- }
- if (javaBin == null && checkJVMSymlink(javaBinDir + "Jalview"))
- {
- javaBin = javaBinDir + "Jalview";
- }
- if (javaBin == null)
- {
- javaBin = "java";
- }
-
- List<String> command = new ArrayList<>();
- command.add(javaBin);
-
- String memSetting = null;
-
- boolean isAMac = System.getProperty("os.name").indexOf("Mac") > -1;
-
- for (String jvmArg : ManagementFactory.getRuntimeMXBean()
- .getInputArguments())
- {
- command.add(jvmArg);
+ jalview.bin.Console
+ .errPrintln("WARNING - The Java version being used (Java "
+ + LaunchUtils.getJavaVersion()
+ + ") may lead to problems. This installation of Jalview should be used with Java "
+ + LaunchUtils.getJavaCompileVersion() + ".");
}
- command.add("-cp");
- command.add(ManagementFactory.getRuntimeMXBean().getClassPath());
String jvmmempc = null;
String jvmmemmax = null;
boolean debug = false;
boolean wait = true;
boolean quiet = false;
+ boolean headless = false;
+ boolean gui = false;
+ boolean stdout = false;
// must set --debug before --launcher...
boolean launcherstop = false;
boolean launcherprint = false;
boolean launcherwait = false;
ArrayList<String> arguments = new ArrayList<>();
+ String previousArg = null;
for (String arg : args)
{
if (arg.equals("--debug"))
{
quiet = true;
}
+ if (arg.equals("--headless"))
+ {
+ headless = true;
+ }
+ if (arg.equals("--gui"))
+ {
+ gui = true;
+ }
+ if (arg.equals("--output=-")
+ || (arg.equals("-") && "--output".equals(previousArg)))
+ {
+ stdout = true;
+ }
if (debug && arg.equals("--launcherprint"))
{
launcherprint = true;
{
wait = false;
}
+ previousArg = arg;
// Don't add the --launcher... args to Jalview launch
if (arg.startsWith("--launcher"))
{
arguments.add(arg);
}
}
+ if (gui)
+ {
+ // --gui takes precedence over --headless
+ headless = false;
+ }
+
+ final String appName = ChannelProperties.getProperty("app_name");
+
+ // if we're using jalview.bin.Launcher we always assume a console is in use
+ final String javaBin = LaunchUtils.findJavaBin(true);
+
+ List<String> command = new ArrayList<>();
+ command.add(javaBin);
+
+ String memSetting = null;
+
+ for (String jvmArg : ManagementFactory.getRuntimeMXBean()
+ .getInputArguments())
+ {
+ command.add(jvmArg);
+ }
+ command.add("-cp");
+ command.add(ManagementFactory.getRuntimeMXBean().getClassPath());
// use saved preferences if no cmdline args
boolean useCustomisedSettings = LaunchUtils
boolean memSet = false;
boolean dockIcon = false;
boolean dockName = false;
+ boolean headlessProp = false;
for (int i = 0; i < command.size(); i++)
{
String arg = command.get(i);
{
dockName = true;
}
+ else if (arg.startsWith("-D" + headlessProperty + "="))
+ {
+ headlessProp = true;
+ }
}
if (!memSet)
}
}
- if (isAMac)
+ if (LaunchUtils.isMac)
{
if (!dockIcon)
{
+ appName);
}
}
+ if (headless && !headlessProp)
+ {
+ System.setProperty(headlessProperty, "true");
+ command.add("-D" + headlessProperty + "=true");
+ }
String scalePropertyArg = HiDPISetting.getScalePropertyArg();
if (scalePropertyArg != null)
{
- sysout(debug, quiet, "Running " + startClass + " with scale setting "
+ syserr(debug, quiet, "Running " + startClass + " with scale setting "
+ scalePropertyArg);
command.add(scalePropertyArg);
}
if ((Boolean.parseBoolean(System.getProperty("launcherprint", "false"))
|| launcherprint))
{
- sysout(debug, quiet,
+ syserr(debug, quiet,
"LAUNCHER COMMAND: " + String.join(" ", builder.command()));
}
- sysout(debug, quiet,
+ syserr(debug, quiet,
"Running " + startClass + " with "
+ (memSetting == null ? "no memory setting"
: ("memory setting " + memSetting)));
if (Boolean.parseBoolean(System.getProperty("launcherstop", "false"))
|| (debug && launcherstop))
{
- sysout(debug, quiet,
+ syserr(debug, quiet,
"System property 'launcherstop' is set and not 'false'. Exiting.");
System.exit(0);
}
Process process = builder.start();
if (wait || launcherwait)
{
- sysout(debug, quiet, "Launching application process");
+ syserr(debug, quiet, "Launching application process");
process.waitFor();
}
else
{
int waitInt = 0;
- sysout(debug, quiet,
+ syserr(debug, quiet,
"Wait time for application process is " + waitInt + "ms");
process.waitFor(waitInt, TimeUnit.MILLISECONDS);
}
- sysout(debug, quiet, "Launcher process ending");
+ syserr(debug, quiet, "Launcher process ending");
} catch (IOException e)
{
if (e.getMessage().toLowerCase(Locale.ROOT).contains("memory"))
{
- System.err.println("Caught a memory exception: " + e.getMessage());
+ jalview.bin.Console
+ .errPrintln("Caught a memory exception: " + e.getMessage());
// Probably the "Cannot allocate memory" error, try without the memory
// setting
ArrayList<String> commandNoMem = new ArrayList<>();
}
final ProcessBuilder builderNoMem = new ProcessBuilder(
commandNoMem);
- System.err.println("Command without memory setting: "
+ jalview.bin.Console.errPrintln("Command without memory setting: "
+ String.join(" ", builderNoMem.command()));
try
{
}
}
- private static void sysout(boolean debug, boolean quiet, String message)
+ private static void syserr(boolean debug, boolean quiet, String message)
{
if (debug && !quiet)
{
- System.out.println("LAUNCHERDEBUG - " + message);
+ jalview.bin.Console.errPrintln("LAUNCHERDEBUG - " + message);
}
}
else
{
// number too big for a Long. Limit to Long.MAX_VALUE
- System.out.println("Memory parsing of '" + memString
+ jalview.bin.Console.outPrintln("Memory parsing of '" + memString
+ "' produces number too big. Limiting to Long.MAX_VALUE="
+ Long.MAX_VALUE);
return Long.MAX_VALUE;
ADJUSTMENT_MESSAGE = reason;
if (!quiet)
{
- System.out.println(reason);
+ jalview.bin.Console.outPrintln(reason);
}
}
Opt.UNARY, Opt.BOOTSTRAP),
HEADLESS(Type.CONFIG,
"Run Jalview in headless mode. No GUI interface will be created and Jalview will quit after all arguments have been processed. "
- + "Headless mode is assumed if an output file is to be generated, this can be overridden with --noheadless or --gui.",
- Opt.BOOLEAN, Opt.BOOTSTRAP),
+ + "Headless mode is assumed if an output file is to be generated, this can be overridden with --gui.",
+ Opt.UNARY, Opt.BOOTSTRAP),
GUI(Type.CONFIG,
"Do not run Jalview in headless mode. This overrides the assumption of headless mode when an output file is to be generated.",
Opt.UNARY, Opt.BOOTSTRAP),
+ "turn-propensity,\n" + "buried-index,\n"
+ "nucleotide,\n" + "nucleotide-ambiguity,\n"
+ "purine-pyrimidine,\n" + "rna-helices,\n"
- + "t-coffee-scores,\n" + "sequence-id.\n"
- +"\n"
+ + "t-coffee-scores,\n" + "sequence-id.\n" + "\n"
+ "Names of user defined colourschemes will also work,\n"
- +"and jalview colourscheme specifications like\n"
- +"--colour=\"D,E=red; K,R,H=0022FF; C,c=yellow\"",
+ + "and jalview colourscheme specifications like\n"
+ + "--colour=\"D,E=red; K,R,H=0022FF; C,c=yellow\"",
Opt.STRING, Opt.LINKED, Opt.ALLOWALL),
FEATURES(Type.OPENING, "Add a feature file or URL to the open alignment.",
Opt.STRING, Opt.LINKED, Opt.MULTI, Opt.ALLOWSUBSTITUTIONS),
+ "clustal (aln),\n" + "phylip (phy),\n"
+ "jalview (jvp, jar).",
Opt.STRING, Opt.LINKED, Opt.ALLOWSUBSTITUTIONS, Opt.ALLOWALL,
- Opt.REQUIREINPUT, Opt.OUTPUTFILE, Opt.PRIMARY),
+ Opt.REQUIREINPUT, Opt.OUTPUTFILE, Opt.STDOUT, Opt.PRIMARY),
FORMAT(Type.OUTPUT,
"Sets the format for the preceding --output file. Valid formats are:\n"
+ "fasta,\n" + "pfam,\n" + "stockholm,\n" + "pir,\n"
*/
OUTPUTFILE("output file --headless will be assumed unless --gui used"),
/*
+ * A STDOUT Arg can take an output filename that can be '-' to mean print to STDOUT.
+ */
+ STDOUT("allows the output filename '" + ArgParser.STDOUTFILENAME
+ + "' to mean output to STDOUT"),
+ /*
* A STORED Arg resets and creates a new set of "opened" linkedIds
*/
STORED(null),
public static final char EQUALS = '=';
+ public static final String STDOUTFILENAME = "-";
+
protected static final String NEGATESTRING = "no";
/**
public ArgParser(String[] args, boolean initsubstitutions,
BootstrapArgs bsa)
{
- // Make a mutable new ArrayList so that shell globbing parser works.
- // (When shell file globbing is used, there are a sequence of non-Arg
- // arguments (which are the expanded globbed filenames) that need to be
- // consumed by the --append/--argfile/etc Arg which is most easily done by
- // removing these filenames from the list one at a time. This can't be done
- // with an ArrayList made with only Arrays.asList(String[] args). )
+ /*
+ * Make a mutable new ArrayList so that shell globbing parser works.
+ * (When shell file globbing is used, there are a sequence of non-Arg
+ * arguments (which are the expanded globbed filenames) that need to be
+ * consumed by the --append/--argfile/etc Arg which is most easily done
+ * by removing these filenames from the list one at a time. This can't be
+ * done with an ArrayList made with only Arrays.asList(String[] args) as
+ * that is not mutable. )
+ */
this(new ArrayList<>(Arrays.asList(args)), initsubstitutions, false,
bsa);
}
boolean allowPrivate)
{
this.substitutions = initsubstitutions;
- boolean openEachInitialFilenames = true;
- for (int i = 0; i < args.size(); i++)
- {
- String arg = args.get(i);
- // If the first arguments do not start with "--" or "-" or is not "open"
- // and` is a filename that exists it is probably a file/list of files to
- // open so we fake an Arg.OPEN argument and when adding files only add the
- // single arg[i] and increment the defaultLinkedIdCounter so that each of
- // these files is opened separately.
- if (openEachInitialFilenames && !arg.startsWith(DOUBLEDASH)
- && !arg.startsWith("-") && !arg.equals("open")
- && (new File(arg).exists()
- || HttpUtils.startsWithHttpOrHttps(arg)))
- {
- arg = Arg.OPEN.argString();
- }
- else
+ /*
+ * If the first argument does not start with "--" or "-" or is not "open",
+ * and is a filename that exists or a URL, it is probably a file/list of
+ * files to open so we insert an Arg.OPEN argument before it. This will
+ * mean the list of files at the start of the arguments are all opened
+ * separately.
+ */
+ if (args.size() > 0)
+ {
+ String arg0 = args.get(0);
+ if (arg0 != null
+ && (!arg0.startsWith(DOUBLEDASH) && !arg0.startsWith("-")
+ && !arg0.equals("open") && (new File(arg0).exists()
+ || HttpUtils.startsWithHttpOrHttps(arg0))))
{
- openEachInitialFilenames = false;
+ // insert "--open" at the start
+ args.add(0, Arg.OPEN.argString());
}
+ }
+
+ for (int i = 0; i < args.size(); i++)
+ {
+ String arg = args.get(i);
// look for double-dash, e.g. --arg
if (arg.startsWith(DOUBLEDASH))
{
// There is no "=" so value is next arg or args (possibly shell
// glob-expanded)
- if ((openEachInitialFilenames ? i : i + 1) >= args.size())
+ if (i + 1 >= args.size())
{
// no value to take for arg, which wants a value
Console.error("Argument '" + a.getName()
{
// if this is the first argument with a file list at the start of
// the args we add filenames from index i instead of i+1
- globVals = getShellGlobbedFilenameValues(a, args,
- openEachInitialFilenames ? i : i + 1);
+ globVals = getShellGlobbedFilenameValues(a, args, i + 1);
}
else
{
private Set<Type> argsTypes = new HashSet<>();
+ private boolean outputToStdout = false;
+
public static BootstrapArgs getBootstrapArgs(String[] args)
{
List<String> argList = new ArrayList<>(Arrays.asList(args));
{
if (argFiles.contains(inArgFile))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Looped argfiles detected: '" + inArgFile.getPath() + "'");
return;
}
}
}
- if (ArgParser.argMap.containsKey(argName) && val == null)
- {
- val = "true";
- }
-
Arg a = ArgParser.argMap.get(argName);
if (a != null)
if (a == null || !a.hasOption(Opt.BOOTSTRAP))
{
- // not a valid bootstrap arg
+ // not a bootstrap arg
+
+ // make a check for an output going to stdout
+ if (a != null && a.hasOption(Opt.OUTPUTFILE)
+ && a.hasOption(Opt.STDOUT))
+ {
+ if (val == null && i + 1 < args.size())
+ {
+ val = args.get(i + 1);
+ }
+ if (val.startsWith("[") && val.indexOf(']') > 0)
+ {
+ val = val.substring(val.indexOf(']') + 1);
+ }
+
+ if (ArgParser.STDOUTFILENAME.equals(val))
+ {
+ this.outputToStdout = true;
+ }
+ }
+
continue;
}
}
else
{
+ if (val == null)
+ {
+ val = "true";
+ }
+
add(a, type, val);
}
}
}
else if (this.contains(Arg.HEADLESS))
{
- // --headless, --noheadless specified => use value
+ // --headless has been specified on the command line => headless
isHeadless = this.getBoolean(Arg.HEADLESS);
}
else if (this.argsHaveOption(Opt.OUTPUTFILE))
}
return isHeadless;
}
+
+ public boolean outputToStdout()
+ {
+ return this.outputToStdout;
+ }
}
{
command.seqs[s].insertCharAt(command.position, command.number,
command.gapChar);
- // System.out.println("pos: "+command.position+" number:
+ // jalview.bin.Console.outPrintln("pos: "+command.position+" number:
// "+command.number);
}
//
// for (int s = 0; s < command.seqs.length; s++)
// {
- // System.out.println("pos: "+command.position+" number: "+command.number);
+ // jalview.bin.Console.outPrintln("pos: "+command.position+" number: "+command.number);
// command.seqs[s].insertCharAt(command.position, command.number,'A');
// }
//
}
else
{
- System.err.println("Can't undo edit action " + action);
+ jalview.bin.Console.errPrintln("Can't undo edit action " + action);
// throw new IllegalStateException("Can't undo edit action " +
// action);
}
ds.setSequenceFeatures(dna.getSequenceFeatures());
// dnaSeqs[i] = ds;
ssm.fromSeq = ds;
- System.out.println("Realised mapped sequence " + ds.getName());
+ jalview.bin.Console.outPrintln("Realised mapped sequence " + ds.getName());
}
}
}
invalidrnastruc = -1;
} catch (WUSSParseException px)
{
- // DEBUG System.out.println(px);
+ // DEBUG jalview.bin.Console.outPrintln(px);
invalidrnastruc = px.getProblemPos();
}
if (invalidrnastruc > -1)
scaleColLabel = true;
_markRnaHelices();
}
- // System.out.println("featuregroup " + _rnasecstr[0].getFeatureGroup());
+ // jalview.bin.Console.outPrintln("featuregroup " + _rnasecstr[0].getFeatureGroup());
}
{
/*
- * System.out.println(this.annotation._rnasecstr[x] + " Begin" +
+ * jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x] + " Begin" +
* this.annotation._rnasecstr[x].getBegin());
*/
- // System.out.println(this.annotation._rnasecstr[x].getFeatureGroup());
+ // jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x].getFeatureGroup());
int val = 0;
try
{
char firstChar = 0;
for (int i = 0; i < annotations.length; i++)
{
- // DEBUG System.out.println(i + ": " + annotations[i]);
+ // DEBUG jalview.bin.Console.outPrintln(i + ": " + annotations[i]);
if (annotations[i] == null)
{
continue;
if (annotations[i].secondaryStructure == 'H'
|| annotations[i].secondaryStructure == 'E')
{
- // DEBUG System.out.println( "/H|E/ '" +
+ // DEBUG jalview.bin.Console.outPrintln( "/H|E/ '" +
// annotations[i].secondaryStructure + "'");
hasIcons |= true;
}
else
// Check for RNA secondary structure
{
- // DEBUG System.out.println( "/else/ '" +
+ // DEBUG jalview.bin.Console.outPrintln( "/else/ '" +
// annotations[i].secondaryStructure + "'");
// TODO: 2.8.2 should this ss symbol validation check be a function in
// RNA/ResidueProperties ?
}
}
- // System.out.println("displaychar " + annotations[i].displayCharacter);
+ // jalview.bin.Console.outPrintln("displaychar " + annotations[i].displayCharacter);
if (annotations[i].displayCharacter == null
|| annotations[i].displayCharacter.length() == 0)
public static void testSelectionViews(AlignmentI alignment,
HiddenColumns hidden, SequenceGroup selection)
{
- System.out.println("Testing standard view creation:\n");
+ jalview.bin.Console.outPrintln("Testing standard view creation:\n");
AlignmentView view = null;
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View with no hidden columns, no limit to selection, no groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, false, false,
false);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View with no hidden columns, no limit to selection, and all groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, false, false,
true);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection marked but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View with no hidden columns, limited to selection and no groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, false, true,
false);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection restricted but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View with no hidden columns, limited to selection, and all groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, false, true,
true);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection restricted and groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View *with* hidden columns, no limit to selection, no groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, true, false,
false);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View *with* hidden columns, no limit to selection, and all groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, true, false,
true);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection marked but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View *with* hidden columns, limited to selection and no groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, true, true,
false);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection restricted but no groups marked.");
}
try
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"View *with* hidden columns, limited to selection, and all groups to be collected:");
view = new AlignmentView(alignment, hidden, selection, true, true,
true);
} catch (Exception e)
{
e.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to generate alignment with selection restricted and groups marked.");
}
if (alignmentIndex < 0 || hiddenSequences[alignmentIndex] != null)
{
- System.out.println("ERROR!!!!!!!!!!!");
+ jalview.bin.Console.outPrintln("ERROR!!!!!!!!!!!");
return;
}
}
else
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
seq.getName() + " has been deleted whilst hidden");
}
}
else
{
// debug
- // System.err.println("Outwith bounds!" + matchStart+">"+end +" or "
+ // jalview.bin.Console.errPrintln("Outwith bounds!" + matchStart+">"+end +" or "
// + matchEnd+"<"+start);
}
}
{
if (name == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"POSSIBLE IMPLEMENTATION ERROR: null sequence name passed to constructor.");
name = "";
}
{
if (sf.getType() == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"SequenceFeature type may not be null: " + sf.toString());
return false;
}
} catch (java.lang.OutOfMemoryError err)
{
// TODO: catch OOM
- System.out.println("Out of memory loading groups: " + err);
+ jalview.bin.Console.outPrintln("Out of memory loading groups: " + err);
}
return upd;
}
int nextQuotePos = descriptor.indexOf(QUOTE, 1);
if (nextQuotePos == -1)
{
- System.err.println(invalidFormat);
+ jalview.bin.Console.errPrintln(invalidFormat);
return null;
}
firstField = descriptor.substring(1, nextQuotePos);
int nextSpacePos = descriptor.indexOf(SPACE);
if (nextSpacePos == -1)
{
- System.err.println(invalidFormat);
+ jalview.bin.Console.errPrintln(invalidFormat);
return null;
}
firstField = descriptor.substring(0, nextSpacePos);
cond = Condition.fromString(leftToParse);
if (cond == null || cond.needsAPattern())
{
- System.err.println(invalidFormat);
+ jalview.bin.Console.errPrintln(invalidFormat);
return null;
}
}
else
{
// unbalanced quote
- System.err.println(invalidFormat);
+ jalview.bin.Console.errPrintln(invalidFormat);
return null;
}
}
if (spacePos == -1)
{
// trailing junk after a match condition
- System.err.println(invalid);
+ jalview.bin.Console.errPrintln(invalid);
return null;
}
String conjunction = leftToParse.substring(0, spacePos);
else
{
// not an AND or an OR - invalid
- System.err.println(invalid);
+ jalview.bin.Console.errPrintln(invalid);
return null;
}
}
int closePos = leftToParse.indexOf(CLOSE_BRACKET);
if (closePos == -1)
{
- System.err.println(invalid);
+ jalview.bin.Console.errPrintln(invalid);
return null;
}
nextCondition = leftToParse.substring(1, closePos);
FeatureMatcher fm = FeatureMatcher.fromString(nextCondition);
if (fm == null)
{
- System.err.println(invalid);
+ jalview.bin.Console.errPrintln(invalid);
return null;
}
try
} catch (IllegalStateException e)
{
// thrown if OR and AND are mixed
- System.err.println(invalid);
+ jalview.bin.Console.errPrintln(invalid);
return null;
}
SequenceFeature sf = contactFeatureEnds.get(index);
if (!sf.isContactFeature())
{
- System.err.println("Error! non-contact feature type " + sf.getType()
+ jalview.bin.Console.errPrintln("Error! non-contact feature type " + sf.getType()
+ " in contact features list");
index++;
continue;
SequenceFeature sf = contactFeatureStarts.get(index);
if (!sf.isContactFeature())
{
- System.err.println("Error! non-contact feature " + sf.toString()
+ jalview.bin.Console.errPrintln("Error! non-contact feature " + sf.toString()
+ " in contact features list");
index++;
continue;
String type = sf.getType();
if (type == null)
{
- System.err.println("Feature type may not be null: " + sf.toString());
+ jalview.bin.Console.errPrintln("Feature type may not be null: " + sf.toString());
return false;
}
return true;
} catch (NumberFormatException e)
{
- System.err.println("Bad integers in description " + description);
+ jalview.bin.Console.errPrintln("Bad integers in description " + description);
}
}
return false;
ids, -1, MODE_MAP, null);
} catch (IOException | ParseException e)
{
- System.err.println("Error parsing " + identifier + " lookup response "
+ jalview.bin.Console.errPrintln("Error parsing " + identifier + " lookup response "
+ e.getMessage());
return null;
}
return (parseAssemblyMappingResponse(url));
} catch (Throwable t)
{
- System.out.println("Error calling " + url + ": " + t.getMessage());
+ jalview.bin.Console.outPrintln("Error calling " + url + ": " + t.getMessage());
return null;
}
}
return null;
} catch (Throwable t)
{
- System.out.println("Error calling " + url + ": " + t.getMessage());
+ jalview.bin.Console.outPrintln("Error calling " + url + ": " + t.getMessage());
return null;
}
}
String ass = mapped.get("assembly_name").toString();
if (assembly != null && !assembly.equals(ass))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"EnsemblMap found multiple assemblies - can't resolve");
return null;
}
String chr = mapped.get("seq_region_name").toString();
if (chromosome != null && !chromosome.equals(chr))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"EnsemblMap found multiple chromosomes - can't resolve");
return null;
}
return pingString != null;
} catch (Throwable t)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error connecting to " + pingUrl + ": " + t.getMessage());
} finally
{
* note: a GET request for an invalid id returns an error code e.g. 415
* but POST request returns 200 and an empty Fasta response
*/
- System.err.println("Response code " + responseCode);// + " for " + url);
+ jalview.bin.Console.errPrintln("Response code " + responseCode);// + " for " + url);
return null;
}
protected HttpURLConnection tryConnection(URL url, List<String> ids,
int readTimeout) throws IOException, ProtocolException
{
- // System.out.println(System.currentTimeMillis() + " " + url);
+ // jalview.bin.Console.outPrintln(System.currentTimeMillis() + " " + url);
HttpURLConnection connection = (HttpURLConnection) url.openConnection();
int retrySecs = Integer.valueOf(retryDelay);
if (retrySecs > 0 && retrySecs < 10)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Ensembl REST service rate limit exceeded, waiting "
+ retryDelay + " seconds before retrying");
Thread.sleep(1000 * retrySecs);
}
} catch (NumberFormatException | InterruptedException e)
{
- System.err.println("Error handling Retry-After: " + e.getMessage());
+ jalview.bin.Console.errPrintln("Error handling Retry-After: " + e.getMessage());
}
}
}
}
} catch (NumberFormatException e)
{
- System.err.println("Error in REST version: " + e.toString());
+ jalview.bin.Console.errPrintln("Error in REST version: " + e.toString());
}
/*
expected) == 1;
if (laterVersion)
{
- System.err.println(String.format(
+ jalview.bin.Console.errPrintln(String.format(
"EnsemblRestClient expected %s REST version %s but found %s, see %s",
getDbSource(), expected, version, REST_CHANGE_LOG));
}
info.restVersion = version;
} catch (Throwable t)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error checking Ensembl REST version: " + t.getMessage());
}
}
domainData.get(getDomain()).dataVersion = versions.get(0).toString();
} catch (Throwable e)
{// could be IOException | ParseException e) {
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error checking Ensembl data version: " + e.getMessage());
}
}
String msg = "Aborting ID retrieval after " + v
+ " chunks. Unexpected problem (" + r.getLocalizedMessage()
+ ")";
- System.err.println(msg);
+ jalview.bin.Console.errPrintln(msg);
r.printStackTrace();
break;
}
}
} catch (IOException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error transferring Ensembl features: " + e.getMessage());
}
// Platform.timeCheck("ESP.addfeat done", Platform.TIME_MARK);
String accId = querySeq.getName();
try
{
- System.out.println("Adding protein product for " + accId);
+ jalview.bin.Console.outPrintln("Adding protein product for " + accId);
AlignmentI protein = new EnsemblProtein(getDomain())
.getSequenceRecords(accId);
if (protein == null || protein.getHeight() == 0)
{
- System.out.println("No protein product found for " + accId);
+ jalview.bin.Console.outPrintln("No protein product found for " + accId);
return;
}
SequenceI proteinSeq = protein.getSequenceAt(0);
seq.addDBRef(xrefs.get(i));
}
- // System.out.println("primaries are " + seq.getPrimaryDBRefs().toString());
+ // jalview.bin.Console.outPrintln("primaries are " + seq.getPrimaryDBRefs().toString());
/*
* and add a reference to itself
*/
if (seqs.size() != ids.size())
{
- System.out.println(String.format(
+ jalview.bin.Console.outPrintln(String.format(
"Only retrieved %d sequences for %d query strings",
seqs.size(), ids.size()));
}
result.add(sequence);
} catch (ParseException | IOException e)
{
- System.err.println("Error processing JSON response: " + e.toString());
+ jalview.bin.Console.errPrintln("Error processing JSON response: " + e.toString());
// ignore
}
// Platform.timeCheck("ENS seqproxy2", Platform.TIME_MARK);
if (regions.isEmpty())
{
- System.out.println("Failed to identify target sequence for " + accId
+ jalview.bin.Console.outPrintln("Failed to identify target sequence for " + accId
+ " from genomic features");
return null;
}
boolean result = transferFeatures(sfs, targetSequence, mapping,
accessionId);
- // System.out.println("transferFeatures (" + (sfs.size()) + " --> "
+ // jalview.bin.Console.outPrintln("transferFeatures (" + (sfs.size()) + " --> "
// + targetSequence.getFeatures().getFeatureCount(true) + ") to "
// + targetSequence.getName() + " took "
// + (System.currentTimeMillis() - start) + "ms");
{
if (!isValid() || !refFile.isIndexed())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Cannot read contig as file is invalid or not indexed");
return null;
}
public void createImage(String file, String type, int quality)
{
- System.out.println("JMOL CREATE IMAGE");
+ jalview.bin.Console.outPrintln("JMOL CREATE IMAGE");
}
@Override
public String createImage(String fileName, String type,
Object textOrBytes, int quality)
{
- System.out.println("JMOL CREATE IMAGE");
+ jalview.bin.Console.outPrintln("JMOL CREATE IMAGE");
return null;
}
@Override
public String eval(String strEval)
{
- // System.out.println(strEval);
+ // jalview.bin.Console.outPrintln(strEval);
// "# 'eval' is implemented only for the applet.";
return null;
}
lastMessage = strInfo;
if (data != null)
{
- System.err.println("Ignoring additional hover info: " + data
+ jalview.bin.Console.errPrintln("Ignoring additional hover info: " + data
+ " (other info: '" + strInfo + "' pos " + atomIndex + ")");
}
mouseOverStructure(atomIndex, strInfo);
*/
if (strData != null)
{
- System.err.println("Ignoring additional pick data string " + strData);
+ jalview.bin.Console.errPrintln("Ignoring additional pick data string " + strData);
}
int chainSeparator = strInfo.indexOf(":");
int p = 0;
(data == null) ? ((String) null) : (String) data[1]);
break;
case ERROR:
- // System.err.println("Ignoring error callback.");
+ // jalview.bin.Console.errPrintln("Ignoring error callback.");
break;
case SYNC:
case RESIZE:
case CLICK:
default:
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unhandled callback " + type + " " + data[1].toString());
break;
}
} catch (Exception e)
{
- System.err.println("Squashed Jmol callback handler error:");
+ jalview.bin.Console.errPrintln("Squashed Jmol callback handler error:");
e.printStackTrace();
}
}
public void setCallbackFunction(String callbackType,
String callbackFunction)
{
- System.err.println("Ignoring set-callback request to associate "
+ jalview.bin.Console.errPrintln("Ignoring set-callback request to associate "
+ callbackType + " with function " + callbackFunction);
}
String buttonsToShow)
{
- System.err.println("Allocating Jmol Viewer: " + commandOptions);
+ jalview.bin.Console.errPrintln("Allocating Jmol Viewer: " + commandOptions);
if (commandOptions == null)
{
console = createJmolConsole(consolePanel, buttonsToShow);
} catch (Throwable e)
{
- System.err.println("Could not create Jmol application console. "
+ jalview.bin.Console.errPrintln("Could not create Jmol application console. "
+ e.getMessage());
e.printStackTrace();
}
}
} catch (OutOfMemoryError er)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"OUT OF MEMORY LOADING TRANSFORMING JMOL MODEL TO JALVIEW MODEL");
throw new IOException(MessageManager
.getString("exception.outofmemory_loading_mmcif_file"));
org.jmol.modelset.Atom prevAtom,
HashMap<String, org.jmol.modelset.Atom> chainTerMap)
{
- // System.out.println("Atom: " + curAtom.getAtomNumber()
+ // jalview.bin.Console.outPrintln("Atom: " + curAtom.getAtomNumber()
// + " Last atom index " + curAtom.group.lastAtomIndex);
if (chainTerMap == null || prevAtom == null)
{
if (sval == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"DEVELOPER WARNING: Annotate3d didn't return a '2D' tag in its response. Consider checking output of server. Response was :"
+ val.toString());
boolean getReply)
{
String postBody = getPostRequest(command);
- // System.out.println(postBody);// debug
+ // jalview.bin.Console.outPrintln(postBody);// debug
String rpcUrl = "http://127.0.0.1:" + this.pymolXmlRpcPort;
PrintWriter out = null;
BufferedReader in = null;
}
else if (message.startsWith(MODEL_CHANGED))
{
- System.err.println(message);
+ jalview.bin.Console.errPrintln(message);
processModelChanged(message.substring(MODEL_CHANGED.length()));
}
else
{
- System.err.println("Unexpected chimeraNotification: " + message);
+ jalview.bin.Console.errPrintln("Unexpected chimeraNotification: " + message);
}
}
}
*/
protected void processModelChanged(String message)
{
- // System.out.println(message + " (not implemented in Jalview)");
+ // jalview.bin.Console.outPrintln(message + " (not implemented in Jalview)");
}
/**
startListening(chimeraListener.getUri());
} catch (BindException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to start Chimera listener: " + e.getMessage());
}
}
private void log(String message)
{
- System.err.println("## Chimera log: " + message);
+ jalview.bin.Console.errPrintln("## Chimera log: " + message);
}
/**
executeCommand(false, null, command);
} catch (IOException e)
{
- System.err.println("Sending commands to Chimera via file failed with "
+ jalview.bin.Console.errPrintln("Sending commands to Chimera via file failed with "
+ e.getMessage());
}
}
int x = 0;
for (FTSDataColumnI field : allFTSDataColumns)
{
- // System.out.println("allFTSDataColumns==" + allFTSDataColumns);
+ // jalview.bin.Console.outPrintln("allFTSDataColumns==" + allFTSDataColumns);
if (field.getName().equalsIgnoreCase("all"))
{
continue;
data[x++] = new Object[] { ftsRestClient
.getAllDefaultDisplayedFTSDataColumns().contains(field),
field.getName(), field.getGroup() };
- // System.out.println(" PUIS " + field.getName() + " ET AUSSI " +
+ // jalview.bin.Console.outPrintln(" PUIS " + field.getName() + " ET AUSSI " +
// field.getGroup() + "X = " + x);
break;
case STRUCTURE_CHOOSER:
} catch (Exception e)
{
e.printStackTrace();
- System.out.println("offending value:" + fieldData);
+ jalview.bin.Console.outPrintln("offending value:" + fieldData);
}
}
}
URI uri = webResource.getURI();
- System.out.println(uri);
+ jalview.bin.Console.outPrintln(uri);
ClientResponse clientResponse = null;
int responseStatus = -1;
// Get the JSON string from the response object or directly from the
Map<String, Object> jsonObj = null;
String responseString = null;
- System.out.println("query >>>>>>> " + pdbRestRequest.toString());
+ jalview.bin.Console.outPrintln("query >>>>>>> " + pdbRestRequest.toString());
if (!isMocked())
{
for (FTSDataColumnI field : diplayFields)
{
- // System.out.println("Field " + field);
+ // jalview.bin.Console.outPrintln("Field " + field);
String fieldData = (pdbJsonDoc.get(field.getCode()) == null) ? ""
: pdbJsonDoc.get(field.getCode()).toString();
- // System.out.println("Field Data : " + fieldData);
+ // jalview.bin.Console.outPrintln("Field Data : " + fieldData);
if (field.isPrimaryKeyColumn())
{
primaryKey = fieldData;
} catch (Exception e)
{
e.printStackTrace();
- System.out.println("offending value:" + fieldData);
+ jalview.bin.Console.outPrintln("offending value:" + fieldData);
}
}
}
@Override
protected void showHelp()
{
- System.out.println("No help implemented yet.");
+ jalview.bin.Console.outPrintln("No help implemented yet.");
}
webResource = client.resource(DEFAULT_THREEDBEACONS_DOMAIN + query);
URI uri = webResource.getURI();
- System.out.println(uri.toString());
+ jalview.bin.Console.outPrintln(uri.toString());
// Execute the REST request
ClientResponse clientResponse;
String fieldData = (tdbJsonStructure.get(field.getCode()) == null)
? " "
: tdbJsonStructure.get(field.getCode()).toString();
- // System.out.println("Field : " + field + " Data : " + fieldData);
+ // jalview.bin.Console.outPrintln("Field : " + field + " Data : " + fieldData);
if (field.isPrimaryKeyColumn())
{
primaryKey = fieldData;
} catch (Exception e)
{
// e.printStackTrace();
- System.out.println("offending value:" + fieldData + fieldData);
+ jalview.bin.Console.outPrintln("offending value:" + fieldData + fieldData);
}
}
}
.getEntity(String.class);
// Make redundant objects eligible for garbage collection to conserve
// memory
- // System.out.println(">>>>> response : "
+ // jalview.bin.Console.outPrintln(">>>>> response : "
// + uniProtTabDelimittedResponseString);
if (clientResponse.getStatus() != 200)
{
firstRow = false;
continue;
}
- // System.out.println(dataRow);
+ // jalview.bin.Console.outPrintln(dataRow);
result.add(getFTSData(dataRow, uniprotRestRequest));
}
searchResult.setNumberOfItemsFound(xTotalResults);
} catch (Exception e)
{
e.printStackTrace();
- System.out.println("offending value:" + fieldData);
+ jalview.bin.Console.outPrintln("offending value:" + fieldData);
}
}
} catch (Exception e)
import java.io.File;
import java.io.FileWriter;
import java.io.IOException;
+import java.io.OutputStreamWriter;
import java.io.PrintWriter;
import java.net.URL;
import java.util.ArrayList;
import jalview.viewmodel.ViewportRanges;
import jalview.ws.DBRefFetcher;
import jalview.ws.DBRefFetcher.FetchFinishedListenerI;
-import jalview.ws.datamodel.alphafold.PAEContactMatrix;
import jalview.ws.jws1.Discoverer;
import jalview.ws.jws2.Jws2Discoverer;
import jalview.ws.jws2.jabaws2.Jws2Instance;
// if (viewport.cursorMode)
// {
// alignPanel.seqPanel.insertNucAtCursor(false,"A");
- // //System.out.println("A");
+ // //jalview.bin.Console.outPrintln("A");
// }
// break;
/*
* case KeyEvent.VK_CLOSE_BRACKET: if (viewport.cursorMode) {
- * System.out.println("closing bracket"); } break;
+ * jalview.bin.Console.outPrintln("closing bracket"); } break;
*/
case KeyEvent.VK_DELETE:
case KeyEvent.VK_BACK_SPACE:
@Override
public void propertyChange(PropertyChangeEvent evt)
{
- // // System.out.println("Discoverer property change.");
+ // // jalview.bin.Console.outPrintln("Discoverer property
+ // change.");
// if (evt.getPropertyName().equals("services"))
{
SwingUtilities.invokeLater(new Runnable()
@Override
public void run()
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Rebuild WS Menu for service change");
BuildWebServiceMenu();
}
public void internalFrameClosed(
javax.swing.event.InternalFrameEvent evt)
{
- // System.out.println("deregistering discoverer listener");
+ // jalview.bin.Console.outPrintln("deregistering discoverer listener");
Desktop.instance.removeJalviewPropertyChangeListener("services",
thisListener);
closeMenuItem_actionPerformed(true);
*/
public void saveAlignment(String file, FileFormatI format)
{
+ saveAlignment(file, format, false);
+ }
+
+ public void saveAlignment(String file, FileFormatI format, boolean stdout)
+ {
lastSaveSuccessful = true;
- lastFilenameSaved = file;
+ if (!stdout)
+ {
+ lastFilenameSaved = file;
+ }
lastFormatSaved = format;
if (FileFormat.Jalview.equals(format))
shortName = shortName
.substring(shortName.lastIndexOf(File.separatorChar) + 1);
}
+ // TODO deal with stdout=true
lastSaveSuccessful = new Jalview2XML().saveAlignment(this, file,
shortName);
else
{
// create backupfiles object and get new temp filename destination
- boolean doBackup = BackupFiles.getEnabled();
+ boolean doBackup = BackupFiles.getEnabled() && !stdout;
BackupFiles backupfiles = null;
if (doBackup)
{
String tempFilePath = doBackup ? backupfiles.getTempFilePath()
: file;
Console.trace("ALIGNFRAME setting PrintWriter");
- PrintWriter out = new PrintWriter(new FileWriter(tempFilePath));
+ PrintWriter out = stdout
+ ? new PrintWriter(new OutputStreamWriter(System.out))
+ : new PrintWriter(new FileWriter(tempFilePath));
if (backupfiles != null)
{
}
out.print(output);
- Console.trace("ALIGNFRAME about to close file");
- out.close();
- Console.trace("ALIGNFRAME closed file");
- AlignFrame.this.setTitle(file);
- statusBar.setText(MessageManager.formatMessage(
- "label.successfully_saved_to_file_in_format", new Object[]
- { fileName, format.getName() }));
+ out.flush();
+ if (!stdout)
+ {
+ Console.trace("ALIGNFRAME about to close file");
+ out.close();
+ Console.trace("ALIGNFRAME closed file");
+ }
+ AlignFrame.this.setTitle(stdout ? "STDOUT" : file);
+ if (stdout)
+ {
+ statusBar.setText(MessageManager.formatMessage(
+ "label.successfully_printed_to_stdout_in_format",
+ new Object[]
+ { format.getName() }));
+ }
+ else
+ {
+ statusBar.setText(MessageManager.formatMessage(
+ "label.successfully_saved_to_file_in_format",
+ new Object[]
+ { fileName, format.getName() }));
+ }
lastSaveSuccessful = true;
} catch (IOException e)
{
protected void htmlMenuItem_actionPerformed(ActionEvent e)
{
HtmlSvgOutput htmlSVG = new HtmlSvgOutput(alignPanel);
- try {
+ try
+ {
htmlSVG.exportHTML(null);
- } catch (ImageOutputException x) {
+ } catch (ImageOutputException x)
+ {
// report problem to console and raise dialog
}
}
public void bioJSMenuItem_actionPerformed(ActionEvent e)
{
BioJsHTMLOutput bjs = new BioJsHTMLOutput(alignPanel);
- try {
- bjs.exportHTML(null);
- } catch (ImageOutputException x) {
- // report problem to console and raise dialog
- }
+ try
+ {
+ bjs.exportHTML(null);
+ } catch (ImageOutputException x)
+ {
+ // report problem to console and raise dialog
+ }
}
public void createImageMap(File file, String image)
{
- try {
- alignPanel.makePNGImageMap(file, image);
- } catch (ImageOutputException x) {
+ try
+ {
+ alignPanel.makePNGImageMap(file, image);
+ } catch (ImageOutputException x)
+ {
// report problem to console and raise dialog
}
}
@Override
- public void createPNG_actionPerformed(ActionEvent e) {
- try{
+ public void createPNG_actionPerformed(ActionEvent e)
+ {
+ try
+ {
createPNG(null);
} catch (ImageOutputException ioex)
{
// raise dialog, and report via console
}
}
+
@Override
- public void createEPS_actionPerformed(ActionEvent e) {
- try{
+ public void createEPS_actionPerformed(ActionEvent e)
+ {
+ try
+ {
createEPS(null);
} catch (ImageOutputException ioex)
{
// raise dialog, and report via console
}
-
+
}
+
@Override
- public void createSVG_actionPerformed(ActionEvent e) {
- try{
+ public void createSVG_actionPerformed(ActionEvent e)
+ {
+ try
+ {
createSVG(null);
} catch (ImageOutputException ioex)
{
// raise dialog, and report via console
}
-
+
}
+
/**
* Creates a PNG image of the alignment and writes it to the given file. If
* the file is null, the user is prompted to choose a file.
createPNG(f, null, BitmapImageSizing.nullBitmapImageSizing());
}
- public void createPNG(File f, String renderer, BitmapImageSizing userBis) throws ImageOutputException
+ public void createPNG(File f, String renderer, BitmapImageSizing userBis)
+ throws ImageOutputException
{
alignPanel.makeAlignmentImage(TYPE.PNG, f, renderer, userBis);
}
*
* @param f
*/
- public void createEPS(File f) throws ImageOutputException
+ public void createEPS(File f) throws ImageOutputException
{
createEPS(f, null);
}
*
* @param f
*/
- public void createSVG(File f) throws ImageOutputException
+ public void createSVG(File f) throws ImageOutputException
{
createSVG(f, null);
}
closeAllTabs = true;
}
+ Desktop.closeModal(this);
+
try
{
if (alignPanels != null)
featureSettings.close();
featureSettings = null;
}
+
/*
* this will raise an INTERNAL_FRAME_CLOSED event and this method will
* be called recursively, with the frame now in 'closed' state
// annotation was duplicated earlier
alignment.addAnnotation(sequences[i].getAnnotation()[a]);
// take care of contact matrix too
- ContactMatrixI cm=sequences[i].getContactMatrixFor(sequences[i].getAnnotation()[a]);
- if (cm!=null)
+ ContactMatrixI cm = sequences[i]
+ .getContactMatrixFor(sequences[i].getAnnotation()[a]);
+ if (cm != null)
{
- alignment.addContactListFor(sequences[i].getAnnotation()[a], cm);
+ alignment.addContactListFor(sequences[i].getAnnotation()[a],
+ cm);
}
-
+
alignment.setAnnotationIndex(sequences[i].getAnnotation()[a],
a);
}
} catch (Exception ex)
{
ex.printStackTrace();
- System.out.println("Exception whilst pasting: " + ex);
+ jalview.bin.Console.outPrintln("Exception whilst pasting: " + ex);
// could be anything being pasted in here
}
} catch (Exception ex)
{
ex.printStackTrace();
- System.out.println("Exception whilst pasting: " + ex);
+ jalview.bin.Console.outPrintln("Exception whilst pasting: " + ex);
// could be anything being pasted in here
} catch (OutOfMemoryError oom)
{
@Override
public void wrapMenuItem_actionPerformed(ActionEvent e)
{
- scaleAbove.setVisible(wrapMenuItem.isSelected());
- scaleLeft.setVisible(wrapMenuItem.isSelected());
- scaleRight.setVisible(wrapMenuItem.isSelected());
- viewport.setWrapAlignment(wrapMenuItem.isSelected());
+ setWrapFormat(wrapMenuItem.isSelected(), false);
+ }
+
+ public void setWrapFormat(boolean b, boolean setMenuItem)
+ {
+ scaleAbove.setVisible(b);
+ scaleLeft.setVisible(b);
+ scaleRight.setVisible(b);
+ viewport.setWrapAlignment(b);
alignPanel.updateLayout();
+ if (setMenuItem)
+ {
+ wrapMenuItem.setSelected(b);
+ }
}
@Override
}
JInternalFrame frame = new JInternalFrame();
-
+ frame.setFrameIcon(null);
frame.getContentPane().add(new JScrollPane(pane));
Desktop.addInternalFrame(frame, MessageManager
return alignPanel.overviewPanel;
}
JInternalFrame frame = new JInternalFrame();
+ frame.setFrameIcon(null);
final OverviewPanel overview = new OverviewPanel(alignPanel, frame,
showHidden);
frame.setContentPane(overview);
Desktop.addInternalFrame(frame, "", true, frame.getWidth(),
frame.getHeight(), true, true);
- frame.setFrameIcon(null);
frame.pack();
frame.setLayer(JLayeredPane.PALETTE_LAYER);
final AlignmentPanel thePanel = this.alignPanel;
else
{
JInternalFrame frame = new JInternalFrame();
+ frame.setFrameIcon(null);
frame.setContentPane(new PairwiseAlignPanel(viewport));
Desktop.addInternalFrame(frame,
MessageManager.getString("action.pairwise_alignment"), 600,
return tp;
}
- public void showContactMapTree(AlignmentAnnotation aa,
- ContactMatrixI cm)
+ public void showContactMapTree(AlignmentAnnotation aa, ContactMatrixI cm)
{
int x = 4, y = 5;
int w = 400, h = 500;
{
NewickFile fin = new NewickFile(
new FileParse(cm.getNewick(), DataSourceType.PASTE));
- String title = aa.label + " "
- + cm.getTreeMethod() + " tree" + (aa.sequenceRef != null
+ String title = aa.label + " " + cm.getTreeMethod() + " tree"
+ + (aa.sequenceRef != null
? (" for " + aa.sequenceRef.getDisplayId(false))
: "");
{
try
{
- System.err.println("Waiting for building menu to finish.");
+ jalview.bin.Console
+ .errPrintln("Waiting for building menu to finish.");
Thread.sleep(10);
} catch (Exception e)
{
final List<JMenuItem> legacyItems = new ArrayList<>();
try
{
- // System.err.println("Building ws menu again "
+ // jalview.bin.Console.errPrintln("Building ws menu again "
// + Thread.currentThread());
// TODO: add support for context dependent disabling of services based
// on
Desktop.instance);
if (pe != null)
{
- System.err.println("Associated file : "
+ jalview.bin.Console.errPrintln("Associated file : "
+ (fm[0].toString()) + " with "
+ toassoc.getDisplayId(true));
assocfiles++;
viewport.getAlignment()));
} catch (Exception ex)
{
- System.err.println(ex.getMessage());
+ jalview.bin.Console.errPrintln(ex.getMessage());
return;
}
}
console.runScript();
} catch (Exception ex)
{
- System.err.println((ex.toString()));
+ jalview.bin.Console.errPrintln((ex.toString()));
JvOptionPane.showInternalMessageDialog(Desktop.desktop,
MessageManager.getString("label.couldnt_run_groovy_script"),
MessageManager.getString("label.groovy_support_failed"),
}
else
{
- System.err.println("Can't run Groovy script as console not found");
+ jalview.bin.Console
+ .errPrintln("Can't run Groovy script as console not found");
}
}
import jalview.commands.CommandI;
import jalview.datamodel.AlignedCodonFrame;
import jalview.datamodel.Alignment;
-import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.ColumnSelection;
import jalview.datamodel.ContactMatrixI;
import jalview.bin.Cache;
import jalview.bin.Console;
import jalview.bin.Jalview;
+import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.HiddenColumns;
import jalview.datamodel.SearchResultsI;
Dimension r = null;
if (av.getIdWidth() < 0)
{
- int afwidth = (alignFrame != null ? alignFrame.getWidth() : 300);
- int idWidth = Math.min(afwidth - 200, 2 * afwidth / 3);
- int maxwidth = Math.max(IdwidthAdjuster.MIN_ID_WIDTH, idWidth);
- r = calculateIdWidth(maxwidth);
+ r = calculateDefaultAlignmentIdWidth();
av.setIdWidth(r.width);
}
else
return r;
}
+ public Dimension calculateDefaultAlignmentIdWidth()
+ {
+ int afwidth = (alignFrame != null ? alignFrame.getWidth() : 300);
+ int idWidth = Math.min(afwidth - 200, 2 * afwidth / 3);
+ int maxwidth = Math.max(IdwidthAdjuster.MIN_ID_WIDTH, idWidth);
+ return calculateIdWidth(-1, false, false);
+ }
+
/**
* Calculate the width of the alignment labels based on the displayed names
* and any bounds on label width set in preferences.
*/
protected Dimension calculateIdWidth(int maxwidth)
{
+ return calculateIdWidth(maxwidth, true, false);
+ }
+
+ public Dimension calculateIdWidth(int maxwidth,
+ boolean includeAnnotations, boolean visibleOnly)
+ {
Container c = new Container();
FontMetrics fm = c.getFontMetrics(
}
// Also check annotation label widths
- i = 0;
-
- if (al.getAlignmentAnnotation() != null)
+ if (includeAnnotations && al.getAlignmentAnnotation() != null)
{
- fm = c.getFontMetrics(getAlabels().getFont());
-
- while (i < al.getAlignmentAnnotation().length)
+ if (Jalview.isHeadlessMode())
{
- String label = al.getAlignmentAnnotation()[i].label;
- int stringWidth = fm.stringWidth(label);
+ AnnotationLabels aal = this.getAlabels();
+ int stringWidth = aal.drawLabels(null, false, idWidth, false, fm);
idWidth = Math.max(idWidth, stringWidth);
- i++;
+ }
+ else
+ {
+ fm = c.getFontMetrics(getAlabels().getFont());
+
+ for (i = 0; i < al.getAlignmentAnnotation().length; i++)
+ {
+ AlignmentAnnotation aa = al.getAlignmentAnnotation()[i];
+ if (visibleOnly && !aa.visible)
+ {
+ continue;
+ }
+ String label = aa.label;
+ int stringWidth = fm.stringWidth(label);
+ idWidth = Math.max(idWidth, stringWidth);
+ }
}
}
// this is called after loading new annotation onto alignment
if (alignFrame.getHeight() == 0)
{
- System.out.println("NEEDS FIXING");
+ jalview.bin.Console.outPrintln("NEEDS FIXING");
}
validateAnnotationDimensions(true);
addNotify();
// not be called directly by programs.
// I note that addNotify() is called in several areas of Jalview.
- int annotationHeight = getAnnotationPanel().adjustPanelHeight();
- annotationHeight = getAnnotationPanel()
- .adjustForAlignFrame(adjustPanelHeight, annotationHeight);
+ AnnotationPanel ap = getAnnotationPanel();
+ int annotationHeight = ap.adjustPanelHeight();
+ annotationHeight = ap.adjustForAlignFrame(adjustPanelHeight,
+ annotationHeight);
hscroll.addNotify();
- annotationScroller.setPreferredSize(
- new Dimension(annotationScroller.getWidth(), annotationHeight));
-
Dimension e = idPanel.getSize();
- alabels.setSize(new Dimension(e.width, annotationHeight));
+ int idWidth = e.width;
+ boolean manuallyAdjusted = this.getIdPanel().getIdCanvas()
+ .manuallyAdjusted();
+ annotationScroller.setPreferredSize(new Dimension(
+ manuallyAdjusted ? idWidth : annotationScroller.getWidth(),
+ annotationHeight));
+
+ alabels.setPreferredSize(new Dimension(idWidth, annotationHeight));
annotationSpaceFillerHolder.setPreferredSize(new Dimension(
- annotationSpaceFillerHolder.getWidth(), annotationHeight));
+ manuallyAdjusted ? idWidth
+ : annotationSpaceFillerHolder.getWidth(),
+ annotationHeight));
annotationScroller.validate();
annotationScroller.addNotify();
+ ap.validate();
}
/**
boolean wrap = av.getWrapAlignment();
ViewportRanges ranges = av.getRanges();
ranges.setStartSeq(0);
- scalePanelHolder.setVisible(!wrap);
+ // scalePanelHolder.setVisible(!wrap);
hscroll.setVisible(!wrap);
- idwidthAdjuster.setVisible(!wrap);
+ // Allow idPanel width adjustment in wrap mode
+ idwidthAdjuster.setVisible(true);
if (wrap)
{
}
}
- idSpaceFillerPanel1.setVisible(!wrap);
+ // idSpaceFillerPanel1.setVisible(!wrap);
repaint();
}
public void paintComponent(Graphics g)
{
invalidate(); // needed so that the id width adjuster works correctly
-
Dimension d = getIdPanel().getIdCanvas().getPreferredSize();
- idPanelHolder.setPreferredSize(d);
- hscrollFillerPanel.setPreferredSize(new Dimension(d.width, 12));
+ int idWidth = d.width;
+
+ // check wrapped alignment as at least 1 residue width
+ if (av.getWrapAlignment())
+ {
+ SeqCanvas sc = this.getSeqPanel().seqCanvas;
+ if (sc != null && sc.getWidth() < sc.getMinimumWrappedCanvasWidth())
+ {
+ // need to make some adjustments
+ idWidth -= (sc.getMinimumWrappedCanvasWidth() - sc.getWidth());
+ av.setIdWidth(idWidth);
+ av.getAlignPanel().getIdPanel().getIdCanvas()
+ .setManuallyAdjusted(true);
+
+ validateAnnotationDimensions(false);
+ }
+ }
+
+ idPanelHolder.setPreferredSize(new Dimension(idWidth, d.height));
+ hscrollFillerPanel.setPreferredSize(new Dimension(idWidth, 12));
validate(); // needed so that the id width adjuster works correctly
}
int w = getIdPanel().getWidth();
+ w = this.calculateIdWidth(-1, true, true).width;
return (w > 0 ? w : calculateIdWidth().width);
}
- void makeAlignmentImage(ImageMaker.TYPE type, File file, String renderer) throws ImageOutputException
+ void makeAlignmentImage(ImageMaker.TYPE type, File file, String renderer)
+ throws ImageOutputException
{
makeAlignmentImage(type, file, renderer,
BitmapImageSizing.nullBitmapImageSizing());
final int borderBottomOffset = 5;
AlignmentDimension aDimension = getAlignmentDimension();
+
// todo use a lambda function in place of callback here?
ImageWriterI writer = new ImageWriterI()
{
}
- public void makePNGImageMap(File imgMapFile, String imageName) throws ImageOutputException
+ public void makePNGImageMap(File imgMapFile, String imageName)
+ throws ImageOutputException
{
// /////ONLY WORKS WITH NON WRAPPED ALIGNMENTS
// ////////////////////////////////////////////
} catch (Exception ex)
{
- throw new ImageOutputException("couldn't write ImageMap due to unexpected error",ex);
+ throw new ImageOutputException(
+ "couldn't write ImageMap due to unexpected error", ex);
}
} // /////////END OF IMAGE MAP
{
int seqPanelWidth = getSeqPanel().seqCanvas.getWidth();
- if (System.getProperty("java.awt.headless") != null
- && System.getProperty("java.awt.headless").equals("true"))
+ if (Jalview.isHeadlessMode())
{
seqPanelWidth = alignFrame.getWidth() - getVisibleIdWidth()
- vscroll.getPreferredSize().width
*/
package jalview.gui;
+import java.awt.Canvas;
import java.awt.Color;
import java.awt.Cursor;
import java.awt.Dimension;
import jalview.analysis.AlignSeq;
import jalview.analysis.AlignmentUtils;
+import jalview.bin.Cache;
+import jalview.bin.Jalview;
import jalview.datamodel.Alignment;
import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.Annotation;
/**
* height in pixels for allowing height adjuster to be active
*/
- private static int HEIGHT_ADJUSTER_HEIGHT = 10;
+ public static int HEIGHT_ADJUSTER_HEIGHT = 10;
private static final Font font = new Font("Arial", Font.PLAIN, 11);
private static final String COPYCONS_SEQ = MessageManager
.getString("label.copy_consensus_sequence");
+ private static final String ADJUST_ANNOTATION_LABELS_WIDTH_PREF = "ADJUST_ANNOTATION_LABELS_WIDTH";
+
private final boolean debugRedraw = false;
private AlignmentPanel ap;
private boolean resizePanel = false;
+ private int annotationIdWidth = -1;
+
+ public static final String RESIZE_MARGINS_MARK_PREF = "RESIZE_MARGINS_MARK";
+
/**
* Creates a new AnnotationLabels object
*
*/
public AnnotationLabels(AlignmentPanel ap)
{
-
this.ap = ap;
av = ap.av;
ToolTipManager.sharedInstance().registerComponent(this);
pop.add(consclipbrd);
}
- addColourOrFilterByOptions(ap,aa[selectedRow],pop);
-
+ addColourOrFilterByOptions(ap, aa[selectedRow], pop);
+
if (aa[selectedRow].graph == AlignmentAnnotation.CONTACT_MAP)
{
- addContactMatrixOptions(ap,aa[selectedRow],pop);
- // Set/adjust threshold for grouping ?
- // colour alignment by this [type]
- // select/hide columns by this row
-
- }
+ addContactMatrixOptions(ap, aa[selectedRow], pop);
+ // Set/adjust threshold for grouping ?
+ // colour alignment by this [type]
+ // select/hide columns by this row
+
}
-
+ }
+
pop.show(this, evt.getX(), evt.getY());
}
static void addColourOrFilterByOptions(final AlignmentPanel ap,
- final AlignmentAnnotation alignmentAnnotation, final JPopupMenu pop)
+ final AlignmentAnnotation alignmentAnnotation,
+ final JPopupMenu pop)
{
JMenuItem item;
- item = new JMenuItem(MessageManager.getString("label.colour_by_annotation"));
+ item = new JMenuItem(
+ MessageManager.getString("label.colour_by_annotation"));
item.addActionListener(new ActionListener()
{
-
+
@Override
public void actionPerformed(ActionEvent e)
{
- AnnotationColourChooser.displayFor(ap.av, ap,alignmentAnnotation,false);
+ AnnotationColourChooser.displayFor(ap.av, ap, alignmentAnnotation,
+ false);
};
});
pop.add(item);
- if (alignmentAnnotation.sequenceRef!=null)
+ if (alignmentAnnotation.sequenceRef != null)
{
- item = new JMenuItem(MessageManager.getString("label.colour_by_annotation")+" ("+MessageManager.getString("label.per_seq")+")");
+ item = new JMenuItem(
+ MessageManager.getString("label.colour_by_annotation") + " ("
+ + MessageManager.getString("label.per_seq") + ")");
item.addActionListener(new ActionListener()
{
@Override
public void actionPerformed(ActionEvent e)
{
- AnnotationColourChooser.displayFor(ap.av, ap,alignmentAnnotation,true);
+ AnnotationColourChooser.displayFor(ap.av, ap, alignmentAnnotation,
+ true);
};
});
pop.add(item);
}
- item = new JMenuItem(MessageManager.getString("action.select_by_annotation"));
+ item = new JMenuItem(
+ MessageManager.getString("action.select_by_annotation"));
item.addActionListener(new ActionListener()
{
-
+
@Override
public void actionPerformed(ActionEvent e)
{
- AnnotationColumnChooser.displayFor(ap.av,ap,alignmentAnnotation);
+ AnnotationColumnChooser.displayFor(ap.av, ap, alignmentAnnotation);
};
});
pop.add(item);
}
+
static void addContactMatrixOptions(final AlignmentPanel ap,
- final AlignmentAnnotation alignmentAnnotation, final JPopupMenu pop)
+ final AlignmentAnnotation alignmentAnnotation,
+ final JPopupMenu pop)
{
-
+
final ContactMatrixI cm = ap.av.getContactMatrix(alignmentAnnotation);
JMenuItem item;
if (cm != null)
if (cm.hasGroups())
{
- JCheckBoxMenuItem chitem = new JCheckBoxMenuItem(MessageManager.getString("action.show_groups_on_matrix"));
- chitem.setToolTipText(MessageManager.getString("action.show_groups_on_matrix_tooltip"));
- boolean showGroups = alignmentAnnotation.isShowGroupsForContactMatrix();
- final AlignmentAnnotation sel_row=alignmentAnnotation;
+ JCheckBoxMenuItem chitem = new JCheckBoxMenuItem(
+ MessageManager.getString("action.show_groups_on_matrix"));
+ chitem.setToolTipText(MessageManager
+ .getString("action.show_groups_on_matrix_tooltip"));
+ boolean showGroups = alignmentAnnotation
+ .isShowGroupsForContactMatrix();
+ final AlignmentAnnotation sel_row = alignmentAnnotation;
chitem.setState(showGroups);
chitem.addActionListener(new ActionListener()
{
}
if (cm.hasTree())
{
- item = new JMenuItem(MessageManager.getString("action.show_tree_for_matrix"));
- item.setToolTipText(MessageManager.getString("action.show_tree_for_matrix_tooltip"));
+ item = new JMenuItem(
+ MessageManager.getString("action.show_tree_for_matrix"));
+ item.setToolTipText(MessageManager
+ .getString("action.show_tree_for_matrix_tooltip"));
item.addActionListener(new ActionListener()
{
}
else
{
- item = new JMenuItem(MessageManager.getString("action.cluster_matrix"));
- item.setToolTipText(MessageManager.getString("action.cluster_matrix_tooltip"));
+ item = new JMenuItem(
+ MessageManager.getString("action.cluster_matrix"));
+ item.setToolTipText(
+ MessageManager.getString("action.cluster_matrix_tooltip"));
item.addActionListener(new ActionListener()
{
@Override
public void run()
{
final long progBar;
- ap.alignFrame.setProgressBar(MessageManager.formatMessage("action.clustering_matrix_for",cm.getAnnotDescr(),5f), progBar = System.currentTimeMillis());
+ ap.alignFrame.setProgressBar(
+ MessageManager.formatMessage(
+ "action.clustering_matrix_for",
+ cm.getAnnotDescr(), 5f),
+ progBar = System.currentTimeMillis());
cm.setGroupSet(GroupSet.makeGroups(cm, true));
cm.randomlyReColourGroups();
cm.transferGroupColorsTo(alignmentAnnotation);
}
drawComponent(g2, true, width);
-
}
/**
* @param width
* Width for scaling labels
*/
- public void drawComponent(Graphics g, boolean clip, int width)
+ public void drawComponent(Graphics g, boolean clip, int givenWidth)
{
- if (av.getFont().getSize() < 10)
+ int width = givenWidth;
+ IdwidthAdjuster iwa = null;
+ if (ap != null)
{
- g.setFont(font);
+ iwa = ap.idwidthAdjuster;
+ if ((Cache.getDefault(ADJUST_ANNOTATION_LABELS_WIDTH_PREF, true)
+ || Jalview.isHeadlessMode()))
+ {
+ Graphics2D g2d = (Graphics2D) g;
+ Graphics dummy = g2d.create();
+ int newAnnotationIdWidth = drawLabels(dummy, clip, width, false,
+ null);
+ dummy.dispose();
+ Dimension d = ap.calculateDefaultAlignmentIdWidth();
+ int alignmentIdWidth = d.width;
+ if (iwa != null && !iwa.manuallyAdjusted())
+ {
+ // If no manual adjustment to ID column with has been made then adjust
+ // width match widest of alignment or annotation id widths
+ boolean allowShrink = Cache.getDefault("ALLOW_SHRINK_ID_WIDTH",
+ false);
+ width = Math.max(alignmentIdWidth, newAnnotationIdWidth);
+ if (clip && width < givenWidth && !allowShrink)
+ {
+ width = givenWidth;
+ }
+ }
+ else if (newAnnotationIdWidth != annotationIdWidth
+ && newAnnotationIdWidth > givenWidth
+ && newAnnotationIdWidth > alignmentIdWidth)
+ {
+ // otherwise if the annotation id width has become larger than the
+ // current id width, increase
+ width = newAnnotationIdWidth;
+ annotationIdWidth = newAnnotationIdWidth;
+ }
+ // set the width if it's changed
+ if (width != ap.av.getIdWidth())
+ {
+ iwa.setWidth(width);
+ }
+ }
}
else
{
- g.setFont(av.getFont());
+ int newAnnotationIdWidth = drawLabels(g, clip, width, false, null);
+ width = Math.max(newAnnotationIdWidth, givenWidth);
+ }
+ drawLabels(g, clip, width, true, null);
+ }
+
+ /**
+ * Render the full set of annotation Labels for the alignment at the given
+ * cursor. If actuallyDraw is false or g is null then no actual drawing will
+ * occur, but the widest label width will be returned. If g is null then
+ * fmetrics must be supplied.
+ *
+ * Returns the width of the annotation labels.
+ *
+ * @param g
+ * Graphics2D instance (needed for font scaling)
+ * @param clip
+ * - true indicates that only current visible area needs to be
+ * rendered
+ * @param width
+ * Width for scaling labels
+ * @param fmetrics
+ * FontMetrics if Graphics object g is null
+ */
+ public int drawLabels(Graphics g0, boolean clip, int width,
+ boolean actuallyDraw, FontMetrics fmetrics)
+ {
+ if (clip)
+ {
+ clip = Cache.getDefault("MOVE_SEQUENCE_ID_WITH_VISIBLE_ANNOTATIONS",
+ true);
+ }
+ Graphics g = null;
+ // create a dummy Graphics object if not drawing and one is supplied
+ if (g0 != null)
+ {
+ if (!actuallyDraw)
+ {
+ Graphics2D g2d = (Graphics2D) g0;
+ g = g2d.create();
+ }
+ else
+ {
+ g = g0;
+ }
}
+ int actualWidth = 0;
+ if (g != null)
+ {
+ if (av.getFont().getSize() < 10)
+ {
+ g.setFont(font);
+ }
+ else
+ {
+ g.setFont(av.getFont());
+ }
+ }
+
+ FontMetrics fm = fmetrics == null ? g.getFontMetrics(g.getFont())
+ : fmetrics;
+ if (actuallyDraw)
+ {
+ g.setColor(Color.white);
+ g.fillRect(0, 0, getWidth(), getHeight());
+
+ if (!Cache.getDefault(RESIZE_MARGINS_MARK_PREF, false)
+ && !av.getWrapAlignment())
+ {
+ g.setColor(Color.LIGHT_GRAY);
+ g.drawLine(0, HEIGHT_ADJUSTER_HEIGHT / 4, HEIGHT_ADJUSTER_WIDTH / 4,
+ HEIGHT_ADJUSTER_HEIGHT / 4);
+ g.drawLine(0, 3 * HEIGHT_ADJUSTER_HEIGHT / 4,
+ HEIGHT_ADJUSTER_WIDTH / 4, 3 * HEIGHT_ADJUSTER_HEIGHT / 4);
- FontMetrics fm = g.getFontMetrics(g.getFont());
- g.setColor(Color.white);
- g.fillRect(0, 0, getWidth(), getHeight());
+ }
+ }
- g.translate(0, getScrollOffset());
- g.setColor(Color.black);
+ if (actuallyDraw)
+ {
+ g.translate(0, getScrollOffset());
+ g.setColor(Color.black);
+ }
SequenceI lastSeqRef = null;
String lastLabel = null;
AlignmentAnnotation[] aa = av.getAlignment().getAlignmentAnnotation();
- int fontHeight = g.getFont().getSize();
+ int fontHeight = g != null ? g.getFont().getSize()
+ : fm.getFont().getSize();
int y = 0;
int x = 0;
int graphExtras = 0;
int offset = 0;
- Font baseFont = g.getFont();
+ Font baseFont = g != null ? g.getFont() : fm.getFont();
FontMetrics baseMetrics = fm;
int ofontH = fontHeight;
int sOffset = 0;
{
if (debugRedraw)
{
- System.out.println("before vis: " + i);
+ jalview.bin.Console.outPrintln("before vis: " + i);
}
before = true;
}
{
if (debugRedraw)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Scroll offset: " + sOffset + " after vis: " + i);
}
after = true;
continue;
}
}
- g.setColor(Color.black);
-
+ if (actuallyDraw && g != null)
+ {
+ g.setColor(Color.black);
+ }
offset = -aa[i].height / 2;
if (aa[i].hasText)
vertBar = true;
}
}
- x = width - fm.stringWidth(label) - 3;
+
+ int labelWidth = fm.stringWidth(label) + 3;
+ x = width - labelWidth;
if (aa[i].graphGroup > -1)
{
s = ((float) fontHeight) / (float) ofontH;
Font f = baseFont
.deriveFont(AffineTransform.getScaleInstance(s, s));
- g.setFont(f);
- fm = g.getFontMetrics();
- graphExtras = (aa[i].height - (groupSize * (fontHeight + 8)))
- / 2;
+ Canvas c = new Canvas();
+ fm = c.getFontMetrics(f);
+ if (actuallyDraw && g != null)
+ {
+ g.setFont(f);
+ // fm = g.getFontMetrics();
+ graphExtras = (aa[i].height
+ - (groupSize * (fontHeight + 8))) / 2;
+ }
}
}
if (visible)
{
if (aa[gg].graphGroup == aa[i].graphGroup)
{
- x = width - fm.stringWidth(aa[gg].label) - 3;
- g.drawString(aa[gg].label, x, y - graphExtras);
-
- if (aa[gg]._linecolour != null)
+ labelWidth = fm.stringWidth(aa[gg].label) + 3;
+ x = width - labelWidth;
+ if (actuallyDraw && g != null)
{
+ g.drawString(aa[gg].label, x, y - graphExtras);
- g.setColor(aa[gg]._linecolour);
- g.drawLine(x, y - graphExtras + 3,
- x + fm.stringWidth(aa[gg].label),
- y - graphExtras + 3);
- }
+ if (aa[gg]._linecolour != null)
+ {
+
+ g.setColor(aa[gg]._linecolour);
+ g.drawLine(x, y - graphExtras + 3,
+ x + fm.stringWidth(aa[gg].label),
+ y - graphExtras + 3);
+ }
- g.setColor(Color.black);
+ g.setColor(Color.black);
+ }
graphExtras += fontHeight + 8;
}
}
}
- g.setFont(baseFont);
+ if (actuallyDraw && g != null)
+ {
+ g.setFont(baseFont);
+ }
fm = baseMetrics;
fontHeight = ofontH;
}
else
{
- if (vertBar)
+ if (actuallyDraw && g != null)
{
- g.drawLine(width - 3, y + offset - fontHeight, width - 3,
- (int) (y - 1.5 * aa[i].height - offset - fontHeight));
- // g.drawLine(20, y + offset, x - 20, y + offset);
+ if (vertBar)
+ {
+ g.drawLine(width - 3, y + offset - fontHeight, width - 3,
+ (int) (y - 1.5 * aa[i].height - offset - fontHeight));
+ // g.drawLine(20, y + offset, x - 20, y + offset);
+ }
+ g.drawString(label, x, y + offset);
}
- g.drawString(label, x, y + offset);
}
lastSeqRef = aa[i].sequenceRef;
+
+ if (labelWidth > actualWidth)
+ {
+ actualWidth = labelWidth;
+ }
}
}
if (!resizePanel && dragEvent != null && aa != null)
{
- g.setColor(Color.lightGray);
- g.drawString(
- (aa[selectedRow].sequenceRef == null ? ""
- : aa[selectedRow].sequenceRef.getName())
- + aa[selectedRow].label,
- dragEvent.getX(), dragEvent.getY() - getScrollOffset());
+ if (actuallyDraw && g != null)
+ {
+ g.setColor(Color.lightGray);
+ g.drawString(
+ (aa[selectedRow].sequenceRef == null ? ""
+ : aa[selectedRow].sequenceRef.getName())
+ + aa[selectedRow].label,
+ dragEvent.getX(), dragEvent.getY() - getScrollOffset());
+ }
}
if (!av.getWrapAlignment() && ((aa == null) || (aa.length < 1)))
{
- g.drawString(MessageManager.getString("label.right_click"), 2, 8);
- g.drawString(MessageManager.getString("label.to_add_annotation"), 2,
- 18);
+ if (actuallyDraw && g != null)
+ {
+ g.drawString(MessageManager.getString("label.right_click"), 2, 8);
+ g.drawString(MessageManager.getString("label.to_add_annotation"), 2,
+ 18);
+ }
}
+
+ return actualWidth;
}
public int getScrollOffset()
tried = true;
} catch (IllegalArgumentException exc)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Serious issue with viewport geometry imgWidth requested was "
+ imgWidth);
return;
&& (fadedImage == null || fadedImage.getWidth() != imgWidth
|| fadedImage.getHeight() != image.getHeight()))
{
- // System.err.println("redraw faded image ("+(fadedImage==null ?
+ // jalview.bin.Console.errPrintln("redraw faded image ("+(fadedImage==null ?
// "null image" : "") + " lastGood="+lastImageGood+")");
fadedImage = new BufferedImage(imgWidth, image.getHeight(),
BufferedImage.TYPE_INT_RGB);
}
if (waitTotal > waitMax)
{
- System.err.println("Timed out waiting for Jmol to load files after "
+ jalview.bin.Console.errPrintln("Timed out waiting for Jmol to load files after "
+ waitTotal + "ms");
- // System.err.println("finished: " + jmb.isFinishedInit()
+ // jalview.bin.Console.errPrintln("finished: " + jmb.isFinishedInit()
// + "; loaded: " + Arrays.toString(jmb.getPdbFile())
// + "; files: " + files.toString());
jmb.getStructureFiles();
.openURL("http://wiki.jmol.org");// http://jmol.sourceforge.net/docs/JmolUserGuide/");
} catch (Exception ex)
{
- System.err.println("Show Jmol help failed with: " + ex.getMessage());
+ jalview.bin.Console.errPrintln("Show Jmol help failed with: " + ex.getMessage());
}
}
if (shift != null)
{
int i = shift.shift(newBase.getIndex());
- // System.err.println("shifted "+(arg1.getIndex())+" to "+i);
+ // jalview.bin.Console.errPrintln("shifted "+(arg1.getIndex())+" to "+i);
ssm.mouseOverVamsasSequence(seq, i, this);
}
else
} catch (ExceptionNAViewAlgorithm e)
{
// only throwable for draw mode = 3 NAView
- System.err.println("Error drawing RNA: " + e.getMessage());
+ jalview.bin.Console.errPrintln("Error drawing RNA: " + e.getMessage());
}
}
}
String formattedDate = Cache.setDateProperty(
"JALVIEW_NEWS_RSS_LASTMODIFIED", lastread.getTime());
BlogReader me = new BlogReader();
- System.out.println("Set last date to " + formattedDate);
+ jalview.bin.Console.outPrintln("Set last date to " + formattedDate);
if (me.isNewsNew())
{
Console.debug("There is news to read.");
boolean opened = jmb.openSession(chimeraSessionFile);
if (!opened)
{
- System.err.println("An error occurred opening Chimera session file "
+ jalview.bin.Console.errPrintln("An error occurred opening Chimera session file "
+ chimeraSessionFile);
}
}
}
} catch (Exception ex)
{
- System.out.println("Error loading User ColourFile\n" + ex);
+ jalview.bin.Console.outPrintln("Error loading User ColourFile\n" + ex);
}
}
// you may omit this part for your application
//
- System.out.println("Hello World 2");
- System.out.println("All fonts available to Graphic2D:\n");
+ jalview.bin.Console.outPrintln("Hello World 2");
+ jalview.bin.Console.outPrintln("All fonts available to Graphic2D:\n");
GraphicsEnvironment ge = GraphicsEnvironment
.getLocalGraphicsEnvironment();
String[] fontNames = ge.getAvailableFontFamilyNames();
for (int n = 0; n < fontNames.length; n++)
{
- System.out.println(fontNames[n]);
+ jalview.bin.Console.outPrintln(fontNames[n]);
}
// Testing part: simple an error thrown anywhere in this JVM will be printed
// on the Console
// We do it with a seperate Thread becasue we don't wan't to break a Thread
// used by the Console.
- System.out.println("\nLets throw an error on this console");
+ jalview.bin.Console.outPrintln("\nLets throw an error on this console");
errorThrower = new Thread(this);
errorThrower.setDaemon(true);
errorThrower.start();
MessageManager.getString("label.cant_map_cds"),
MessageManager.getString("label.operation_failed"),
JvOptionPane.OK_OPTION);
- System.err.println("Failed to make CDS alignment");
+ jalview.bin.Console.errPrintln("Failed to make CDS alignment");
return null;
}
if (copyAlignment.getHeight() <= 0)
{
- System.err.println("No Sequences generated for xRef type " + source);
+ jalview.bin.Console.errPrintln("No Sequences generated for xRef type " + source);
return null;
}
import java.awt.geom.AffineTransform;
import java.beans.PropertyChangeEvent;
import java.beans.PropertyChangeListener;
+import java.beans.PropertyVetoException;
import java.io.File;
import java.io.FileWriter;
import java.io.IOException;
import java.util.List;
import java.util.ListIterator;
import java.util.Locale;
+import java.util.Map;
import java.util.Vector;
import java.util.concurrent.ExecutorService;
import java.util.concurrent.Executors;
* Send this message to stderr as the warning that follows (due to
* reflection) also goes to stderr.
*/
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Linux platform only! You may have the following warning next: \"WARNING: An illegal reflective access operation has occurred\"\nThis is expected and cannot be avoided, sorry about that.");
}
final String awtAppClassName = "awtAppClassName";
}
// Thread off a new instance of the file chooser - this reduces the time
- // it
- // takes to open it later on.
+ // it takes to open it later on.
new Thread(new Runnable()
{
@Override
public void run()
{
jalview.bin.Console.debug("Filechooser init thread started.");
- String fileFormat = Cache.getProperty("DEFAULT_FILE_FORMAT");
+ String fileFormat = FileLoader.getUseDefaultFileFormat()
+ ? Cache.getProperty("DEFAULT_FILE_FORMAT")
+ : null;
JalviewFileChooser.forRead(Cache.getProperty("LAST_DIRECTORY"),
fileFormat);
jalview.bin.Console.debug("Filechooser init thread finished.");
}
} catch (Exception ex)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Unable to paste alignment from system clipboard:\n" + ex);
}
}
@Override
public void inputLocalFileMenuItem_actionPerformed(AlignViewport viewport)
{
- String fileFormat = Cache.getProperty("DEFAULT_FILE_FORMAT");
+ String fileFormat = FileLoader.getUseDefaultFileFormat()
+ ? Cache.getProperty("DEFAULT_FILE_FORMAT")
+ : null;
JalviewFileChooser chooser = JalviewFileChooser.forRead(
Cache.getProperty("LAST_DIRECTORY"), fileFormat,
BackupFiles.getEnabled());
}
} catch (Exception ex)
{
- System.err.println("Error opening help: " + ex.getMessage());
+ jalview.bin.Console.errPrintln("Error opening help: " + ex.getMessage());
}
}
boolean autoSave = projectFile != null && !saveAs
&& BackupFiles.getEnabled();
- // System.out.println("autoSave="+autoSave+", projectFile='"+projectFile+"',
+ // jalview.bin.Console.outPrintln("autoSave="+autoSave+", projectFile='"+projectFile+"',
// saveAs="+saveAs+", Backups
// "+(BackupFiles.getEnabled()?"enabled":"disabled"));
{
if (Platform.isAMacAndNotJS())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Please ignore plist error - occurs due to problem with java 8 on OSX");
}
}
}
/**
- * checks if any progress bars are being displayed in any of the windows managed by the desktop
+ * checks if any progress bars are being displayed in any of the windows
+ * managed by the desktop
+ *
* @return
*/
public boolean operationsAreInProgress()
{
JInternalFrame[] frames = getAllFrames();
- for (JInternalFrame frame:frames)
+ for (JInternalFrame frame : frames)
{
if (frame instanceof IProgressIndicator)
{
- if (((IProgressIndicator)frame).operationInProgress())
+ if (((IProgressIndicator) frame).operationInProgress())
{
return true;
}
}
return operationInProgress();
}
+
+ /**
+ * keep track of modal JvOptionPanes open as modal dialogs for AlignFrames.
+ * The way the modal JInternalFrame is made means it cannot be a child of an
+ * AlignFrame, so closing the AlignFrame might leave the modal open :(
+ */
+ private static Map<AlignFrame, JInternalFrame> alignFrameModalMap = new HashMap<>();
+
+ protected static void addModal(AlignFrame af, JInternalFrame jif)
+ {
+ alignFrameModalMap.put(af, jif);
+ }
+
+ protected static void closeModal(AlignFrame af)
+ {
+ if (!alignFrameModalMap.containsKey(af))
+ {
+ return;
+ }
+ JInternalFrame jif = alignFrameModalMap.get(af);
+ if (jif != null)
+ {
+ try
+ {
+ jif.setClosed(true);
+ } catch (PropertyVetoException e)
+ {
+ e.printStackTrace();
+ }
+ }
+ alignFrameModalMap.remove(af);
+ }
+
}
JvOptionPane.frameDialog(panel, title, JvOptionPane.PLAIN_MESSAGE,
options, ok, actions, false);
- */
+ */
}
}
}
} catch (Exception ex)
{
- System.out.println("Error loading User Colour File\n" + ex);
+ jalview.bin.Console.outPrintln("Error loading User Colour File\n" + ex);
}
}
{
Color newColor = gcol.getMaxColour();
comp.setBackground(newColor);
- // System.err.println("Width is " + w / 2);
+ // jalview.bin.Console.errPrintln("Width is " + w / 2);
Icon ficon = new FeatureIcon(gcol, comp.getBackground(), w, h, thr);
comp.setIcon(ficon);
// tt+="RGB value: Max (" + newColor.getRed() + ", "
{
if (featureSettings != null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION ISSUE: overwriting action listener for FeatureColourChooser");
}
featureSettings = listener;
hb.setCurrentID(id.getId());
} catch (BadIDException bad)
{
- System.out.println("Bad help link: " + id.getId()
+ jalview.bin.Console.outPrintln("Bad help link: " + id.getId()
+ ": must match a target in help.jhm");
throw bad;
}
import java.awt.BorderLayout;
import java.awt.Color;
+import java.awt.Dimension;
import java.awt.Font;
import java.awt.FontMetrics;
import java.awt.Graphics;
void drawIdsWrapped(Graphics2D g, AlignViewport alignViewport,
int startSeq, int pageHeight)
{
+ drawIdsWrapped(g, alignViewport, startSeq, pageHeight, -1);
+ }
+
+ void drawIdsWrapped(Graphics2D g, AlignViewport alignViewport,
+ int startSeq, int pageHeight, int idWidth)
+ {
int alignmentWidth = alignViewport.getAlignment().getWidth();
final int alheight = alignViewport.getAlignment().getHeight();
if (labels != null && alignViewport.isShowAnnotation())
{
+ int getWidth = getWidth();
+ int thisIdWidth = getWidth;
g.translate(0, ypos + (alheight * charHeight));
- labels.drawComponent(g, getWidth());
+ if (!manuallyAdjusted())
+ {
+ int getAnnotationsIdWidth = labels.drawLabels(g, false, -1, false,
+ null);
+ thisIdWidth = idWidth < 0 ? getAnnotationsIdWidth : idWidth;
+ if (thisIdWidth > getWidth)
+ {
+ this.setPreferredSize(
+ new Dimension(thisIdWidth, this.getHeight()));
+ this.repaint();
+ alignViewport.setIdWidth(thisIdWidth);
+ }
+ }
+ labels.drawComponent(g, false, thisIdWidth);
g.translate(0, -ypos - (alheight * charHeight));
}
repaint();
}
}
+
+ private boolean manuallyAdjusted = false;
+
+ public boolean manuallyAdjusted()
+ {
+ return manuallyAdjusted;
+ }
+
+ public void setManuallyAdjusted(boolean b)
+ {
+ manuallyAdjusted = b;
+ }
}
*/
package jalview.gui;
-import jalview.api.AlignViewportI;
-
import java.awt.Color;
import java.awt.Cursor;
import java.awt.Graphics;
import javax.swing.JPanel;
+import jalview.api.AlignViewportI;
+import jalview.bin.Cache;
+
/**
* DOCUMENT ME!
*
return;
}
+ /*
+ * don't allow residue width to be < 1 in wrapped format
+ */
+ if (viewport.getWrapAlignment())
+ {
+ SeqCanvas sc = ap.getSeqPanel().seqCanvas;
+ if (sc != null && sc.getWrappedCanvasWidth(sc.getWidth() - dif) < 1)
+ {
+ return;
+ }
+ }
+
oldX = evt.getX();
/*
return;
}
viewport.setIdWidth(newWidth);
+ ap.validateAnnotationDimensions(false);
+ ap.paintAlignment(true, false);
+
+ ap.getIdPanel().getIdCanvas().setManuallyAdjusted(true);
+ }
+
+ public void setWidth(int newWidth)
+ {
+ if (newWidth < MIN_ID_WIDTH
+ || ap.getIdPanel().getIdCanvas().manuallyAdjusted())
+ {
+ return;
+ }
+ final AlignViewportI viewport = ap.getAlignViewport();
+ viewport.setIdWidth(newWidth);
ap.paintAlignment(true, false);
}
+ public boolean manuallyAdjusted()
+ {
+ return ap.getIdPanel().getIdCanvas().manuallyAdjusted();
+ }
+
@Override
public void mouseMoved(MouseEvent evt)
{
@Override
public void paintComponent(Graphics g)
{
+ int width = getWidth();
+ int height = getHeight();
g.setColor(Color.white);
- g.fillRect(0, 0, getWidth(), getHeight());
+ g.fillRect(0, 0, width, height);
+
+ if (!Cache.getDefault(AnnotationLabels.RESIZE_MARGINS_MARK_PREF, false))
+ // && !ap.getAlignViewport().getWrapAlignment()) // now allowing adjustment
+ // in wrap mode
+ {
+ int spacer = Math.max(2, AnnotationLabels.HEIGHT_ADJUSTER_HEIGHT / 4);
+ g.setColor(Color.LIGHT_GRAY);
+ g.drawLine(width - 3 * spacer, 0, width - 3 * spacer, height / 2);
+ g.drawLine(width - spacer, 0, width - spacer, height / 2);
+ }
+
setCursor(Cursor.getPredefinedCursor(Cursor.W_RESIZE_CURSOR));
}
}
import jalview.util.ImageMaker.TYPE;
import jalview.util.MessageManager;
import jalview.util.Platform;
+import jalview.util.StringUtils;
import jalview.util.imagemaker.BitmapImageSizing;
/**
}
public void doExport(File file, Component parent, int width, int height,
- String imageSource, String renderer, BitmapImageSizing userBis) throws ImageOutputException
+ String imageSource, String renderer, BitmapImageSizing userBis)
+ throws ImageOutputException
{
final long messageId = System.currentTimeMillis();
setStatus(
{
if (Desktop.instance.isInBatchMode())
{
- // defensive error report - we could wait for user input.. I guess ?
- throw(new ImageOutputException("Need an output file to render to when exporting images in batch mode!"));
+ // defensive error report - we could wait for user input.. I guess ?
+ throw (new ImageOutputException(
+ "Need an output file to render to when exporting images in batch mode!"));
}
JalviewFileChooser chooser = imageType.getFileChooser();
chooser.setFileView(new JalviewFileView());
renderStyle = "Text";
}
AtomicBoolean textSelected = new AtomicBoolean(
- !"Lineart".equals(renderStyle));
- if ((imageType == TYPE.EPS || imageType == TYPE.SVG)
- && LineartOptions.PROMPT_EACH_TIME.equals(renderStyle)
+ !StringUtils.equalsIgnoreCase("lineart", renderStyle));
+ if ((imageType == TYPE.EPS || imageType == TYPE.SVG) && StringUtils
+ .equalsIgnoreCase(LineartOptions.PROMPT_EACH_TIME, renderStyle)
&& !Jalview.isHeadlessMode())
{
final File chosenFile = file;
else
{
/*
- * character rendering not required, or preference already set
- * - just do the export
+ * character rendering not required, or preference already set
+ * or we're in headless mode - just do the export
*/
exportImage(file, !textSelected.get(), width, height, messageId,
userBis);
messageId);
} catch (Exception e)
{
- jalview.bin.Console.error(String.format("Error creating %s file: %s", type,
- e.toString()),e);
+ jalview.bin.Console.error(String.format("Error creating %s file: %s",
+ type, e.toString()), e);
setStatus(MessageManager.formatMessage("info.error_creating_file",
type), messageId);
}
}
else
{
- System.err.println("dupe ig for : " + dbs[i] + " \t"
+ jalview.bin.Console.errPrintln("dupe ig for : " + dbs[i] + " \t"
+ dbp.getDbName() + " (" + dbp.getDbSource() + ")");
source.remove(tn);
}
@Override
public void setVisible(boolean arg0)
{
- System.out.println("setVisible: " + arg0);
+ jalview.bin.Console.outPrintln("setVisible: " + arg0);
super.setVisible(arg0);
}
}
import java.awt.Window;
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
+import java.awt.event.KeyEvent;
import java.awt.event.MouseAdapter;
import java.awt.event.MouseMotionAdapter;
import java.beans.PropertyChangeEvent;
import java.beans.PropertyChangeListener;
+import java.beans.PropertyVetoException;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.HashMap;
import javax.swing.JFrame;
import javax.swing.JInternalFrame;
import javax.swing.JLayeredPane;
+import javax.swing.JMenu;
+import javax.swing.JMenuBar;
import javax.swing.JOptionPane;
import javax.swing.JPanel;
+import javax.swing.JRootPane;
import javax.swing.SwingUtilities;
import javax.swing.UIManager;
import javax.swing.event.InternalFrameEvent;
private static void outputMessage(Object message)
{
- System.out.println(">>> JOption Message : " + message.toString());
+ jalview.bin.Console.outPrintln(">>> JOption Message : " + message.toString());
}
public static Object getMockResponse()
if (parentComponent != this
&& !(parentComponent == null && Desktop.instance == null))
{
+ // note the parent goes back to a JRootPane so is probably
+ // Desktop.getDesktop()
JInternalFrame jif = this.createInternalFrame(
parentComponent != null ? parentComponent : Desktop.instance,
title);
+ // connect to the alignFrame using a map in Desktop
+ if (parentComponent instanceof AlignFrame)
+ {
+ Desktop.addModal((AlignFrame) parentComponent, jif);
+ }
jif.setFrameIcon(null);
jif.addInternalFrameListener(new InternalFrameListener()
{
private void internalDialogHandleResponse()
{
- String responseString = (String) this.getValue();
+ Object value = this.getValue();
+ if (value == null
+ || (value instanceof Integer && (Integer) value == -1))
+ {
+ return;
+ }
+ String responseString = value.toString();
int response = ourOptions.indexOf(responseString);
if (!Platform.isJS())
lp.add(modalInterceptor);
f.toFront();
+ // disable the main menu bar if in Linux
+ JMenuBar menubar = null;
+ if (Platform.isLinux())
+ {
+ JRootPane rootpane = Desktop.getDesktop().getRootPane();
+ menubar = rootpane.getJMenuBar();
+ }
+
// We need to explicitly dispatch events when we are blocking the event
// dispatch thread.
EventQueue queue = Toolkit.getDefaultToolkit().getSystemEventQueue();
try
{
+ if (menubar != null)
+ {
+ // don't allow clicks on main menu on linux due to a hanging bug.
+ // see JAL-4214.
+ setMenusEnabled(menubar, false);
+ }
+
while (!f.isClosed())
{
if (EventQueue.isDispatchThread())
// EventQueue.dispatchEvent() directly, because it is
// protected, unfortunately.
if (ev instanceof ActiveEvent)
+ {
((ActiveEvent) ev).dispatch();
- else if (ev.getSource() instanceof Component)
+ }
+ else if (ev instanceof KeyEvent && ((KeyEvent) ev).isControlDown()
+ && menubar != null)
+ {
+ // temporarily enable menus to send Ctrl+? KeyEvents
+ setMenusEnabled(menubar, true);
((Component) ev.getSource()).dispatchEvent(ev);
+ setMenusEnabled(menubar, false);
+ }
else if (ev.getSource() instanceof MenuComponent)
+ {
((MenuComponent) ev.getSource()).dispatchEvent(ev);
+ }
+ else if (ev.getSource() instanceof Component)
+ {
+ ((Component) ev.getSource()).dispatchEvent(ev);
+ }
// Other events are ignored as per spec in
// EventQueue.dispatchEvent
}
// If we get interrupted, then leave the modal state.
} finally
{
+ // re-enable the main menu bar
+ if (menubar != null)
+ {
+ setMenusEnabled(menubar, true);
+ }
+
// Clean up the modal interceptor.
lp.remove(modalInterceptor);
+ // unpaint the frame
+ f.setVisible(false);
+
+ // close the frame
+ try
+ {
+ f.setClosed(true);
+ } catch (PropertyVetoException e)
+ {
+ f.doDefaultCloseAction();
+ }
+
// Remove the internal frame from its parent, so it is no longer
// lurking around and clogging memory.
Container parent = f.getParent();
if (parent != null)
+ {
parent.remove(f);
+ }
}
}
return jvop;
}
+
+ private static void setMenusEnabled(JMenuBar menubar, boolean b)
+ {
+ for (int i = 0; i < menubar.getMenuCount(); i++)
+ {
+ JMenu menu = menubar.getMenu(i);
+ menu.setEnabled(b);
+ }
+ }
+
}
}
} catch (NumberFormatException e)
{
- System.err.println(e.toString());
+ jalview.bin.Console.errPrintln(e.toString());
}
if (minValue != null || maxValue != null)
{
}
} catch (NumberFormatException e)
{
- System.err.println(e.toString());
+ jalview.bin.Console.errPrintln(e.toString());
}
if (minValue != null && maxValue != null)
{
{
// raise an implementation warning here - not sure if this situation
// will ever occur
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION PROBLEM: DATASET out of sync due to an insert whilst calling PaintRefresher.validateSequences(AlignmentI, ALignmentI)");
}
List<SequenceI> alsq = comp.getSequences();
if (!first)
{
- System.out.println(DASHES);
+ jalview.bin.Console.outPrintln(DASHES);
textarea.append(DASHES);
}
first = false;
for (int i = 0; i < seqs.length; i++)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
String.format("%3d %s", i + 1, seqs[i].getDisplayId(true)));
}
{
System.out.print(String.format("%7d", i + 1));
}
- System.out.println();
+ jalview.bin.Console.outPrintln();
for (int i = 0; i < seqs.length; i++)
{
*/
System.out.print(String.format("%7.3f", scores[i][j] / totscore));
}
- System.out.println();
+ jalview.bin.Console.outPrintln();
}
- System.out.println("\n");
+ jalview.bin.Console.outPrintln("\n");
}
/**
if (Platform.isJS())
{
details = new JInternalFrame();
+ details.setFrameIcon(null);
JPanel panel = new JPanel(new BorderLayout());
panel.setOpaque(true);
panel.setBackground(Color.white);
pane.setBackground(Color.WHITE);
pane.add(textLabel, BorderLayout.NORTH);
frame = new JInternalFrame();
+ frame.setFrameIcon(null);
frame.getContentPane().add(new JScrollPane(pane));
}
else
String[] omitHidden = null;
- System.out.println("PROMPT USER HERE"); // TODO: decide if a prompt happens
+ jalview.bin.Console.outPrintln("PROMPT USER HERE"); // TODO: decide if a prompt happens
// or we simply trust the user wants
// wysiwig behaviour
final JPanel progressPanel = progressBars.get(id);
if (progressPanel == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"call setProgressBar before registering the progress bar's handler.");
return;
}
protected List<String> executeCommand(StructureCommandI command,
boolean getReply)
{
- // System.out.println(command.toString()); // debug
+ // jalview.bin.Console.outPrintln(command.toString()); // debug
return pymolManager.sendCommand(command, getReply);
}
validate();
sliderValueChanged();
- // System.out.println((System.currentTimeMillis()-start));
+ // jalview.bin.Console.outPrintln((System.currentTimeMillis()-start));
}
void sliderValueChanged()
.newInstance());
} catch (Throwable x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected exception when instantiating rest input type.");
x.printStackTrace();
}
updated = true;
} catch (InvalidArgumentException ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION ERROR: Invalid argument for type : "
+ typeList.getSelectedValue() + "\n");
ex.printStackTrace();
types.add(jtype.getURLtokenPrefix());
} catch (Throwable x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected exception when instantiating rest input type.");
x.printStackTrace();
}
mtch.group(2) + ":" + mtch.group(3), mtch.group(1),
mtch.group(2), mtch.group(3), inputTypes, warnings))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION PROBLEM: Cannot parse RestService input parameter string '"
+ its + "'" + "\n" + warnings);
}
} catch (Throwable x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION PROBLEM: Cannot parse RestService output parameter string '"
+ its + "'" + "\n" + warnings);
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION PROBLEM: Restservice generated from GUI is invalid\n"
+ warnings);
}
}
- // System.err.println(">>> FastPaint to " + transX + " " + transY + " "
+ // jalview.bin.Console.errPrintln(">>> FastPaint to " + transX + " " + transY + " "
// + horizontal + " " + vertical + " " + startRes + " " + endRes
// + " " + startSeq + " " + endSeq);
// Call repaint on alignment panel so that repaints from other alignment
// panel components can be aggregated. Otherwise performance of the
// overview window and others may be adversely affected.
- // System.out.println("SeqCanvas fastPaint() repaint() request...");
+ // jalview.bin.Console.outPrintln("SeqCanvas fastPaint() repaint() request...");
av.getAlignPanel().repaint();
} finally
{
return (canvasWidth - labelWidthEast - labelWidthWest) / charWidth;
}
+ public int getMinimumWrappedCanvasWidth()
+ {
+ int charWidth = av.getCharWidth();
+ FontMetrics fm = getFontMetrics(av.getFont());
+ int labelWidth = 0;
+ if (av.getScaleRightWrapped() || av.getScaleLeftWrapped())
+ {
+ labelWidth = getLabelWidth(fm);
+ }
+ labelWidthEast = av.getScaleRightWrapped() ? labelWidth : 0;
+ labelWidthWest = av.getScaleLeftWrapped() ? labelWidth : 0;
+ return labelWidthEast + labelWidthWest + charWidth;
+ }
+
/**
* Returns a pixel width sufficient to show the largest sequence coordinate
* (end position) in the alignment, calculated as the FontMetrics width of
public void propertyChange(PropertyChangeEvent evt)
{
String eventName = evt.getPropertyName();
- // System.err.println(">>SeqCanvas propertyChange " + eventName);
+ // jalview.bin.Console.errPrintln(">>SeqCanvas propertyChange " + eventName);
if (eventName.equals(SequenceGroup.SEQ_GROUP_CHANGED))
{
fastPaint = true;
else if (eventName.equals(ViewportRanges.MOVE_VIEWPORT))
{
fastPaint = false;
- // System.err.println("!!!! fastPaint false from MOVE_VIEWPORT");
+ // jalview.bin.Console.errPrintln("!!!! fastPaint false from MOVE_VIEWPORT");
repaint();
return;
}
} catch (OutOfMemoryError er)
{
System.gc();
- System.err.println("SeqCanvas OutOfMemory Redraw Error.\n" + er);
+ jalview.bin.Console.errPrintln("SeqCanvas OutOfMemory Redraw Error.\n" + er);
new OOMWarning("Creating alignment image for display", er);
return;
MousePos o = (MousePos) obj;
boolean b = (column == o.column && seqIndex == o.seqIndex
&& annotationIndex == o.annotationIndex);
- // System.out.println(obj + (b ? "= " : "!= ") + this);
+ // jalview.bin.Console.outPrintln(obj + (b ? "= " : "!= ") + this);
return b;
}
if (lastMessage == null || !lastMessage.equals(tmp))
{
- // System.err.println("mouseOver Sequence: "+tmp);
+ // jalview.bin.Console.errPrintln("mouseOver Sequence: "+tmp);
ssm.mouseOverSequence(sequence, index, pos, av);
}
lastMessage = tmp;
@Override
public void updateColours(SequenceI seq, int index)
{
- System.out.println("update the seqPanel colours");
+ jalview.bin.Console.outPrintln("update the seqPanel colours");
// repaint();
}
if (copycolsel && av.hasHiddenColumns()
&& (av.getAlignment().getHiddenColumns() == null))
{
- System.err.println("Bad things");
+ jalview.bin.Console.errPrintln("Bad things");
}
if (repaint) // always true!
{
+ ((StringPair) database.getSelectedItem()).getDisplay());
// error
// +="Couldn't retrieve sequences from "+database.getSelectedItem();
- System.err.println("Retrieval failed for source ='"
+ jalview.bin.Console.errPrintln("Retrieval failed for source ='"
+ ((StringPair) database.getSelectedItem()).getDisplay()
+ "' and query\n'" + textArea.getText() + "'\n");
e.printStackTrace();
}
if (mt.isErrorAny())
{
- System.err.println("Error when loading images!");
+ jalview.bin.Console.errPrintln("Error when loading images!");
}
} while (!mt.checkAll());
Desktop.instance.setIconImages(ChannelProperties.getIconList());
protected boolean refreshText()
{
String newtext = Desktop.instance.getAboutMessage();
- // System.err.println("Text found: \n"+newtext+"\nEnd of newtext.");
+ // jalview.bin.Console.errPrintln("Text found: \n"+newtext+"\nEnd of newtext.");
if (oldTextLength != newtext.length())
{
iframe.setVisible(false);
});
featureSettingsUI = new JInternalFrame(MessageManager.getString(
"label.sequence_feature_settings_for_CDS_and_Protein"));
+ featureSettingsUI.setFrameIcon(null);
featureSettingsPanels.setOpaque(true);
JPanel dialog = new JPanel();
import jalview.gui.structurechooser.StructureChooserQuerySource;
import jalview.gui.structurechooser.ThreeDBStructureChooserQuerySource;
import jalview.io.DataSourceType;
-import jalview.io.FileFormatException;
import jalview.io.JalviewFileChooser;
import jalview.io.JalviewFileView;
import jalview.jbgui.FilterOption;
import jalview.ws.DBRefFetcher;
import jalview.ws.DBRefFetcher.FetchFinishedListenerI;
import jalview.ws.datamodel.alphafold.PAEContactMatrix;
-import jalview.ws.dbsources.EBIAlfaFold;
import jalview.ws.seqfetcher.DbSourceProxy;
import jalview.ws.sifts.SiftsSettings;
// for moment, it will work fine as is because it is self-contained
String searchTerm = text.toLowerCase(Locale.ROOT);
searchTerm = searchTerm.split(":")[0];
- // System.out.println(">>>>> search term : " + searchTerm);
+ // jalview.bin.Console.outPrintln(">>>>> search term : " + searchTerm);
List<FTSDataColumnI> wantedFields = new ArrayList<>();
FTSRestRequest pdbRequest = new FTSRestRequest();
pdbRequest.setAllowEmptySeq(false);
sc.mainFrame.dispose();
if (showRefAnnotations)
+ {
showReferenceAnnotationsForSequence(ap.alignFrame, seq);
+ }
return sv;
}
package jalview.gui;
import java.util.ArrayList;
+import java.util.EnumSet;
import java.util.HashMap;
import java.util.LinkedHashMap;
import java.util.List;
+import java.util.Locale;
import java.util.Map;
import java.util.Map.Entry;
public enum ViewerType
{
- JMOL, CHIMERA, CHIMERAX, PYMOL
+ JMOL, CHIMERA, CHIMERAX, PYMOL;
+
+ public static ViewerType getFromString(String viewerString)
+ {
+ ViewerType viewerType = null;
+ if (!"none".equals(viewerString))
+ {
+ for (ViewerType v : EnumSet.allOf(ViewerType.class))
+ {
+ String name = v.name().toLowerCase(Locale.ROOT).replaceAll(" ",
+ "");
+ if (viewerString.equals(name))
+ {
+ viewerType = v;
+ break;
+ }
+ }
+ }
+ return viewerType;
+ }
+
};
/**
}
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error retrieving PDB id " + pdbid + ": " + e.getMessage());
} finally
{
{
if (tree == null)
{
- System.out.println("tree is null");
+ jalview.bin.Console.outPrintln("tree is null");
// TODO: deal with case when a change event is received whilst a
// tree is still being calculated - should save reference for
// processing message later.
}
if (evt.getNewValue() == null)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"new alignment sequences vector value is null");
}
pg.close();
} catch (Exception ex)
{
- System.err.println("Error writing tree as EPS");
+ jalview.bin.Console.errPrintln("Error writing tree as EPS");
ex.printStackTrace();
}
}
cdoc = null;
} catch (Exception ee)
{
- System.err.println("Exception whilst updating :");
+ jalview.bin.Console.errPrintln("Exception whilst updating :");
ee.printStackTrace(System.err);
// recover object map backup, since its probably corrupted with references
// to Vobjects that don't exist anymore.
// we only care about AlignmentSequence selections
SelectionMessage sm = (SelectionMessage) message;
sm.validate();
- System.err.println("Received\n" + sm.getRawMessage());
+ jalview.bin.Console.errPrintln("Received\n" + sm.getRawMessage());
Object[] jvobjs = sm.getVorbaIDs() == null ? null
: new Object[sm.getVorbaIDs().length];
if (jvobjs == null)
@Override
public void internalFrameClosed(InternalFrameEvent evt)
{
- // System.out.println("Shutting down webservice client");
+ // jalview.bin.Console.outPrintln("Shutting down webservice client");
WSClientI service = thisinfo.getthisService();
if (service != null && service.isCancellable())
{
else
{
// TODO: show warning
- System.err.println("Invalid name. Not saved.");
+ jalview.bin.Console.errPrintln("Invalid name. Not saved.");
}
}
}
else
{
- System.err.println("Ignoring unknown service argument type "
+ jalview.bin.Console.errPrintln("Ignoring unknown service argument type "
+ myarg.getClass().getName());
}
}
{
if (arg instanceof OptionI)
{
- // System.out.println("Setting option "
+ // jalview.bin.Console.outPrintln("Setting option "
// + System.identityHashCode(arg) + ":" + arg.getName()
// + " with " + arg.getDefaultValue());
opanp.selectOption((OptionI) arg, arg.getValue());
if (cw + 120 > panewidth)
{
jobOptions.add(pbox, "wrap");
- // System.out.println("Wrap on "+pbox.option.getName());
+ // jalview.bin.Console.outPrintln("Wrap on "+pbox.option.getName());
cw = hgap + pbox.getSize().width;
fh = true;
}
}
// TODO: waste some time trying to eliminate any unnecessary .validate calls
// here
- // System.out.println("Size will be : "+w+","+os);
+ // jalview.bin.Console.outPrintln("Size will be : "+w+","+os);
// optsAndparams.setPreferredSize(null);
// paramPane.getViewport().setView(optsAndparams);
paramPane.getViewport().setAutoscrolls(true);
disc.run();
} catch (Exception e)
{
- System.err.println("Aborting. Problem discovering services.");
+ jalview.bin.Console.errPrintln("Aborting. Problem discovering services.");
e.printStackTrace();
return;
}
pr = en.next();
}
{
- System.out.println("Testing opts dupes for "
+ jalview.bin.Console.outPrintln("Testing opts dupes for "
+ lastserv.getUri() + " : " + lastserv.getActionText()
+ ":" + pr.getName());
List<Option> rg = lastserv.getRunnerConfig().getOptions();
Option cpy = jalview.ws.jws2.ParameterUtils.copyOption(o);
} catch (Exception e)
{
- System.err.println("Failed to copy " + o.getName());
+ jalview.bin.Console.errPrintln("Failed to copy " + o.getName());
e.printStackTrace();
} catch (Error e)
{
- System.err.println("Failed to copy " + o.getName());
+ jalview.bin.Console.errPrintln("Failed to copy " + o.getName());
e.printStackTrace();
}
}
}
{
- System.out.println("Testing param dupes:");
+ jalview.bin.Console.outPrintln("Testing param dupes:");
List<Parameter> rg = lastserv.getRunnerConfig()
.getParameters();
for (Parameter o : rg)
.copyParameter(o);
} catch (Exception e)
{
- System.err.println("Failed to copy " + o.getName());
+ jalview.bin.Console.errPrintln("Failed to copy " + o.getName());
e.printStackTrace();
} catch (Error e)
{
- System.err.println("Failed to copy " + o.getName());
+ jalview.bin.Console.errPrintln("Failed to copy " + o.getName());
e.printStackTrace();
}
}
}
{
- System.out.println("Testing param write:");
+ jalview.bin.Console.outPrintln("Testing param write:");
List<String> writeparam = null, readparam = null;
try
{
.writeParameterSet(
pr.getArguments(lastserv.getRunnerConfig()),
" ");
- System.out.println("Testing param read :");
+ jalview.bin.Console.outPrintln("Testing param read :");
List<Option> pset = jalview.ws.jws2.ParameterUtils
.processParameters(writeparam,
lastserv.getRunnerConfig(), " ");
String on = o.next(), sn = s.next(), st = t.next();
if (!sn.equals(st))
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Original was " + on + " Phase 1 wrote " + sn
+ "\tPhase 2 wrote " + st);
failed = true;
}
if (failed)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Original parameters:\n" + pr.getOptions());
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Wrote parameters in first set:\n" + writeparam);
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Wrote parameters in second set:\n" + readparam);
}
* + storeSetName + ": ", jobParams); }
*
* private void writeParam(String nm, List<ArgumentI> params) { for (ArgumentI
- * p : params) { System.out.println(nm + ":" + System.identityHashCode(p) +
+ * p : params) { jalview.bin.Console.outPrintln(nm + ":" + System.identityHashCode(p) +
* " Name: " + p.getName() + " Value: " + p.getDefaultValue()); } }
*
* private Object[] _getUserPreset(String setName) { Object[] pset =
return;
}
settingDialog = true;
- System.out.println("Prompting to save " + lsetname);
+ jalview.bin.Console.outPrintln("Prompting to save " + lsetname);
if (JvOptionPane.showConfirmDialog(this, "Parameter set '" + lsetname
+ "' is modifed, and your changes will be lost.\nReally change preset ?",
"Warning: Unsaved Changes",
settingDialog = false;
// and leave.
return;
- // System.out.println("Saving for " + lsetname);
+ // jalview.bin.Console.outPrintln("Saving for " + lsetname);
// _storeCurrentPreset(lsetname);
}
return;
}
curSetName = newname;
- System.err.println("New name for user setting " + curSetName
+ jalview.bin.Console.errPrintln("New name for user setting " + curSetName
+ " (was " + setName.getSelectedItem() + ")");
if (curSetName.equals(setName.getSelectedItem()))
{
String[] names = seqName.toLowerCase(Locale.ROOT).split("\\|");
for (String name : names)
{
- // System.out.println("Found name : " + name);
+ // jalview.bin.Console.outPrintln("Found name : " + name);
name.trim();
if (isValidSeqName(name))
{
*/
static boolean isValidSeqName(String seqName)
{
- // System.out.println("seqName : " + seqName);
+ // jalview.bin.Console.outPrintln("seqName : " + seqName);
String ignoreList = "pdb,uniprot,swiss-prot";
if (seqName.length() < 3)
{
*/
static boolean isValidSeqName(String seqName)
{
- // System.out.println("seqName : " + seqName);
+ // jalview.bin.Console.outPrintln("seqName : " + seqName);
String ignoreList = "pdb,uniprot,swiss-prot";
if (seqName.length() < 3)
{
int idx = EXP_CATEGORIES.indexOf(upper_cat);
if (idx == -1)
{
- System.out.println("Unknown category: '" + cat + "'");
+ jalview.bin.Console.outPrintln("Unknown category: '" + cat + "'");
EXP_CATEGORIES.add(upper_cat);
idx = EXP_CATEGORIES.size() - 1;
}
{
if (!hasPdbResp)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Warning: seems like we couldn't get to the PDBe search interface.");
}
else
/*
* Set server error status on response
*/
- System.err.println("Exception handling request "
+ jalview.bin.Console.errPrintln("Exception handling request "
+ request.getRequestURI() + " : " + t.getMessage());
if (response.isCommitted())
{
/*
* Can't write an HTTP header once any response content has been written
*/
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unable to return HTTP 500 as response already committed");
}
else
*/
protected void dumpRequest(HttpServletRequest request)
{
- System.out.println(request.getMethod());
- System.out.println(request.getRequestURL());
+ jalview.bin.Console.outPrintln(request.getMethod());
+ jalview.bin.Console.outPrintln(request.getRequestURL());
for (String hdr : Collections.list(request.getHeaderNames()))
{
for (String val : Collections.list(request.getHeaders(hdr)))
{
- System.out.println(hdr + ": " + val);
+ jalview.bin.Console.outPrintln(hdr + ": " + val);
}
}
for (String param : Collections.list(request.getParameterNames()))
{
for (String val : request.getParameterValues(param))
{
- System.out.println(param + "=" + val);
+ jalview.bin.Console.outPrintln(param + "=" + val);
}
}
}
stop();
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error stopping " + getName() + ": " + e.getMessage());
}
}
contextHandlers = new HandlerCollection(true);
server.setHandler(contextHandlers);
server.start();
- // System.out.println(String.format(
+ // jalview.bin.Console.outPrintln(String.format(
// "HttpServer started with %d threads", server.getThreadPool()
// .getThreads()));
contextRoot = server.getURI();
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error trying to start HttpServer: " + e.getMessage());
try
{
{
for (String val : Collections.list(request.getHeaders(hdr)))
{
- System.out.println(hdr + ": " + val);
+ jalview.bin.Console.outPrintln(hdr + ": " + val);
}
}
for (String param : Collections.list(request.getParameterNames()))
{
for (String val : request.getParameterValues(param))
{
- System.out.println(param + "=" + val);
+ jalview.bin.Console.outPrintln(param + "=" + val);
}
}
}
server.stop();
} catch (Exception e)
{
- System.err.println("Error stopping Http Server on "
+ jalview.bin.Console.errPrintln("Error stopping Http Server on "
+ server.getURI() + ": " + e.getMessage());
}
}
ch.start();
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error starting handler for " + path + ": " + e.getMessage());
}
handler.setUri(this.contextRoot + ch.getContextPath().substring(1));
- System.out.println("Jalview " + handler.getName()
+ jalview.bin.Console.outPrintln("Jalview " + handler.getName()
+ " handler started on " + handler.getUri());
}
{
contextHandlers.removeHandler(ch);
myHandlers.remove(handler);
- System.out.println("Stopped Jalview " + handler.getName()
+ jalview.bin.Console.outPrintln("Stopped Jalview " + handler.getName()
+ " handler on " + handler.getUri());
}
}
}
else
{
- // System.err.println("Skipping NaN - not valid value.");
+ // jalview.bin.Console.errPrintln("Skipping NaN - not valid value.");
text.append(comma + 0f);// row.annotations[j].value);
}
comma = ",";
} catch (Exception ex)
{
ex.printStackTrace();
- System.out.println("Problem reading annotation file: " + ex);
+ jalview.bin.Console.outPrintln("Problem reading annotation file: " + ex);
if (nlinesread > 0)
{
- System.out.println("Last read line " + nlinesread + ": '" + lastread
+ jalview.bin.Console.outPrintln("Last read line " + nlinesread + ": '" + lastread
+ "' (first 80 chars) ...");
}
return false;
if (refSeqIndex < 1)
{
refSeqIndex = 1;
- System.out.println(
+ jalview.bin.Console.outPrintln(
"WARNING: SEQUENCE_REF index must be > 0 in AnnotationFile");
}
} catch (Exception ex)
{
if (hidden == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Cannot process HIDE_INSERTIONS without an alignment view: Ignoring line: "
+ line);
}
{
// TODO: specify and implement duplication of alignment annotation
// for multiple group references.
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Ignoring 1:many group reference mappings for group name '"
+ groupRef + "'");
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't combine annotations. None are added to alignment yet!");
}
}
value = Float.valueOf(nextToken);
} catch (NumberFormatException e)
{
- System.err.println("line " + nlinesread + ": Threshold '" + nextToken
+ jalview.bin.Console.errPrintln("line " + nlinesread + ": Threshold '" + nextToken
+ "' invalid, setting to zero");
}
String label = st.hasMoreTokens() ? st.nextToken() : null;
}
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't parse Group Start or End Field as '*' or a valid column or sequence index: '"
+ rng + "' - assuming alignment width for group.");
// assume group is full width
} catch (Exception e)
{
e.printStackTrace();
- System.err.println("Failed to read alignment using the '" + fileFormat
+ jalview.bin.Console.errPrintln("Failed to read alignment using the '" + fileFormat
+ "' reader.\n" + e);
if (e.getMessage() != null
} catch (Exception e)
{
e.printStackTrace();
- System.err.println("Failed to read alignment using the '" + format
+ jalview.bin.Console.errPrintln("Failed to read alignment using the '" + format
+ "' reader.\n" + e);
if (e.getMessage() != null
String afileresp = afile.print(seqs, jvsuffix);
if (afile.hasWarningMessage())
{
- System.err.println("Warning raised when writing as " + format
+ jalview.bin.Console.errPrintln("Warning raised when writing as " + format
+ " : " + afile.getWarningMessage());
}
return afileresp;
} catch (Exception e)
{
- System.err.println("Failed to write alignment as a '"
+ jalview.bin.Console.errPrintln("Failed to write alignment as a '"
+ format.getName() + "' file\n");
e.printStackTrace();
}
{
try
{
- System.out.println("Reading file: " + f);
+ jalview.bin.Console.outPrintln("Reading file: " + f);
AppletFormatAdapter afa = new AppletFormatAdapter();
Runtime r = Runtime.getRuntime();
System.gc();
memf += r.totalMemory() - r.freeMemory();
if (al != null)
{
- System.out.println("Alignment contains " + al.getHeight()
+ jalview.bin.Console.outPrintln("Alignment contains " + al.getHeight()
+ " sequences and " + al.getWidth() + " columns.");
try
{
- System.out.println(new AppletFormatAdapter()
+ jalview.bin.Console.outPrintln(new AppletFormatAdapter()
.formatSequences(FileFormat.Fasta, al, true));
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couln't format the alignment for output as a FASTA file.");
e.printStackTrace(System.err);
}
}
else
{
- System.out.println("Couldn't read alignment");
+ jalview.bin.Console.outPrintln("Couldn't read alignment");
}
- System.out.println("Read took " + (t1 / 1000.0) + " seconds.");
- System.out.println(
+ jalview.bin.Console.outPrintln("Read took " + (t1 / 1000.0) + " seconds.");
+ jalview.bin.Console.outPrintln(
"Difference between free memory now and before is "
+ (memf / (1024.0 * 1024.0) * 1.0) + " MB");
} catch (Exception e)
{
- System.err.println("Exception when dealing with " + i
+ jalview.bin.Console.errPrintln("Exception when dealing with " + i
+ "'th argument: " + args[i] + "\n" + e);
}
}
else
{
- System.err.println("Ignoring argument '" + args[i] + "' (" + i
+ jalview.bin.Console.errPrintln("Ignoring argument '" + args[i] + "' (" + i
+ "'th)- not a readable file.");
}
i++;
DataSourceType protocol = null;
if (debug)
{
- System.out.println("resolving datasource started with:\n>>file\n"
+ jalview.bin.Console.outPrintln("resolving datasource started with:\n>>file\n"
+ file + ">>endfile");
}
}
if (debug)
{
- System.err.println("Resource '" + file + "' was "
+ jalview.bin.Console.errPrintln("Resource '" + file + "' was "
+ (rtn ? "" : "not") + " located by classloader.");
}
if (rtn)
{
if (debug)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Trying to get contents of resource as " + protocol + ":");
}
fp = new FileParse(file, protocol);
{
if (debug)
{
- System.out.println("Successful.");
+ jalview.bin.Console.outPrintln("Successful.");
}
}
} catch (Exception e)
{
if (debug)
{
- System.err.println("Exception when accessing content: " + e);
+ jalview.bin.Console.errPrintln("Exception when accessing content: " + e);
}
fp = null;
}
{
if (debug)
{
- System.out.println("Accessing as paste.");
+ jalview.bin.Console.outPrintln("Accessing as paste.");
}
protocol = DataSourceType.PASTE;
fp = null;
}
} catch (Exception e)
{
- System.err.println("Failed to access content as paste!");
+ jalview.bin.Console.errPrintln("Failed to access content as paste!");
e.printStackTrace();
fp = null;
}
{
if (debug)
{
- System.out.println("Format not identified. Inaccessible file.");
+ jalview.bin.Console.outPrintln("Format not identified. Inaccessible file.");
}
return null;
}
if (debug)
{
- System.out.println("Format identified as " + idformat
+ jalview.bin.Console.outPrintln("Format identified as " + idformat
+ "and expected as " + format);
}
if (idformat.equals(format))
{
if (debug)
{
- System.out.println("Protocol identified as " + protocol);
+ jalview.bin.Console.outPrintln("Protocol identified as " + protocol);
}
return protocol;
}
{
if (debug)
{
- System.err.println("File deemed not accessible via " + protocol);
+ jalview.bin.Console.errPrintln("File deemed not accessible via " + protocol);
e.printStackTrace();
}
}
}
} catch (IOException e)
{
- System.out.println("IOException when checking file '" + filename
+ jalview.bin.Console.outPrintln("IOException when checking file '" + filename
+ "' is a backupfile");
}
{
if (!biojsDirectory.mkdirs())
{
- System.out.println("Couldn't create local directory : "
+ jalview.bin.Console.outPrintln("Couldn't create local directory : "
+ BJS_TEMPLATES_LOCAL_DIRECTORY);
return;
}
} catch (OutOfMemoryError err)
{
- System.out.println("########################\n" + "OUT OF MEMORY "
+ jalview.bin.Console.outPrintln("########################\n" + "OUT OF MEMORY "
+ generatedFile + "\n" + "########################");
new OOMWarning("Creating Image for " + generatedFile, err);
} catch (Exception e)
}
} catch (IOException e)
{
- System.err.println("Exception parsing clustal file " + e);
+ jalview.bin.Console.errPrintln("Exception parsing clustal file " + e);
e.printStackTrace();
}
}
else
{
- System.err.println("Clustal File Reader: Can't find sequence for "
+ jalview.bin.Console.errPrintln("Clustal File Reader: Can't find sequence for "
+ headers.elementAt(i));
}
}
// should report somewhere useful for UI if necessary
warningMessage = ((warningMessage == null) ? "" : warningMessage)
+ "Parsing error at\n" + line;
- System.out.println("Error parsing feature file: " + ex + "\n" + line);
+ jalview.bin.Console.outPrintln("Error parsing feature file: " + ex + "\n" + line);
ex.printStackTrace(System.err);
resetMatcher();
return false;
String[] tokens = line.split(TAB_REGEX);
if (tokens.length != 2)
{
- System.err.println(String.format("Invalid token count %d for %d",
+ jalview.bin.Console.errPrintln(String.format("Invalid token count %d for %d",
tokens.length, line));
}
else
*/
if (gffColumns.length < 6)
{
- System.err.println("Ignoring feature line '" + line
+ jalview.bin.Console.errPrintln("Ignoring feature line '" + line
+ "' with too few columns (" + gffColumns.length + ")");
return false;
}
seq = alignment.getSequenceAt(idx);
} catch (NumberFormatException ex)
{
- System.err.println("Invalid sequence index: " + seqIndex);
+ jalview.bin.Console.errPrintln("Invalid sequence index: " + seqIndex);
}
}
if (seq == null)
{
- System.out.println("Sequence not found: " + line);
+ jalview.bin.Console.outPrintln("Sequence not found: " + line);
return false;
}
@Override
public String print(SequenceI[] sqs, boolean jvsuffix)
{
- System.out.println("Use printGffFormat() or printJalviewFormat()");
+ jalview.bin.Console.outPrintln("Use printGffFormat() or printJalviewFormat()");
return null;
}
*/
if (gffColumns.length < 5)
{
- System.err.println("Ignoring GFF feature line with too few columns ("
+ jalview.bin.Console.errPrintln("Ignoring GFF feature line with too few columns ("
+ gffColumns.length + ")");
return null;
}
}
} catch (IOException e)
{
- System.err.println("GFF parsing failed with: " + e.getMessage());
+ jalview.bin.Console.errPrintln("GFF parsing failed with: " + e.getMessage());
return null;
}
}
}
else
{
- System.err.println("Ignoring unknown pragma: " + line);
+ jalview.bin.Console.errPrintln("Ignoring unknown pragma: " + line);
}
}
}
String name = format.getName().toUpperCase(Locale.ROOT);
if (formats.containsKey(name))
{
- System.err.println("Overwriting file format: " + format.getName());
+ jalview.bin.Console.errPrintln("Overwriting file format: " + format.getName());
}
formats.put(name, format);
if (isIdentifiable)
private File selectedFile;
+ private static boolean useDefaultFileFormat = false;
+
/**
* default constructor always raised errors in GUI dialog boxes
*/
if (format == null)
{
Desktop.instance.stopLoading();
- System.err.println("The input file \"" + file
+ jalview.bin.Console.errPrintln("The input file \"" + file
+ "\" has null or unidentifiable data content!");
if (!Jalview.isHeadlessMode())
{
if (source != null)
{
// Tell the user (developer?) that this is going to cause a problem
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION ERROR: Cannot read consecutive Jalview XML projects from a stream.");
// We read the data anyway - it might make sense.
}
}
else
{
- System.err.println(errorMessage);
+ jalview.bin.Console.errPrintln(errorMessage);
}
}
}
} catch (Exception er)
{
- System.err.println("Exception whilst opening file '" + file);
+ jalview.bin.Console.errPrintln("Exception whilst opening file '" + file);
er.printStackTrace();
if (raiseGUI)
{
}
});
}
- System.err.println("Out of memory loading file " + file + "!!");
+ jalview.bin.Console.errPrintln("Out of memory loading file " + file + "!!");
}
loadtime += System.currentTimeMillis();
{
AlignmentI al = alignFrame.getViewport().getAlignment();
- System.out.println("Loaded '" + title + "' in "
+ jalview.bin.Console.outPrintln("Loaded '" + title + "' in "
+ (loadtime / 1000.0) + "s, took an additional "
+ (1.0 * memused / (1024.0 * 1024.0)) + " MB ("
+ al.getHeight() + " seqs by " + al.getWidth() + " cols)");
{
// report that we didn't load anything probably due to an out of memory
// error
- System.out.println("Failed to load '" + title + "' in "
+ jalview.bin.Console.outPrintln("Failed to load '" + title + "' in "
+ (loadtime / 1000.0) + "s, took an additional "
+ (1.0 * memused / (1024.0 * 1024.0))
+ " MB (alignment is null)");
}
this.setShouldBeSaved();
+ // after first file loaded we revert to assuming a default file format
+ useDefaultFileFormat = true;
}
/**
QuitHandler.Message.UNSAVED_ALIGNMENTS);
}
+ public static boolean getUseDefaultFileFormat()
+ {
+ return useDefaultFileFormat;
+ }
+
}
if (sfpos > -1 && sfpos < fileStr.length() - 1)
{
suffix = fileStr.substring(sfpos + 1);
- // System.err.println("DEBUG: Found Suffix:"+suffix);
+ // jalview.bin.Console.errPrintln("DEBUG: Found Suffix:"+suffix);
return fileStr.substring(0, sfpos);
}
return null;
{
if (bytesRead >= READAHEAD_LIMIT)
{
- System.err.println(String.format(
+ jalview.bin.Console.errPrintln(String.format(
"File reset error: read %d bytes but reset limit is %d",
bytesRead, READAHEAD_LIMIT));
}
}
else
{
- System.out.println(message);
+ jalview.bin.Console.outPrintln(message);
}
}
}
} catch (OutOfMemoryError err)
{
- System.out.println("########################\n" + "OUT OF MEMORY "
+ jalview.bin.Console.outPrintln("########################\n" + "OUT OF MEMORY "
+ generatedFile + "\n" + "########################");
new OOMWarning("Creating Image for " + generatedFile, err);
} catch (Exception e)
@Override
public void parse() throws IOException
{
- // JBPNote log.System.out.println("all read in ");
+ // JBPNote log.jalview.bin.Console.outPrintln("all read in ");
String line;
QuerySeqPosition = -1;
noSeqs = 0;
}
else if (id.equals("jnetconf"))
{
- // log.debug System.out.println("here");
+ // log.debug jalview.bin.Console.outPrintln("here");
id = "Prediction Confidence";
this.conf = new Vector(numSymbols);
for (int i = 0; i < jpred.seqs.size(); i++)
{
- System.out.println(((Sequence) jpred.seqs.elementAt(i)).getName()
+ jalview.bin.Console.outPrintln(((Sequence) jpred.seqs.elementAt(i)).getName()
+ "\n"
+ ((Sequence) jpred.seqs.elementAt(i)).getSequenceAsString()
+ "\n");
}
} catch (java.io.IOException e)
{
- System.err.println("Exception " + e);
+ jalview.bin.Console.errPrintln("Exception " + e);
// e.printStackTrace(); not java 1.1 compatible!
}
}
* out = BLCFile.print(s);
*
* AlignFrame af = new AlignFrame(null, s); af.resize(700, 500); af.show();
- * System.out.println(out); } catch (java.io.IOException e) {
- * System.out.println("Exception " + e); } } }
+ * jalview.bin.Console.outPrintln(out); } catch (java.io.IOException e) {
+ * jalview.bin.Console.outPrintln("Exception " + e); } } }
*/
.setSecondaryStructure(annotation.secondaryStructure);
String displayChar = annotation.displayCharacter == null ? null
: annotation.displayCharacter;
- // System.out.println("--------------------->[" + displayChar + "]");
+ // jalview.bin.Console.outPrintln("--------------------->[" + displayChar + "]");
annotationPojo.setDisplayCharacter(displayChar);
if (annotation.colour != null)
{
import java.util.Vector;
import javax.swing.BoxLayout;
-import javax.swing.DefaultListCellRenderer;
import javax.swing.JCheckBox;
import javax.swing.JDialog;
import javax.swing.JFileChooser;
+import javax.swing.JLabel;
import javax.swing.JList;
import javax.swing.JOptionPane;
import javax.swing.JPanel;
import javax.swing.JScrollPane;
+import javax.swing.ListCellRenderer;
import javax.swing.SpringLayout;
+import javax.swing.SwingConstants;
+import javax.swing.SwingUtilities;
+import javax.swing.border.TitledBorder;
import javax.swing.filechooser.FileFilter;
import javax.swing.plaf.basic.BasicFileChooserUI;
}
else
{
- System.err.println("JalviewFileChooser arguments mismatch: "
+ jalview.bin.Console.errPrintln("JalviewFileChooser arguments mismatch: "
+ extensions + ", " + descs);
}
}
// file filters to fix bug on Mac OSX
setAcceptAllFileFilterUsed(acceptAny);
+ // add a "All known alignment files" option
+ List<String> allExtensions = new ArrayList<>();
+ for (String[] format : formats)
+ {
+ String[] extensions = format[0].split(",");
+ for (String ext : extensions)
+ {
+ if (!allExtensions.contains(ext))
+ {
+ allExtensions.add(ext);
+ }
+ }
+ }
+ allExtensions.sort(null);
+ JalviewFileFilter alljvf = new JalviewFileFilter(
+ allExtensions.toArray(new String[] {}),
+ MessageManager.getString("label.all_known_alignment_files"));
+ alljvf.setExtensionListInDescription(false);
+ addChoosableFileFilter(alljvf);
+
+ if (selected == null)
+ {
+ chosen = alljvf;
+ }
+
for (String[] format : formats)
{
JalviewFileFilter jvf = new JalviewFileFilter(format[0], format[1]);
return FileFormats.getInstance().forName(format);
} catch (IllegalArgumentException e)
{
- System.err.println("Unexpected format: " + format);
+ jalview.bin.Console.errPrintln("Unexpected format: " + format);
}
}
return null;
}
} catch (Throwable x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected exception when trying to get filename.");
x.printStackTrace();
}
}
}
+ if (!file.isAbsolute() && file.exists())
+ {
+ file = file.getAbsoluteFile();
+ }
+
setSelectedFile(file);
}
}
}
list = new JList<>(recent);
-
- DefaultListCellRenderer dlcr = new DefaultListCellRenderer();
- dlcr.setHorizontalAlignment(DefaultListCellRenderer.RIGHT);
- list.setCellRenderer(dlcr);
+ list.setCellRenderer(new recentlyOpenedCellRenderer());
list.addMouseListener(new MouseAdapter()
{
}
});
- this.setBorder(new javax.swing.border.TitledBorder(
- MessageManager.getString("label.recently_opened")));
+ TitledBorder recentlyOpenedBorder = new TitledBorder(
+ MessageManager.getString("label.recently_opened"));
+ recentlyOpenedBorder.setTitleFont(
+ recentlyOpenedBorder.getTitleFont().deriveFont(10f));
+ this.setBorder(recentlyOpenedBorder);
final JScrollPane scroller = new JScrollPane(list);
layout.putConstraint(SpringLayout.NORTH, scroller, 5,
SpringLayout.NORTH, this);
- if (Platform.isAMacAndNotJS())
- {
- scroller.setPreferredSize(new Dimension(500, 100));
- }
- else
- {
- scroller.setPreferredSize(new Dimension(530, 200));
- }
-
+ // one size okay for all
+ scroller.setPreferredSize(new Dimension(280, 105));
this.add(scroller);
- javax.swing.SwingUtilities.invokeLater(new Runnable()
+ SwingUtilities.invokeLater(new Runnable()
{
@Override
public void run()
}
+ class recentlyOpenedCellRenderer extends JLabel
+ implements ListCellRenderer<String>
+ {
+ private final static int maxChars = 46;
+
+ private final static String ellipsis = "...";
+
+ @Override
+ public Component getListCellRendererComponent(
+ JList<? extends String> list, String value, int index,
+ boolean isSelected, boolean cellHasFocus)
+ {
+ String filename = value.toString();
+ String displayFilename;
+ if (filename.length() > maxChars)
+ {
+ StringBuilder displayFileSB = new StringBuilder();
+ File file = new File(filename);
+ displayFileSB.append(file.getName());
+ if (file.getParent() != null)
+ {
+ File parent = file;
+ boolean spaceleft = true;
+ while (spaceleft && parent.getParent() != null)
+ {
+ parent = parent.getParentFile();
+ String name = parent.getName();
+ displayFileSB.insert(0, File.separator);
+ if (displayFileSB.length() + name.length() < maxChars - 1)
+ {
+ displayFileSB.insert(0, name);
+ }
+ else
+ {
+ displayFileSB.insert(0, ellipsis);
+ spaceleft = false;
+ }
+ }
+ if (spaceleft && filename.startsWith(File.separator)
+ && !(displayFileSB.charAt(0) == File.separatorChar))
+ {
+ displayFileSB.insert(0, File.separator);
+ }
+ }
+ displayFilename = displayFileSB.toString();
+ }
+ else
+ {
+ displayFilename = filename;
+ }
+ this.setText(displayFilename.toString());
+ this.setToolTipText(filename);
+ if (isSelected)
+ {
+ setBackground(list.getSelectionBackground());
+ setForeground(list.getSelectionForeground());
+ }
+ else
+ {
+ setBackground(list.getBackground());
+ setForeground(list.getForeground());
+ }
+ this.setHorizontalAlignment(SwingConstants.TRAILING);
+ this.setEnabled(list.isEnabled());
+ this.setFont(list.getFont().deriveFont(12f));
+ this.setOpaque(true);
+ return this;
+ }
+
+ }
+
/*
@Override
public JalviewFileChooser setResponseHandler(Object response,
*/
package jalview.io;
-import java.util.Locale;
-
import java.io.File;
import java.util.Hashtable;
import java.util.Iterator;
import java.util.LinkedHashMap;
+import java.util.Locale;
import java.util.Map;
import java.util.StringTokenizer;
while (extensions.hasNext())
{
- fullDescription += (", " + extensions.next());
+ fullDescription += (", ." + extensions.next());
}
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"JalviewFileView.createImageIcon: Couldn't find file: "
+ filePath);
}
}
} catch (IOException e)
{
- System.err.println("Exception parsing MSFFile " + e);
+ jalview.bin.Console.errPrintln("Exception parsing MSFFile " + e);
e.printStackTrace();
}
}
else
{
- System.err.println("MSFFile Parser: Can't find sequence for "
+ jalview.bin.Console.errPrintln("MSFFile Parser: Can't find sequence for "
+ headers.get(i));
}
}
}
} catch (Exception e)
{
- System.err.println("Exception during MSF Checksum calculation");
+ jalview.bin.Console.errPrintln("Exception during MSF Checksum calculation");
e.printStackTrace();
}
}
// node string contains Comment or structured/extended NH format info
/*
* if ((fcp-cp>1 && nf.substring(cp,fcp).trim().length()>1)) { // will
- * process in remains System.err.println("skipped text:
+ * process in remains jalview.bin.Console.errPrintln("skipped text:
* '"+nf.substring(cp,fcp)+"'"); }
*/
// verify termination.
// more codes here.
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't parse code '" + code + "' = '" + value + "'");
e.printStackTrace(System.err);
}
}
treefile.close();
- System.out.println("Read file :\n");
+ jalview.bin.Console.outPrintln("Read file :\n");
NewickFile trf = new NewickFile(args[0], DataSourceType.FILE);
trf.parse();
- System.out.println("Original file :\n");
+ jalview.bin.Console.outPrintln("Original file :\n");
Regex nonl = new Regex("\n+", "");
- System.out.println(nonl.replaceAll(newickfile.toString()) + "\n");
-
- System.out.println("Parsed file.\n");
- System.out.println("Default output type for original input.\n");
- System.out.println(trf.print());
- System.out.println("Without bootstraps.\n");
- System.out.println(trf.print(false));
- System.out.println("Without distances.\n");
- System.out.println(trf.print(true, false));
- System.out.println("Without bootstraps but with distanecs.\n");
- System.out.println(trf.print(false, true));
- System.out.println("Without bootstraps or distanecs.\n");
- System.out.println(trf.print(false, false));
- System.out.println("With bootstraps and with distances.\n");
- System.out.println(trf.print(true, true));
+ jalview.bin.Console.outPrintln(nonl.replaceAll(newickfile.toString()) + "\n");
+
+ jalview.bin.Console.outPrintln("Parsed file.\n");
+ jalview.bin.Console.outPrintln("Default output type for original input.\n");
+ jalview.bin.Console.outPrintln(trf.print());
+ jalview.bin.Console.outPrintln("Without bootstraps.\n");
+ jalview.bin.Console.outPrintln(trf.print(false));
+ jalview.bin.Console.outPrintln("Without distances.\n");
+ jalview.bin.Console.outPrintln(trf.print(true, false));
+ jalview.bin.Console.outPrintln("Without bootstraps but with distanecs.\n");
+ jalview.bin.Console.outPrintln(trf.print(false, true));
+ jalview.bin.Console.outPrintln("Without bootstraps or distanecs.\n");
+ jalview.bin.Console.outPrintln(trf.print(false, false));
+ jalview.bin.Console.outPrintln("With bootstraps and with distances.\n");
+ jalview.bin.Console.outPrintln(trf.print(true, true));
} catch (java.io.IOException e)
{
- System.err.println("Exception\n" + e);
+ jalview.bin.Console.errPrintln("Exception\n" + e);
e.printStackTrace();
}
}
{
if (line.length() == 0)
{
- // System.out.println("blank line");
+ // jalview.bin.Console.outPrintln("blank line");
continue;
}
if (line.indexOf("C;") == 0 || line.indexOf("#") == 0)
}
else
{
- System.err.println("PFAM File reader: Can't find sequence for "
+ jalview.bin.Console.errPrintln("PFAM File reader: Can't find sequence for "
+ headers.get(i));
}
}
} catch (IOException e)
{
- System.err.println("Exception parsing PHYLIP file " + e);
+ jalview.bin.Console.errPrintln("Exception parsing PHYLIP file " + e);
e.printStackTrace(System.err);
throw e;
}
// public static void main(String[] args) {
// Pattern p= Pattern.compile("(.+)[.][^.]+");
// Matcher m = p.matcher("toto.xml.zip");
- // System.out.println(m.matches());
- // System.out.println(m.group(1));
+ // jalview.bin.Console.outPrintln(m.matches());
+ // jalview.bin.Console.outPrintln(m.group(1));
// }
/**
* make a friendly ID string.
}
} catch (Exception x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"problem when creating links from " + urlstring);
x.printStackTrace();
}
UrlLink urlLink = new UrlLink(link);
if (!urlLink.isValid())
{
- System.err.println(urlLink.getInvalidMessage());
+ jalview.bin.Console.errPrintln(urlLink.getInvalidMessage());
return null;
}
rstart = Long.parseLong(stindx);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't parse '" + stindx + "' as start of row");
// inAlignments = false;
// warn for this line
rend = Long.parseLong(endindx);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Couldn't parse '" + endindx + "' as end of row");
// inAlignments = false;
+ umcp.getMessage() + ")";
throw new IOException(umcp);
}
- // DEBUG System.out.println("this is the secondary scructure:"
+ // DEBUG jalview.bin.Console.outPrintln("this is the secondary scructure:"
// +result.size());
SequenceI[] seqs = new SequenceI[result.size()];
String id = null;
for (int i = 0; i < result.size(); i++)
{
- // DEBUG System.err.println("Processing i'th sequence in Stockholm file")
+ // DEBUG jalview.bin.Console.errPrintln("Processing i'th sequence in Stockholm file")
RNA current = result.get(i);
String seq = current.getSeq();
String rna = current.getStructDBN(true);
- // DEBUG System.out.println(seq);
- // DEBUG System.err.println(rna);
+ // DEBUG jalview.bin.Console.outPrintln(seq);
+ // DEBUG jalview.bin.Console.errPrintln(rna);
int begin = 0;
int end = seq.length() - 1;
id = safeName(getDataName());
}
else if (!r.search(line))
{
- // System.err.println("Found sequence line: " + line);
+ // jalview.bin.Console.errPrintln("Found sequence line: " + line);
// Split sequence in sequence and accession parts
if (!x.search(line))
String annType = r.stringMatched(1);
String annContent = r.stringMatched(2);
- // System.err.println("type:" + annType + " content: " + annContent);
+ // jalview.bin.Console.errPrintln("type:" + annType + " content: " + annContent);
if (annType.equals("GF"))
{
else
{
// throw new IOException("Error parsing " + line);
- System.err.println(">> missing annotation: " + line);
+ jalview.bin.Console.errPrintln(">> missing annotation: " + line);
}
}
else if (annType.equals("GC"))
// }
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning - couldn't parse sequence annotation row line:\n"
+ line);
// throw new IOException("Error parsing " + line);
annot.annotations.length);
System.arraycopy(els, 0, anns, annot.annotations.length, els.length);
annot.annotations = anns;
- // System.out.println("else: ");
+ // jalview.bin.Console.outPrintln("else: ");
}
return annot;
}
{
return (String) typeIds.get(id);
}
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning : Unknown Stockholm annotation type code " + id);
return id;
}
{
return key;
}
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning : Unknown Stockholm annotation type: " + type);
return key;
}
protected void processPdbFileWithAnnotate3d(List<SequenceI> rna)
throws Exception
{
- // System.out.println("this is a PDB format and RNA sequence");
+ // jalview.bin.Console.outPrintln("this is a PDB format and RNA sequence");
// note: we use reflection here so that the applet can compile and run
// without the HTTPClient bits and pieces needed for accessing Annotate3D
// web service
processPdbFileWithAnnotate3d(rnaSequences);
} catch (Exception x)
{
- System.err.println("Exceptions when dealing with RNA in pdb file");
+ jalview.bin.Console.errPrintln("Exceptions when dealing with RNA in pdb file");
x.printStackTrace();
}
processWithJmolParser(proteinSequences, true);
} catch (Exception x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exceptions from Jmol when processing data in pdb file");
x.printStackTrace();
}
annotations[j] = null;
if (val > 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning: non-zero value for positional T-COFFEE score for gap at "
+ j + " in sequence " + s.getName());
}
{
// removeValignmentSequences(alignment, docseqs);
docseqs.removeAllElements();
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Sequence deletion from alignment is not implemented.");
}
}
if (alismod)
{
- System.out.println("update alignment in document.");
+ jalview.bin.Console.outPrintln("update alignment in document.");
}
else
{
- System.out.println("alignment in document left unchanged.");
+ jalview.bin.Console.outPrintln("alignment in document left unchanged.");
}
}
else
// unbind alignment from view.
// create new binding and new alignment.
// mark trail on new alignment as being derived from old ?
- System.out.println(
+ jalview.bin.Console.outPrintln(
"update edited alignment to new alignment in document.");
}
}
// METHODS)
{
// verify existing alignment sequence annotation is up to date
- System.out.println("update dataset sequence annotation.");
+ jalview.bin.Console.outPrintln("update dataset sequence annotation.");
}
else
{
// verify existing alignment sequence annotation is up to date
- System.out.println(
+ jalview.bin.Console.outPrintln(
"make new alignment dataset sequence annotation if modification has happened.");
}
}
// METHODS)
{
// verify existing alignment sequence annotation is up to date
- System.out.println("update alignment sequence annotation.");
+ jalview.bin.Console.outPrintln("update alignment sequence annotation.");
}
else
{
// verify existing alignment sequence annotation is up to date
- System.out.println(
+ jalview.bin.Console.outPrintln(
"make new alignment sequence annotation if modification has happened.");
}
}
for (int i = 0; i < ids.size(); i++)
{
Sequence sequence = (Sequence) ids.get(i);
- System.out.println(sequence.getName());
+ jalview.bin.Console.outPrintln(sequence.getName());
BlastThread thread = new BlastThread(sequence);
thread.start();
BlastThread(Sequence sequence)
{
- System.out.println("blasting for: " + sequence.getName());
+ jalview.bin.Console.outPrintln("blasting for: " + sequence.getName());
this.sequence = sequence;
}
else
{
Thread.sleep(10000);
- System.out.println("WSWuBlastClient: I'm alive "
+ jalview.bin.Console.outPrintln("WSWuBlastClient: I'm alive "
+ sequence.getName() + " " + jobid); // log.debug
}
} catch (Exception ex)
{
jobComplete = true;
jobsRunning--;
- System.err.println("WSWUBlastClient error:\n" + exp.toString());
+ jalview.bin.Console.errPrintln("WSWUBlastClient error:\n" + exp.toString());
exp.printStackTrace();
}
}
@Override
public void actionPerformed(ActionEvent e)
{
- // System.out.println(">>>>> Clear cache items");
+ // jalview.bin.Console.outPrintln(">>>>> Clear cache items");
setSelectedItem("");
appCache.deleteCacheItems(cacheKey);
updateCache();
relaxedIdMatching);
} catch (IOException ivfe)
{
- System.err.println(ivfe);
+ jalview.bin.Console.errPrintln(ivfe);
}
/*
}
else if (!"+".equals(strand))
{
- System.err.println("Strand must be specified for alignment");
+ jalview.bin.Console.errPrintln("Strand must be specified for alignment");
return;
}
String[] tokens = region.split(" ");
if (tokens.length != 3)
{
- System.err.println("Malformed Align descriptor: " + region);
+ jalview.bin.Console.errPrintln("Malformed Align descriptor: " + region);
return null;
}
alignCount = Integer.parseInt(tokens[2]);
} catch (NumberFormatException nfe)
{
- System.err.println(nfe.toString());
+ jalview.bin.Console.errPrintln(nfe.toString());
return null;
}
return true;
}
}
- System.err.println("Sorry, I don't handle exonerate model " + model);
+ jalview.bin.Console.errPrintln("Sorry, I don't handle exonerate model " + model);
return false;
}
*/
if ("-".equals(strand))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Skipping mapping from reverse complement as not yet supported");
return null;
}
List<String> targets = attributes.get(TARGET);
if (targets == null)
{
- System.err.println("'Target' missing in GFF");
+ jalview.bin.Console.errPrintln("'Target' missing in GFF");
return null;
}
String[] tokens = target.split(" ");
if (tokens.length < 3)
{
- System.err.println("Incomplete Target: " + target);
+ jalview.bin.Console.errPrintln("Incomplete Target: " + target);
continue;
}
}
} catch (NumberFormatException nfe)
{
- System.err.println("Invalid start or end in Target " + target);
+ jalview.bin.Console.errPrintln("Invalid start or end in Target " + target);
}
}
*/
if (!trimMapping(from, to, fromRatio, toRatio))
{
- System.err.println("Ignoring mapping from " + Arrays.toString(from)
+ jalview.bin.Console.errPrintln("Ignoring mapping from " + Arrays.toString(from)
+ " to " + Arrays.toString(to) + " as counts don't match!");
return null;
}
{
from[1] += fromOverlap / toRatio;
}
- System.err.println(Arrays.toString(from));
+ jalview.bin.Console.errPrintln(Arrays.toString(from));
return true;
}
else if (fromOverlap < 0 && fromOverlap % fromRatio == 0)
{
to[1] += fromOverlap / fromRatio;
}
- System.err.println(Arrays.toString(to));
+ jalview.bin.Console.errPrintln(Arrays.toString(to));
return true;
}
return sf;
} catch (NumberFormatException nfe)
{
- System.err.println("Invalid number in gff: " + nfe.getMessage());
+ jalview.bin.Console.errPrintln("Invalid number in gff: " + nfe.getMessage());
return null;
}
}
if (!valid)
{
- System.err.println(INVALID_GFF_ATTRIBUTE_FORMAT + s);
+ jalview.bin.Console.errPrintln(INVALID_GFF_ATTRIBUTE_FORMAT + s);
return map;
}
theKey = theKey.trim();
if (theKey.isEmpty())
{
- System.err.println(INVALID_GFF_ATTRIBUTE_FORMAT + s);
+ jalview.bin.Console.errPrintln(INVALID_GFF_ATTRIBUTE_FORMAT + s);
map.clear();
return map;
}
{
// suppress logging here as it reports Uniprot sequence features
// (which do not use SO terms) when auto-configuring feature colours
- // System.out.println("SO term " + term
+ // jalview.bin.Console.outPrintln("SO term " + term
// + " not known - add to model if needed in "
// + getClass().getName());
termsNotFound.add(term);
AlignmentSet last = getLastAlignmentSet();
if (last != null)
{
- System.err.println("Deuniquifying last alignment set.");
+ jalview.bin.Console.errPrintln("Deuniquifying last alignment set.");
last.deuniquifyAlignment();
}
al.add(new AlignmentSet(newal));
fp = new FileParse(file, AppletFormatAdapter.checkProtocol(file));
} catch (Exception e)
{
- System.err.println("Couldn't handle datasource of type " + jtype
+ jalview.bin.Console.errPrintln("Couldn't handle datasource of type " + jtype
+ " using URI " + file);
e.printStackTrace();
return;
}
else
{
- System.out.println("Couldn't parse source type token '"
+ jalview.bin.Console.outPrintln("Couldn't parse source type token '"
+ type.toUpperCase(Locale.ROOT) + "'");
}
}
System.out.print("\n");
}
- System.out.println("Now trying to parse set:");
+ jalview.bin.Console.outPrintln("Now trying to parse set:");
JalviewDataset context;
Object[] newdm;
ParsePackedSet pps;
.getAlignment(context = new JalviewDataset(), dp);
} catch (Exception e)
{
- System.out.println("Test failed for these arguments.\n");
+ jalview.bin.Console.outPrintln("Test failed for these arguments.\n");
e.printStackTrace(System.out);
return;
}
{
for (Object o : newdm)
{
- System.out.println("Will need to create an " + o.getClass());
+ jalview.bin.Console.outPrintln("Will need to create an " + o.getClass());
}
// now test uniquify/deuniquify stuff
{
if (context.getLastAlignmentSet().isModified())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Initial alignment set was modified and any associated views should be updated.");
}
}
private void conflict(Mapping mjvmapping, SequenceMapping sequenceMapping)
{
- System.err.println("Conflict in update of sequenceMapping "
+ jalview.bin.Console.errPrintln("Conflict in update of sequenceMapping "
+ sequenceMapping.getVorbaId());
}
}
else
{
- System.err.println("WARNING: Unassociated treeNode "
+ jalview.bin.Console.errPrintln("WARNING: Unassociated treeNode "
+ tnode.element().toString() + " "
+ ((tnode.getName() != null)
? " label " + tnode.getName()
occurence = Integer.valueOf(oval).intValue();
} catch (Exception e)
{
- System.err.println("Invalid nodespec '" + nodespec + "'");
+ jalview.bin.Console.errPrintln("Invalid nodespec '" + nodespec + "'");
return null;
}
jalview.datamodel.BinaryNode bn = null;
initialise(vcfFile);
} catch (IOException e)
{
- System.err.println("Error opening VCF file: " + e.getMessage());
+ jalview.bin.Console.errPrintln("Error opening VCF file: " + e.getMessage());
}
// map of species!chromosome!fromAssembly!toAssembly to {fromRange, toRange}
}
} catch (Throwable e)
{
- System.err.println("Error processing VCF: " + e.getMessage());
+ jalview.bin.Console.errPrintln("Error processing VCF: " + e.getMessage());
e.printStackTrace();
if (gui != null)
{
patterns.add(Pattern.compile(token.toUpperCase(Locale.ROOT)));
} catch (PatternSyntaxException e)
{
- System.err.println("Invalid pattern ignored: " + token);
+ jalview.bin.Console.errPrintln("Invalid pattern ignored: " + token);
}
}
return patterns;
{
if (jvlite.debug && dbgMsg != null)
{
- System.err.println(dbgMsg);
+ jalview.bin.Console.errPrintln(dbgMsg);
}
scriptObject.call(_listener, objects);
}
{
if (jvlite.debug)
{
- System.err.println(jex);
+ jalview.bin.Console.errPrintln(jex);
}
if (jex instanceof netscape.javascript.JSException
&& jvlite.jsfallbackEnabled)
jsex[0] = jex;
if (jvlite.debug)
{
- System.err.println("Falling back to javascript: url call");
+ jalview.bin.Console.errPrintln("Falling back to javascript: url call");
}
StringBuffer sb = new StringBuffer(
"javascript:" + _listener + "(");
sb.append(")");
if (jvlite.debug)
{
- System.err.println(sb.toString());
+ jalview.bin.Console.errPrintln(sb.toString());
}
// alternate
URL url = null;
public void selection(SequenceGroup seqsel, ColumnSelection colsel,
HiddenColumns hidden, SelectionSource source)
{
- // System.err.println("Testing selection event relay to
+ // jalview.bin.Console.errPrintln("Testing selection event relay to
// jsfunction:"+_listener);
try
{
;
}
- System.err.println("Relaying selection to jsfunction:" + _listener);
+ jalview.bin.Console.errPrintln("Relaying selection to jsfunction:" + _listener);
executeJavascriptFunction(_listener,
new Object[]
{ src, setid, jvlite.arrayToSeparatorList(seqs),
jvlite.arrayToSeparatorList(cols) });
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Jalview Javascript exec error: Couldn't send selection message using function '"
+ _listener + "'");
ex.printStackTrace();
if (ex instanceof netscape.javascript.JSException)
{
- System.err.println("Javascript Exception: "
+ jalview.bin.Console.errPrintln("Javascript Exception: "
+ ((netscape.javascript.JSException) ex).getCause()
.toString());
}
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"JalviewLite javascript error: Couldn't send mouseOver with handler '"
+ _listener + "'");
if (ex instanceof netscape.javascript.JSException)
{
- System.err.println("Javascript Exception: "
+ jalview.bin.Console.errPrintln("Javascript Exception: "
+ ((netscape.javascript.JSException) ex).getMessage());
}
ex.printStackTrace();
"" + (atom.getPdbResNum()), "" + atom.getAtomIndex() });
} catch (Exception ex)
{
- System.err.println("Couldn't execute callback with " + _listenerfn
+ jalview.bin.Console.errPrintln("Couldn't execute callback with " + _listenerfn
+ " for atomSpec: " + atom);
ex.printStackTrace();
}
if (JalviewLite.debug)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
this.getClass().getName() + " modelSet[0]: " + modelSet[0]);
ssm.reportMapping();
}
}
// if (jvlite.debug)
// {
- // System.err.println("Mapped '" + modelSet[m] + "' to "
+ // jalview.bin.Console.errPrintln("Mapped '" + modelSet[m] + "' to "
// + sequence[m].length + " sequences.");
// }
}
executeJavascriptFunction(true, _listenerfn, st);
} catch (Exception ex)
{
- System.err.println("Couldn't execute callback with " + _listenerfn
+ jalview.bin.Console.errPrintln("Couldn't execute callback with " + _listenerfn
+ " using args { " + st[0] + ", " + st[1] + ", " + st[2]
+ "," + st[3] + "}"); // + ","+st[4]+"\n");
ex.printStackTrace();
* executeJavascriptFunction( false, _listenerfn, st = new String[] {
* "colourstruct", "" + ((jalview.appletgui.AlignmentPanel) source).av
* .getViewId(), handle, "" }); } catch (Exception ex) {
- * System.err.println("Couldn't execute callback with " + _listenerfn +
+ * jalview.bin.Console.errPrintln("Couldn't execute callback with " + _listenerfn +
* " using args { " + st[0] + ", " + st[1] + ", " + st[2] + "," + st[3] +
* "\n"); ex.printStackTrace();
*
import jalview.gui.JvSwingUtils;
import jalview.gui.Preferences;
import jalview.io.FileFormats;
-import jalview.io.exceptions.ImageOutputException;
import jalview.schemes.ResidueColourScheme;
import jalview.util.MessageManager;
import jalview.util.Platform;
{
try
{
+ setFrameIcon(null);
// for Web-page embedding using id=align-frame-div
setName("jalview-alignment");
}
} catch (Exception e)
{
- System.err.println(e.toString());
+ jalview.bin.Console.errPrintln(e.toString());
}
if (Platform.allowMnemonics()) // was "not mac and not JS"
protected void createPNG_actionPerformed(ActionEvent object)
{
// TODO Auto-generated method stub
-
+
}
protected void createEPS_actionPerformed(ActionEvent object)
{
// TODO Auto-generated method stub
-
+
}
protected void createSVG_actionPerformed(ActionEvent object)
{
// TODO Auto-generated method stub
-
+
}
protected void copyHighlightedColumns_actionPerformed(
{
}
-
protected void font_actionPerformed(ActionEvent e)
{
}
}
-
protected void loadTreeMenuItem_actionPerformed(ActionEvent e)
{
protected JPanel scalePanelHolder = newJPanel();
- protected JPanel idPanelHolder = newJPanel();
+ public JPanel idPanelHolder = newJPanel();
protected JPanel idSpaceFillerPanel1 = newJPanel();
APQHandlers.setAPQHandlers((Desktop) this);
} catch (Exception e)
{
- System.out.println("Cannot set APQHandlers");
+ jalview.bin.Console.outPrintln("Cannot set APQHandlers");
// e.printStackTrace();
} catch (Throwable t)
{
inputURLMenuItem_actionPerformed(null);
} catch (FileFormatException e1)
{
- System.err.println("Error loading from URL: " + e1.getMessage());
+ jalview.bin.Console.errPrintln("Error loading from URL: " + e1.getMessage());
}
}
});
*/
protected void quit()
{
- // System.out.println("********** GDesktop.quit()");
+ // jalview.bin.Console.outPrintln("********** GDesktop.quit()");
}
/**
mainFrame.pack();
} catch (Exception e)
{
- System.out.println(e); // for JavaScript TypeError
+ jalview.bin.Console.outPrintln(e); // for JavaScript TypeError
e.printStackTrace();
}
}
protected void closeAction(int preferredHeight)
{
- // System.out.println(">>>>>>>>>> closing internal frame!!!");
- // System.out.println("width : " + mainFrame.getWidth());
- // System.out.println("heigh : " + mainFrame.getHeight());
- // System.out.println("x : " + mainFrame.getX());
- // System.out.println("y : " + mainFrame.getY());
+ // jalview.bin.Console.outPrintln(">>>>>>>>>> closing internal frame!!!");
+ // jalview.bin.Console.outPrintln("width : " + mainFrame.getWidth());
+ // jalview.bin.Console.outPrintln("heigh : " + mainFrame.getHeight());
+ // jalview.bin.Console.outPrintln("x : " + mainFrame.getX());
+ // jalview.bin.Console.outPrintln("y : " + mainFrame.getY());
tempUserPrefs.put("structureChooser.width", pnl_filter.getWidth());
tempUserPrefs.put("structureChooser.height", preferredHeight);
tempUserPrefs.put("structureChooser.x", mainFrame.getX());
{
String logLine = String.format("%s: %s", loglevel.toString(),
message);
- System.out.println(logLine);
+ jalview.bin.Console.outPrintln(logLine);
if (t != null)
{
if (loglevel.compareTo(LogLevel.DEBUG) <= 0)
t.printStackTrace(System.err);
else
- System.err.println(t.getMessage());
+ jalview.bin.Console.errPrintln(t.getMessage());
}
return false;
}
}
else
{
- // System.out.println("Iteration " + iter);
+ // jalview.bin.Console.outPrintln("Iteration " + iter);
}
g = (d[l] - d[l - 1]) / (2.0 * e[l - 1]);
}
else
{
- // System.out.println("Iteration " + iter);
+ // jalview.bin.Console.outPrintln("Iteration " + iter);
}
g = (d[l] - d[l - 1]) / (2.0 * e[l - 1]);
Float floatValue = Float.valueOf(degrees);
if (cachedRotations.get(axis).containsKey(floatValue))
{
- // System.out.println("getRotation from cache: " + (int) degrees);
+ // jalview.bin.Console.outPrintln("getRotation from cache: " + (int) degrees);
return cachedRotations.get(axis).get(floatValue);
}
}
} catch (Exception x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"IMPLEMENTATION ERROR: Failed to resolve forward reference for sequence "
+ ref.getSref());
x.printStackTrace();
}
if (unresolved > 0)
{
- System.err.println("Jalview Project Import: There were " + unresolved
+ jalview.bin.Console.errPrintln("Jalview Project Import: There were " + unresolved
+ " forward references left unresolved on the stack.");
}
if (failedtoresolve > 0)
{
- System.err.println("SERIOUS! " + failedtoresolve
+ jalview.bin.Console.errPrintln("SERIOUS! " + failedtoresolve
+ " resolvable forward references failed to resolve.");
}
if (incompleteSeqs != null && incompleteSeqs.size() > 0)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Jalview Project Import: There are " + incompleteSeqs.size()
+ " sequences which may have incomplete metadata.");
if (incompleteSeqs.size() < 10)
{
for (SequenceI s : incompleteSeqs.values())
{
- System.err.println(s.toString());
+ jalview.bin.Console.errPrintln(s.toString());
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Too many to report. Skipping output of incomplete sequences.");
}
}
object.setCreationDate(now);
} catch (DatatypeConfigurationException e)
{
- System.err.println("error writing date: " + e.toString());
+ jalview.bin.Console.errPrintln("error writing date: " + e.toString());
}
object.setVersion(Cache.getDefault("VERSION", "Development Build"));
// HAPPEN! (PF00072.15.stk does this)
// JBPNote: Uncomment to debug writing out of files that do not read
// back in due to ArrayOutOfBoundExceptions.
- // System.err.println("vamsasSeq backref: "+id+"");
- // System.err.println(jds.getName()+"
+ // jalview.bin.Console.errPrintln("vamsasSeq backref: "+id+"");
+ // jalview.bin.Console.errPrintln(jds.getName()+"
// "+jds.getStart()+"-"+jds.getEnd()+" "+jds.getSequenceAsString());
- // System.err.println("Hashcode: "+seqHash(jds));
+ // jalview.bin.Console.errPrintln("Hashcode: "+seqHash(jds));
// SequenceI rsq = (SequenceI) seqRefIds.get(id + "");
- // System.err.println(rsq.getName()+"
+ // jalview.bin.Console.errPrintln(rsq.getName()+"
// "+rsq.getStart()+"-"+rsq.getEnd()+" "+rsq.getSequenceAsString());
- // System.err.println("Hashcode: "+seqHash(rsq));
+ // jalview.bin.Console.errPrintln("Hashcode: "+seqHash(rsq));
}
else
{
try
{
fileName = fileName.replace('\\', '/');
- System.out.println("Writing jar entry " + fileName);
+ jalview.bin.Console.outPrintln("Writing jar entry " + fileName);
JarEntry entry = new JarEntry(fileName);
jout.putNextEntry(entry);
PrintWriter pout = new PrintWriter(
} catch (Exception ex)
{
// TODO: raise error in GUI if marshalling failed.
- System.err.println("Error writing Jalview project");
+ jalview.bin.Console.errPrintln("Error writing Jalview project");
ex.printStackTrace();
}
}
File file = new File(infilePath);
if (file.exists() && jout != null)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Writing jar entry " + jarEntryName + " (" + msg + ")");
jout.putNextEntry(new JarEntry(jarEntryName));
copyAll(is, jout);
});
} catch (Exception x)
{
- System.err.println("Error loading alignment: " + x.getMessage());
+ jalview.bin.Console.errPrintln("Error loading alignment: " + x.getMessage());
}
}
return af;
{
if (bytes != null)
{
- // System.out.println("Jalview2XML: opening byte jarInputStream for
+ // jalview.bin.Console.outPrintln("Jalview2XML: opening byte jarInputStream for
// bytes.length=" + bytes.length);
return new JarInputStream(new ByteArrayInputStream(bytes));
}
if (_url != null)
{
- // System.out.println("Jalview2XML: opening url jarInputStream for "
+ // jalview.bin.Console.outPrintln("Jalview2XML: opening url jarInputStream for "
// + _url);
return new JarInputStream(_url.openStream());
}
else
{
- // System.out.println("Jalview2XML: opening file jarInputStream for
+ // jalview.bin.Console.outPrintln("Jalview2XML: opening file jarInputStream for
// " + file);
return new JarInputStream(new FileInputStream(file));
}
{
ex.printStackTrace();
errorMessage = "Couldn't locate Jalview XML file : " + file;
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exception whilst loading jalview XML file : " + ex + "\n");
} catch (Exception ex)
{
- System.err.println("Parsing as Jalview Version 2 file failed.");
+ jalview.bin.Console.errPrintln("Parsing as Jalview Version 2 file failed.");
ex.printStackTrace(System.err);
if (attemptversion1parse)
{
}
if (af != null)
{
- System.out.println("Successfully loaded archive file");
+ jalview.bin.Console.outPrintln("Successfully loaded archive file");
return af;
}
ex.printStackTrace();
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exception whilst loading jalview XML file : " + ex + "\n");
} catch (OutOfMemoryError e)
{
// Don't use the OOM Window here
errorMessage = "Out of memory loading jalview XML file";
- System.err.println("Out of memory whilst loading jalview XML file");
+ jalview.bin.Console.errPrintln("Out of memory whilst loading jalview XML file");
e.printStackTrace();
}
Desktop.addInternalFrame(af, view.getTitle(),
safeInt(view.getWidth()), safeInt(view.getHeight()));
af.setMenusForViewport();
- System.err.println("Failed to restore view " + view.getTitle()
+ jalview.bin.Console.errPrintln("Failed to restore view " + view.getTitle()
+ " to split frame");
}
}
}
else
{
- System.err.println("Problem loading Jalview file: " + errorMessage);
+ jalview.bin.Console.errPrintln("Problem loading Jalview file: " + errorMessage);
}
}
errorMessage = null;
if (tmpSeq.getStart() != jseq.getStart()
|| tmpSeq.getEnd() != jseq.getEnd())
{
- System.err.println(String.format(
+ jalview.bin.Console.errPrintln(String.format(
"Warning JAL-2154 regression: updating start/end for sequence %s from %d/%d to %d/%d",
tmpSeq.getName(), tmpSeq.getStart(), tmpSeq.getEnd(),
jseq.getStart(), jseq.getEnd()));
// XML.
// and then recover its containing af to allow the settings to be applied.
// TODO: fix for vamsas demo
- System.err.println(
+ jalview.bin.Console.errPrintln(
"About to recover a viewport for existing alignment: Sequence set ID is "
+ uniqueSeqSetId);
Object seqsetobj = retrieveExistingObj(uniqueSeqSetId);
if (seqsetobj instanceof String)
{
uniqueSeqSetId = (String) seqsetobj;
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Recovered extant sequence set ID mapping for ID : New Sequence set ID is "
+ uniqueSeqSetId);
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning : Collision between sequence set ID string and existing jalview object mapping.");
}
createOrLinkStructureViewer(entry, af, ap, jprovider);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Error loading structure viewer: " + e.getMessage());
// failed - try the next one
}
|| version.equalsIgnoreCase("Test")
|| version.equalsIgnoreCase("AUTOMATED BUILD"))
{
- System.err.println("Assuming project file with "
+ jalview.bin.Console.errPrintln("Assuming project file with "
+ (version == null ? "null" : version)
+ " is compatible with Jalview version " + supported);
return true;
//
// @Override
// protected void processKeyEvent(java.awt.event.KeyEvent e) {
- // System.out.println("Jalview2XML AF " + e);
+ // jalview.bin.Console.outPrintln("Jalview2XML AF " + e);
// super.processKeyEvent(e);
//
// }
}
if (matchedAnnotation == null)
{
- System.err.println("Failed to match annotation colour scheme for "
+ jalview.bin.Console.errPrintln("Failed to match annotation colour scheme for "
+ annotationId);
return null;
}
}
// TODO: merges will never happen if we 'know' we have the real dataset
// sequence - this should be detected when id==dssid
- System.err.println(
+ jalview.bin.Console.errPrintln(
"DEBUG Notice: Merged dataset sequence (if you see this often, post at http://issues.jalview.org/browse/JAL-1474)"); // ("
// + (pre ? "prepended" : "") + " "
// + (post ? "appended" : ""));
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning - making up dataset sequence id for DbRef sequence map reference");
sqid = ((Object) ms).toString(); // make up a new hascode for
// undefined dataset sequence hash
} catch (IllegalStateException e)
{
// mixing AND and OR conditions perhaps
- System.err.println(
+ jalview.bin.Console.errPrintln(
String.format("Error reading filter conditions for '%s': %s",
featureType, e.getMessage()));
// return as much as was parsed up to the error
}
else
{
- System.err.println("Malformed compound filter condition");
+ jalview.bin.Console.errPrintln("Malformed compound filter condition");
}
}
}
import java.awt.Graphics;
import java.awt.Graphics2D;
import java.awt.Image;
+import java.awt.RenderingHints;
+import java.awt.Stroke;
import java.awt.geom.AffineTransform;
import java.awt.image.ImageObserver;
import java.util.BitSet;
import java.util.Hashtable;
+import org.jfree.graphics2d.svg.SVGGraphics2D;
+import org.jibble.epsgraphics.EpsGraphics2D;
+
import jalview.analysis.AAFrequency;
import jalview.analysis.CodingUtils;
import jalview.analysis.Rna;
import jalview.analysis.StructureFrequency;
import jalview.api.AlignViewportI;
+import jalview.bin.Cache;
+import jalview.bin.Console;
import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.Annotation;
import jalview.datamodel.ColumnSelection;
private boolean av_ignoreGapsConsensus;
+ private boolean vectorRendition = false;
+
+ private boolean glyphLineDrawn = false;
+
/**
* attributes set from AwtRenderPanelI
*/
* if new annotation with a closing base pair half of the stem,
* display a backward arrow
*/
- g.fillPolygon(new int[] { lastSSX + 5, lastSSX + 5, lastSSX },
+ fillPolygon(g, new int[] { lastSSX + 5, lastSSX + 5, lastSSX },
new int[]
{ y + iconOffset, y + 14 + iconOffset, y + 8 + iconOffset },
3);
* if annotation ending with an opeing base pair half of the stem,
* display a forward arrow
*/
- g.fillPolygon(new int[] { x2 - 5, x2 - 5, x2 },
+ fillPolygon(g, new int[] { x2 - 5, x2 - 5, x2 },
new int[]
{ y + iconOffset, y + 14 + iconOffset, y + 8 + iconOffset },
3);
}
}
// draw arrow body
- g.fillRect(x1, y + 4 + iconOffset, x2 - x1, 7);
+ fillRect(g, x1, y + 4 + iconOffset, x2 - x1, 7);
}
void drawNotCanonicalAnnot(Graphics g, Color nonCanColor,
int iconOffset, int startRes, int column, boolean validRes,
boolean validEnd)
{
- // System.out.println(nonCanColor);
+ // Console.info(nonCanColor);
- g.setColor(nonCanColor);
int sCol = (lastSSX / charWidth)
+ hiddenColumns.visibleToAbsoluteColumn(startRes);
int x1 = lastSSX;
boolean diffdownstream = !validRes || !validEnd
|| row_annotations[column] == null
|| !dc.equals(row_annotations[column].displayCharacter);
- // System.out.println("Column "+column+" diff up: "+diffupstream+"
+ // Console.info("Column "+column+" diff up:
+ // "+diffupstream+"
// down:"+diffdownstream);
// If a closing base pair half of the stem, display a backward arrow
+ if (diffupstream || diffdownstream)
+ {
+ // draw glyphline under arrow
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+ }
+ g.setColor(nonCanColor);
if (column > 0 && Rna.isClosingParenthesis(dc))
{
// if (validRes && column>1 && row_annotations[column-2]!=null &&
// dc.equals(row_annotations[column-2].displayCharacter))
{
- g.fillPolygon(new int[] { lastSSX + 5, lastSSX + 5, lastSSX },
+ fillPolygon(g, new int[] { lastSSX + 5, lastSSX + 5, lastSSX },
new int[]
- { y + iconOffset, y + 14 + iconOffset, y + 8 + iconOffset },
+ { y + iconOffset + 1, y + 13 + iconOffset,
+ y + 7 + iconOffset },
3);
x1 += 5;
}
// display a forward arrow
if (diffdownstream)
{
- g.fillPolygon(new int[] { x2 - 5, x2 - 5, x2 },
+ fillPolygon(g, new int[] { x2 - 6, x2 - 6, x2 - 1 },
new int[]
- { y + iconOffset, y + 14 + iconOffset, y + 8 + iconOffset },
+ { y + iconOffset + 1, y + 13 + iconOffset,
+ y + 7 + iconOffset },
3);
x2 -= 5;
}
}
}
// draw arrow body
- g.fillRect(x1, y + 4 + iconOffset, x2 - x1, 7);
+ unsetAntialias(g);
+ fillRect(g, x1, y + 4 + iconOffset, x2 - x1, 6);
}
// public void updateFromAnnotationPanel(FontMetrics annotFM, AlignViewportI
AlignViewportI av, Graphics g, int activeRow, int startRes,
int endRes)
{
+ if (g instanceof EpsGraphics2D || g instanceof SVGGraphics2D)
+ {
+ this.setVectorRendition(true);
+ }
+ Graphics2D g2d = (Graphics2D) g;
+
long stime = System.currentTimeMillis();
boolean usedFaded = false;
// NOTES:
*
* continue; }
*/
+
// first pass sets up state for drawing continuation from left-hand
// column
// of startRes
+
+ // flag used for vector rendition
+ this.glyphLineDrawn = false;
x = (startRes == 0) ? 0 : -1;
while (x < endRes - startRes)
{
: null;
if (x > -1)
{
+ unsetAntialias(g);
if (activeRow == i)
{
g.setColor(Color.red);
{
if (columnSelection.contains(column))
{
- g.fillRect(x * charWidth, y, charWidth, charHeight);
+ fillRect(g, x * charWidth, y, charWidth, charHeight);
}
}
}
if (row.getInvalidStrucPos() > x)
{
g.setColor(Color.orange);
- g.fillRect(x * charWidth, y, charWidth, charHeight);
+ fillRect(g, x * charWidth, y, charWidth, charHeight);
}
else if (row.getInvalidStrucPos() == x)
{
g.setColor(Color.orange.darker());
- g.fillRect(x * charWidth, y, charWidth, charHeight);
+ fillRect(g, x * charWidth, y, charWidth, charHeight);
}
if (validCharWidth && validRes && displayChar != null
&& (displayChar.length() > 0))
{
- Graphics2D gg = ((Graphics2D) g);
+ // Graphics2D gg = (g);
float fmWidth = fm.charsWidth(displayChar.toCharArray(), 0,
displayChar.length());
if (row_annotations[column].colour == null)
{
- gg.setColor(Color.black);
+ g2d.setColor(Color.black);
}
else
{
- gg.setColor(row_annotations[column].colour);
+ g2d.setColor(row_annotations[column].colour);
}
/*
/*
* translate to drawing position _before_ applying any scaling
*/
- gg.translate(xPos, yPos);
+ g2d.translate(xPos, yPos);
if (scaledToFit)
{
/*
* use a scaling transform to make the label narrower
* (JalviewJS doesn't have Font.deriveFont(AffineTransform))
*/
- gg.transform(
+ g2d.transform(
AffineTransform.getScaleInstance(fmScaling, 1.0));
}
+ setAntialias(g);
if (column == 0 || row.graph > 0)
{
- gg.drawString(displayChar, 0, 0);
+ g2d.drawString(displayChar, 0, 0);
}
else if (row_annotations[column - 1] == null || (labelAllCols
|| !displayChar.equals(
|| (displayChar.length() < 2
&& row_annotations[column].secondaryStructure == ' ')))
{
- gg.drawString(displayChar, 0, 0);
+ g2d.drawString(displayChar, 0, 0);
}
if (scaledToFit)
{
* undo scaling before translating back
* (restoring saved transform does NOT work in JS PDFGraphics!)
*/
- gg.transform(AffineTransform
+ g2d.transform(AffineTransform
.getScaleInstance(1D / fmScaling, 1.0));
}
- gg.translate(-xPos, -yPos);
+ g2d.translate(-xPos, -yPos);
}
}
if (row.hasIcons)
{
// int nb_annot = x - temp;
- // System.out.println("\t type :"+lastSS+"\t x :"+x+"\t nbre
+ // Console.info("\t type :"+lastSS+"\t x
+ // :"+x+"\t nbre
// annot :"+nb_annot);
switch (lastSS)
{
// temp = x;
break;
default:
- g.setColor(Color.gray);
- g.fillRect(lastSSX, y + 6 + iconOffset,
- (x * charWidth) - lastSSX, 2);
- // temp = x;
+ if (isVectorRendition())
+ {
+ // draw single full width glyphline
+ drawGlyphLine(g, lastSSX, endRes - x, y, iconOffset);
+ // disable more glyph lines
+ this.glyphLineDrawn = true;
+ }
+ else
+ {
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+ }
break;
}
}
case 'y':
case 'Z':
case 'z':
- // System.out.println(lastSS);
+ // Console.info(lastSS);
Color nonCanColor = getNotCanonicalColor(lastSS);
drawNotCanonicalAnnot(g, nonCanColor, row_annotations, lastSSX,
x, y, iconOffset, startRes, column, validRes, validEnd);
break;
default:
- drawGlyphLine(g, row_annotations, lastSSX, x, y, iconOffset,
- startRes, column, validRes, validEnd);
+ if (isVectorRendition())
+ {
+ // draw single full width glyphline
+ drawGlyphLine(g, lastSSX, endRes - x, y, iconOffset);
+ // disable more glyph lines
+ this.glyphLineDrawn = true;
+ }
+ else
+ {
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+ }
break;
}
}
}
else
{
- System.err.println(
+ Console.warn(
"rendered with " + renderer.getClass().toString());
}
}
{
if (clipst)
{
- System.err.println(
- "Start clip at : " + yfrom + " (index " + f_i + ")");
+ Console.warn("Start clip at : " + yfrom + " (index " + f_i + ")");
}
if (clipend)
{
- System.err.println(
- "End clip at : " + yto + " (index " + f_to + ")");
+ Console.warn("End clip at : " + yto + " (index " + f_to + ")");
}
}
;
- System.err.println("Annotation Rendering time:"
+ Console.warn("Annotation Rendering time:"
+ (System.currentTimeMillis() - stime));
}
;
// private Color sdNOTCANONICAL_COLOUR;
- void drawGlyphLine(Graphics g, Annotation[] row, int lastSSX, int x,
- int y, int iconOffset, int startRes, int column, boolean validRes,
- boolean validEnd)
+ void drawGlyphLine(Graphics g, int lastSSX, int x, int y, int iconOffset)
{
+ if (glyphLineDrawn)
+ {
+ // if we've drawn a single long glyphline for an export, don't draw the
+ // bits
+ return;
+ }
+ unsetAntialias(g);
g.setColor(GLYPHLINE_COLOR);
g.fillRect(lastSSX, y + 6 + iconOffset, (x * charWidth) - lastSSX, 2);
}
int lastSSX, int x, int y, int iconOffset, int startRes,
int column, boolean validRes, boolean validEnd)
{
- g.setColor(SHEET_COLOUR);
-
if (!validEnd || !validRes || row == null || row[column] == null
|| row[column].secondaryStructure != 'E')
{
- g.fillRect(lastSSX, y + 4 + iconOffset, (x * charWidth) - lastSSX - 4,
- 7);
- g.fillPolygon(
+ // draw the glyphline underneath
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+
+ g.setColor(SHEET_COLOUR);
+ fillRect(g, lastSSX, y + 4 + iconOffset,
+ (x * charWidth) - lastSSX - 4, 6);
+ fillPolygon(g,
new int[]
- { (x * charWidth) - 4, (x * charWidth) - 4, (x * charWidth) },
+ { (x * charWidth) - 6, (x * charWidth) - 6,
+ (x * charWidth - 1) },
new int[]
- { y + iconOffset, y + 14 + iconOffset, y + 7 + iconOffset },
+ { y + iconOffset + 1, y + 13 + iconOffset,
+ y + 7 + iconOffset },
3);
}
else
{
- g.fillRect(lastSSX, y + 4 + iconOffset, (x + 1) * charWidth - lastSSX,
- 7);
+ g.setColor(SHEET_COLOUR);
+ fillRect(g, lastSSX, y + 4 + iconOffset, (x * charWidth) - lastSSX,
+ 6);
}
-
}
void drawHelixAnnot(Graphics g, Annotation[] row, int lastSSX, int x,
int y, int iconOffset, int startRes, int column, boolean validRes,
boolean validEnd)
{
- g.setColor(HELIX_COLOUR);
-
int sCol = (lastSSX / charWidth)
+ hiddenColumns.visibleToAbsoluteColumn(startRes);
int x1 = lastSSX;
int x2 = (x * charWidth);
- if (USE_FILL_ROUND_RECT)
+ if (USE_FILL_ROUND_RECT || isVectorRendition())
{
+ // draw glyph line behind helix (visible in EPS or SVG output)
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+
+ g.setColor(HELIX_COLOUR);
+ setAntialias(g);
int ofs = charWidth / 2;
// Off by 1 offset when drawing rects and ovals
// to offscreen image on the MAC
- g.fillRoundRect(lastSSX, y + 4 + iconOffset, x2 - x1, 8, 8, 8);
+ fillRoundRect(g, lastSSX, y + 3 + iconOffset, x2 - x1 - 1, 8, 8, 8);
if (sCol == 0 || row[sCol - 1] == null
|| row[sCol - 1].secondaryStructure != 'H')
{
else
{
// g.setColor(Color.orange);
- g.fillRoundRect(lastSSX, y + 4 + iconOffset, x2 - x1 - ofs + 1, 8,
- 0, 0);
+ fillRoundRect(g, lastSSX, y + 3 + iconOffset, x2 - x1 - ofs, 8, 0,
+ 0);
}
if (!validRes || row[column] == null
|| row[column].secondaryStructure != 'H')
else
{
// g.setColor(Color.magenta);
- g.fillRoundRect(lastSSX + ofs, y + 4 + iconOffset,
- x2 - x1 - ofs + 1, 8, 0, 0);
-
+ fillRoundRect(g, lastSSX + ofs, y + 3 + iconOffset, x2 - x1 - ofs,
+ 8, 0, 0);
}
return;
}
- if (sCol == 0 || row[sCol - 1] == null
- || row[sCol - 1].secondaryStructure != 'H')
+ boolean leftEnd = sCol == 0 || row[sCol - 1] == null
+ || row[sCol - 1].secondaryStructure != 'H';
+ boolean rightEnd = !validRes || row[column] == null
+ || row[column].secondaryStructure != 'H';
+
+ if (leftEnd || rightEnd)
+ {
+ drawGlyphLine(g, lastSSX, x, y, iconOffset);
+ }
+ g.setColor(HELIX_COLOUR);
+
+ if (leftEnd)
{
- g.fillArc(lastSSX, y + 4 + iconOffset, charWidth, 8, 90, 180);
+ fillArc(g, lastSSX, y + 3 + iconOffset, charWidth, 8, 90, 180);
x1 += charWidth / 2;
}
- if (!validRes || row[column] == null
- || row[column].secondaryStructure != 'H')
+ if (rightEnd)
{
- g.fillArc((x * charWidth) - charWidth, y + 4 + iconOffset, charWidth,
- 8, 270, 180);
+ fillArc(g, ((x - 1) * charWidth), y + 3 + iconOffset, charWidth, 8,
+ 270, 180);
x2 -= charWidth / 2;
}
- g.fillRect(x1, y + 4 + iconOffset, x2 - x1, 8);
+ fillRect(g, x1, y + 3 + iconOffset, x2 - x1, 8);
}
void drawLineGraph(Graphics g, AlignmentAnnotation _aa,
{
return;
}
+ Stroke roundStroke = new BasicStroke(1, BasicStroke.CAP_ROUND,
+ BasicStroke.JOIN_ROUND);
+ Stroke squareStroke = new BasicStroke(1, BasicStroke.CAP_SQUARE,
+ BasicStroke.JOIN_MITER);
+ Graphics2D g2d = (Graphics2D) g;
+ Stroke prevStroke = g2d.getStroke();
+ g2d.setStroke(roundStroke);
int x = 0;
}
g.setColor(Color.gray);
- g.drawLine(x - charWidth, y2, (eRes - sRes + 1) * charWidth, y2);
+ drawLine(g, squareStroke, x * charWidth - charWidth, y2,
+ (eRes - sRes) * charWidth, y2);
eRes = Math.min(eRes, aa_annotations.length);
// standalone value
y1 = y - (int) (((aa_annotations[column].value - min) / range)
* graphHeight);
- g.drawLine(x * charWidth + charWidth / 4, y1,
+ drawLine(g, x * charWidth + charWidth / 4, y1,
x * charWidth + 3 * charWidth / 4, y1);
x++;
continue;
y2 = y - (int) (((aa_annotations[column].value - min) / range)
* graphHeight);
- g.drawLine(x * charWidth - charWidth / 2, y1,
+ drawLine(g, (x - 1) * charWidth + charWidth / 2, y1,
x * charWidth + charWidth / 2, y2);
x++;
}
{
g.setColor(_aa.threshold.colour);
Graphics2D g2 = (Graphics2D) g;
- g2.setStroke(new BasicStroke(1, BasicStroke.CAP_SQUARE,
+ Stroke s = new BasicStroke(1, BasicStroke.CAP_SQUARE,
BasicStroke.JOIN_ROUND, 3f, new float[]
- { 5f, 3f }, 0f));
+ { 5f, 3f }, 0f);
y2 = (int) (y - ((_aa.threshold.value - min) / range) * graphHeight);
- g.drawLine(0, y2, (eRes - sRes) * charWidth, y2);
- g2.setStroke(new BasicStroke());
+ drawLine(g, s, 0, y2, (eRes - sRes) * charWidth, y2);
}
+ g2d.setStroke(prevStroke);
}
@SuppressWarnings("unused")
g.setColor(Color.gray);
- g.drawLine(x, y2, (eRes - sRes) * charWidth, y2);
+ drawLine(g, x, y2, (eRes - sRes) * charWidth, y2);
int column;
int aaMax = aa_annotations.length - 1;
{
if (y1 - y2 > 0)
{
- g.fillRect(x * charWidth, y2, charWidth, y1 - y2);
+ fillRect(g, x * charWidth, y2, charWidth, y1 - y2);
}
else
{
- g.fillRect(x * charWidth, y1, charWidth, y2 - y1);
+ fillRect(g, x * charWidth, y1, charWidth, y2 - y1);
}
}
// draw profile if available
// lm is not necessary - we can just use fm - could be off by no more
// than 0.5 px
// LineMetrics lm = g.getFontMetrics(ofont).getLineMetrics("Q", g);
- // System.out.println(asc + " " + dec + " " + (asc - lm.getAscent())
+ // Console.info(asc + " " + dec + " " + (asc -
+ // lm.getAscent())
// + " " + (dec - lm.getDescent()));
double asc = fm.getAscent();
if (_aa.threshold != null)
{
g.setColor(_aa.threshold.colour);
- Graphics2D g2 = (Graphics2D) g;
- g2.setStroke(new BasicStroke(1, BasicStroke.CAP_SQUARE,
+ Stroke s = new BasicStroke(1, BasicStroke.CAP_SQUARE,
BasicStroke.JOIN_ROUND, 3f, new float[]
- { 5f, 3f }, 0f));
+ { 5f, 3f }, 0f);
y2 = (int) (y
- ((_aa.threshold.value - min) / range) * _aa.graphHeight);
- g.drawLine(0, y2, (eRes - sRes) * charWidth, y2);
- g2.setStroke(new BasicStroke());
+ drawLine(g, s, 0, y2, (eRes - sRes) * charWidth, y2);
}
}
{
eRes = Math.min(eRes, aa_annotations.length);
g.setColor(Color.white);
- g.fillRect(0, 0, width, y);
+ fillRect(g, 0, 0, width, y);
g.setColor(new Color(0, 0, 180));
int x = 0, height;
height = y;
}
- g.fillRect(x, y - height, charWidth, height);
+ fillRect(g, x, y - height, charWidth, height);
}
x += charWidth;
}
return new Color(0, 80, 255);
default:
- System.out.println("This is not a interaction : " + lastss);
+ Console.info("This is not a interaction : " + lastss);
return null;
}
}
+
+ private void fillPolygon(Graphics g, int[] xpoints, int[] ypoints, int n)
+ {
+ setAntialias(g);
+ g.fillPolygon(xpoints, ypoints, n);
+ }
+
+ /*
+ private void fillRect(Graphics g, int a, int b, int c, int d)
+ {
+ fillRect(g, false, a, b, c, d);
+ }*/
+
+ private void fillRect(Graphics g, int a, int b, int c, int d)
+ {
+ unsetAntialias(g);
+ g.fillRect(a, b, c, d);
+ }
+
+ private void fillRoundRect(Graphics g, int a, int b, int c, int d, int e,
+ int f)
+ {
+ setAntialias(g);
+ g.fillRoundRect(a, b, c, d, e, f);
+ }
+
+ private void fillArc(Graphics g, int a, int b, int c, int d, int e, int f)
+ {
+ setAntialias(g);
+ g.fillArc(a, b, c, d, e, f);
+ }
+
+ private void drawLine(Graphics g, Stroke s, int a, int b, int c, int d)
+ {
+ Graphics2D g2d = (Graphics2D) g;
+ Stroke p = g2d.getStroke();
+ g2d.setStroke(s);
+ drawLine(g, a, b, c, d);
+ g2d.setStroke(p);
+ }
+
+ private void drawLine(Graphics g, int a, int b, int c, int d)
+ {
+ setAntialias(g);
+ g.drawLine(a, b, c, d);
+ }
+
+ private void setAntialias(Graphics g)
+ {
+ if (isVectorRendition())
+ {
+ // no need to antialias vector drawings
+ return;
+ }
+ if (Cache.getDefault("ANTI_ALIAS", true))
+ {
+ Graphics2D g2d = (Graphics2D) g;
+ g2d.setRenderingHint(RenderingHints.KEY_ANTIALIASING,
+ RenderingHints.VALUE_ANTIALIAS_ON);
+ }
+ }
+
+ private void unsetAntialias(Graphics g)
+ {
+ if (isVectorRendition())
+ {
+ // no need to antialias vector drawings
+ return;
+ }
+ Graphics2D g2d = (Graphics2D) g;
+ g2d.setRenderingHint(RenderingHints.KEY_ANTIALIASING,
+ RenderingHints.VALUE_ANTIALIAS_OFF);
+ }
+
+ public void setVectorRendition(boolean b)
+ {
+ vectorRendition = b;
+ }
+
+ public boolean isVectorRendition()
+ {
+ return vectorRendition;
+ }
}
final String reply = "REST not yet implemented; received "
+ request.getMethod() + ": " + request.getRequestURL()
+ (queryString == null ? "" : "?" + queryString);
- System.out.println(reply);
+ jalview.bin.Console.outPrintln(reply);
response.setHeader("Cache-Control", "no-cache/no-store");
response.setHeader("Content-type", "text/plain");
} catch (Exception ex)
{
// used to try to parse a V1 Castor generated colours file
- System.err.println("Failed to read colour scheme from " + filePath
+ jalview.bin.Console.errPrintln("Failed to read colour scheme from " + filePath
+ " : " + ex.toString());
}
cs.getSchemeClass().getDeclaredConstructor().newInstance());
} catch (InstantiationException | IllegalAccessException e)
{
- System.err.println("Error instantiating colour scheme for "
+ jalview.bin.Console.errPrintln("Error instantiating colour scheme for "
+ cs.toString() + " " + e.getMessage());
e.printStackTrace();
} catch (ReflectiveOperationException roe)
String name = cs.getSchemeName();
if (name == null)
{
- System.err.println("ColourScheme name may not be null");
+ jalview.bin.Console.errPrintln("ColourScheme name may not be null");
return;
}
this.mask = setNums(s);
// for (int i=0; i < mask.length; i++) {
- // System.out.println(mask[i] + " " + ResidueProperties.aa[mask[i]]);
+ // jalview.bin.Console.outPrintln(mask[i] + " " + ResidueProperties.aa[mask[i]]);
// }
}
@Deprecated
public boolean isConserved(int[][] cons2, int col, int size)
{
- System.out.println("DEPRECATED!!!!");
+ jalview.bin.Console.outPrintln("DEPRECATED!!!!");
return isConserved(cons2, col, size, true);
}
if (tot > ((threshold * size) / 100))
{
- // System.out.println("True conserved "+tot+" from "+threshold+" out of
+ // jalview.bin.Console.outPrintln("True conserved "+tot+" from "+threshold+" out of
// "+size+" : "+maskstr);
return true;
}
for (int x = 0; x < this.annotation._rnasecstr.length; x++)
{
- // System.out.println(this.annotation._rnasecstr[x] + " Begin" +
+ // jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x] + " Begin" +
// this.annotation._rnasecstr[x].getBegin());
- // System.out.println(this.annotation._rnasecstr[x].getFeatureGroup());
+ // jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x].getFeatureGroup());
// pairs.put(this.annotation._rnasecstr[x].getBegin(),
// this.annotation._rnasecstr[x].getEnd());
@Override
public Color findColour(char c)
{
- // System.out.println("called"); log.debug
+ // jalview.bin.Console.outPrintln("called"); log.debug
// Generate a random pastel color
return ResidueProperties.purinepyrimidine[ResidueProperties.purinepyrimidineIndex[c]];// jalview.util.ColorUtils.generateRandomColor(Color.white);
{
Color currentColour = Color.white;
String currentHelix = null;
- // System.out.println(c + " " + j);
+ // jalview.bin.Console.outPrintln(c + " " + j);
currentHelix = positionsToHelix.get(j);
- // System.out.println(positionsToHelix.get(j));
+ // jalview.bin.Console.outPrintln(positionsToHelix.get(j));
if (currentHelix != null)
{
currentColour = helixcolorhash.get(currentHelix);
}
- // System.out.println(c + " " + j + " helix " + currentHelix + " " +
+ // jalview.bin.Console.outPrintln(c + " " + j + " helix " + currentHelix + " " +
// currentColour);
return currentColour;
}
{
if (!ttype.toLowerCase(Locale.ROOT).startsWith("no"))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Ignoring unrecognised threshold type : " + ttype);
}
}
featureColour.setThreshold(Float.valueOf(tval).floatValue());
} catch (Exception e)
{
- System.err.println("Couldn't parse threshold value as a float: ("
+ jalview.bin.Console.errPrintln("Couldn't parse threshold value as a float: ("
+ tval + ")");
}
}
if (gcol.hasMoreTokens())
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Ignoring additional tokens in parameters in graduated colour specification\n");
while (gcol.hasMoreTokens())
{
- System.err.println(BAR + gcol.nextToken());
+ jalview.bin.Console.errPrintln(BAR + gcol.nextToken());
}
- System.err.println("\n");
+ jalview.bin.Console.errPrintln("\n");
}
return featureColour;
} catch (Exception e)
{
/*
- * System.out.println(this.annotation._rnasecstr[x] + " Begin" +
+ * jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x] + " Begin" +
* this.annotation._rnasecstr[x].getBegin());
*/
- // System.out.println(this.annotation._rnasecstr[x].getFeatureGroup());
+ // jalview.bin.Console.outPrintln(this.annotation._rnasecstr[x].getFeatureGroup());
positionsToHelix.put(this.annotation._rnasecstr[x].getBegin(),
this.annotation._rnasecstr[x].getFeatureGroup());
public static void main(String[] args)
{
Hashtable<String, Vector<String>> aaProps = new Hashtable<>();
- System.out.println("my %aa = {");
+ jalview.bin.Console.outPrintln("my %aa = {");
// invert property hashes
for (String pname : propHash.keySet())
{
System.out.print("'" + props.nextElement() + "'");
if (props.hasMoreElements())
{
- System.out.println(", ");
+ jalview.bin.Console.outPrintln(", ");
}
}
- System.out.println("]" + (res.hasMoreElements() ? "," : ""));
+ jalview.bin.Console.outPrintln("]" + (res.hasMoreElements() ? "," : ""));
}
- System.out.println("};");
+ jalview.bin.Console.outPrintln("};");
}
// to here
if (col == null)
{
- System.out.println("Making colour from name: " + colour);
+ jalview.bin.Console.outPrintln("Making colour from name: " + colour);
col = ColorUtils.createColourFromName(colour);
}
}
} catch (Exception ex)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Error parsing userDefinedColours:\n" + token + "\n" + ex);
}
{
if (mappings.isEmpty())
{
- System.err.println("reportMapping: No PDB/Sequence mappings.");
+ jalview.bin.Console.errPrintln("reportMapping: No PDB/Sequence mappings.");
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"reportMapping: There are " + mappings.size() + " mappings.");
int i = 0;
for (StructureMapping sm : mappings)
{
- System.err.println("mapping " + i++ + " : " + sm.pdbfile);
+ jalview.bin.Console.errPrintln("mapping " + i++ + " : " + sm.pdbfile);
}
}
}
chain.transferResidueAnnotation(siftsMapping, null);
} catch (SiftsException e)
{
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Unexpected exception during SIFTS mapping - falling back to NW for this sequence/structure pair");
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
}
}
if (!foundSiftsMappings.isEmpty())
*
* if (mappings[j].sequence == seq && mappings[j].getPdbId().equals(pdbid)
* && mappings[j].pdbfile.equals(sl.getPdbFile())) {
- * System.out.println(pdbid+" "+mappings[j].getPdbId() +"
+ * jalview.bin.Console.outPrintln(pdbid+" "+mappings[j].getPdbId() +"
* "+mappings[j].pdbfile);
*
* java.awt.Color col; for(int index=0; index<seq.getLength(); index++) {
boolean removed = seqmappings.remove(acf);
if (removed && seqmappings.isEmpty())
{ // debug
- System.out.println("All mappings removed");
+ jalview.bin.Console.outPrintln("All mappings removed");
}
}
}
if (waiting)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Timed out waiting for structure viewer to load file "
+ notLoaded);
return false;
}
else
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Unexpected key returned from identifiers jalview service");
return idData;
}
// BH 2018 -- added more valuable report
if (errorMessage != null)
{
- System.err.println("IdentifiersUrlProvider: cannot read " + idFileName
+ jalview.bin.Console.errPrintln("IdentifiersUrlProvider: cannot read " + idFileName
+ ": " + errorMessage);
}
return idData;
}
}
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Error initialising UrlProvider - no custom url provider");
return null;
}
// testing part
// you may omit this part for your application
//
- System.out.println("Hello World 2");
- System.out.println("All fonts available to Graphic2D:\n");
+ jalview.bin.Console.outPrintln("Hello World 2");
+ jalview.bin.Console.outPrintln("All fonts available to Graphic2D:\n");
GraphicsEnvironment ge = GraphicsEnvironment
.getLocalGraphicsEnvironment();
String[] fontNames = ge.getAvailableFontFamilyNames();
for (int n = 0; n < fontNames.length; n++)
{
- System.out.println(fontNames[n]);
+ jalview.bin.Console.outPrintln(fontNames[n]);
}
// Testing part: simple an error thrown anywhere in this JVM will be printed
// on the Console
// We do it with a seperate Thread becasue we don't wan't to break a Thread
// used by the Console.
- System.out.println("\nLets throw an error on this console");
+ jalview.bin.Console.outPrintln("\nLets throw an error on this console");
errorThrower = new Thread(this);
errorThrower.setDaemon(true);
errorThrower.start();
if (channelPropsURL == null)
{
// complete failure of channel_properties, set all properties to defaults
- System.err.println("Failed to find '/" + CHANNEL_PROPERTIES_FILENAME
+ jalview.bin.Console.errPrintln("Failed to find '/" + CHANNEL_PROPERTIES_FILENAME
+ "' file at '"
+ (channelPropsURL == null ? "null"
: channelPropsURL.toString())
channelPropsIS.close();
} catch (IOException e)
{
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
// return false;
}
}
channelProps.load(is);
} catch (FileNotFoundException e)
{
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
} catch (IOException e)
{
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
}
}
}
}
else
{
- System.err.println("Failed to get channel property '" + key + "'");
+ jalview.bin.Console.errPrintln("Failed to get channel property '" + key + "'");
}
}
return null;
img = imgIcon == null ? null : imgIcon.getImage();
if (img == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to load channel image " + key + "=" + path);
if (!useClassDefaultImage)
{
{
return urlMap().getOrDefault(key, null);
}
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Do not use getImageURL(key) before using getImage(key...)");
}
return null;
}
else
{
- System.err.println("Malformed PDB DR line:" + acn);
+ jalview.bin.Console.errPrintln("Malformed PDB DR line:" + acn);
}
}
else
// debug
/*
* for (int s = 0; s <= rg.numSubs(); s++) {
- * System.err.println("Sub " + s + " : " + rg.matchedFrom(s) +
+ * jalview.bin.Console.errPrintln("Sub " + s + " : " + rg.matchedFrom(s) +
* " : " + rg.matchedTo(s) + " : '" + rg.stringMatched(s) + "'");
* }
*/
if (url == null)
{
- System.out.println("Created NO urls.");
+ jalview.bin.Console.outPrintln("Created NO urls.");
}
else
{
- System.out.println("Created a url from " + ((int[]) url[0])[0]
+ jalview.bin.Console.outPrintln("Created a url from " + ((int[]) url[0])[0]
+ "out of " + idstring[0].length + " sequences.");
- System.out.println("Sequences that did not match:");
+ jalview.bin.Console.outPrintln("Sequences that did not match:");
for (int sq = 0; sq < idstring[0].length; sq++)
{
if (!((boolean[]) url[1])[sq])
{
- System.out.println("Seq " + sq + ": " + idstring[0][sq] + "\t: "
+ jalview.bin.Console.outPrintln("Seq " + sq + ": " + idstring[0][sq] + "\t: "
+ idstring[1][sq]);
}
}
- System.out.println("Sequences that DID match:");
+ jalview.bin.Console.outPrintln("Sequences that DID match:");
for (int sq = 0; sq < idstring[0].length; sq++)
{
if (((boolean[]) url[1])[sq])
{
- System.out.println("Seq " + sq + ": " + idstring[0][sq] + "\t: "
+ jalview.bin.Console.outPrintln("Seq " + sq + ": " + idstring[0][sq] + "\t: "
+ idstring[1][sq]);
}
}
- System.out.println("The generated URL:");
- System.out.println(((String[]) url[3])[0]);
+ jalview.bin.Console.outPrintln("The generated URL:");
+ jalview.bin.Console.outPrintln(((String[]) url[3])[0]);
}
}
GroupUrlLink ul = new GroupUrlLink(links[i]);
if (ul.isValid())
{
- System.out.println("\n\n\n");
- System.out.println(
+ jalview.bin.Console.outPrintln("\n\n\n");
+ jalview.bin.Console.outPrintln(
"Link " + i + " " + links[i] + " : " + ul.toString());
- System.out.println(" pref : " + ul.getUrl_prefix());
- System.out.println(" IdReplace : " + ul.getIDRegexReplace());
- System.out.println(" SeqReplace : " + ul.getSeqRegexReplace());
- System.out.println(" Suffixes : " + ul.getUrl_suffix());
+ jalview.bin.Console.outPrintln(" pref : " + ul.getUrl_prefix());
+ jalview.bin.Console.outPrintln(" IdReplace : " + ul.getIDRegexReplace());
+ jalview.bin.Console.outPrintln(" SeqReplace : " + ul.getSeqRegexReplace());
+ jalview.bin.Console.outPrintln(" Suffixes : " + ul.getUrl_suffix());
- System.out.println(
+ jalview.bin.Console.outPrintln(
"<insert input id and sequence strings here> Without onlyIfMatches:");
Object[] urls;
try
testUrls(ul, seqsandids, urls);
} catch (UrlStringTooLongException ex)
{
- System.out.println("too long exception " + ex);
+ jalview.bin.Console.outPrintln("too long exception " + ex);
}
- System.out.println(
+ jalview.bin.Console.outPrintln(
"<insert input id and sequence strings here> With onlyIfMatches set:");
try
{
testUrls(ul, seqsandids, urls);
} catch (UrlStringTooLongException ex)
{
- System.out.println("too long exception " + ex);
+ jalview.bin.Console.outPrintln("too long exception " + ex);
}
}
else
{
- System.err.println("Invalid URLLink : " + links[i] + " : "
+ jalview.bin.Console.errPrintln("Invalid URLLink : " + links[i] + " : "
+ ul.getInvalidMessage());
}
}
public static boolean checkUrlAvailable(URL url, int readTimeout)
throws IOException, ProtocolException
{
- // System.out.println(System.currentTimeMillis() + " " + url);
+ // jalview.bin.Console.outPrintln(System.currentTimeMillis() + " " + url);
HttpURLConnection connection = (HttpURLConnection) url.openConnection();
import java.net.URL;
import java.util.Properties;
+import jalview.bin.Console;
+
public class LaunchUtils
{
+ // setting these is LaunchUtils so don't need to import Platform
+ public final static boolean isMac = System.getProperty("os.name")
+ .indexOf("Mac") > -1;
+
+ public final static boolean isWindows = System.getProperty("os.name")
+ .indexOf("Win") > -1;
+
+ private static boolean isJS = /** @j2sNative true || */
+ false;
+
public static void loadChannelProps(File dir)
{
ChannelProperties.loadProps(dir);
return null;
} catch (IOException e)
{
- System.err.println(e.getMessage());
+ jalview.bin.Console.errPrintln(e.getMessage());
return null;
}
}
public static int getJavaCompileVersion()
{
- if (Platform.isJS())
+ if (LaunchUtils.isJS)
{
return -1;
}
null);
if (JCV == null)
{
- System.out.println(
+ Console.errPrintln(
"Could not obtain JAVA_COMPILE_VERSION for comparison");
return -2;
}
JAVA_COMPILE_VERSION = Integer.parseInt(JCV);
} catch (MalformedURLException e)
{
- System.err.println("Could not find " + buildDetails);
+ jalview.bin.Console.errPrintln("Could not find " + buildDetails);
return -3;
} catch (IOException e)
{
- System.err.println("Could not load " + buildDetails);
+ jalview.bin.Console.errPrintln("Could not load " + buildDetails);
return -4;
} catch (NumberFormatException e)
{
- System.err.println("Could not parse JAVA_COMPILE_VERSION");
+ jalview.bin.Console.errPrintln("Could not parse JAVA_COMPILE_VERSION");
return -5;
}
public static int getJavaVersion()
{
- if (Platform.isJS())
+ if (LaunchUtils.isJS)
{
return -1;
}
String JV = System.getProperty("java.version");
if (JV == null)
{
- System.out.println("Could not obtain java.version for comparison");
+ Console.errPrintln("Could not obtain java.version for comparison");
return -2;
}
if (JV.startsWith("1."))
: Integer.parseInt(JV.substring(0, JV.indexOf(".")));
} catch (NumberFormatException e)
{
- System.err.println("Could not parse java.version");
+ jalview.bin.Console.errPrintln("Could not parse java.version");
return -3;
}
return JAVA_VERSION;
public static boolean checkJavaVersion()
{
- if (Platform.isJS())
+ if (LaunchUtils.isJS)
{
return true;
}
if (java_compile_version <= 0 || java_version <= 0)
{
- System.out.println("Could not make Java version check");
+ Console.errPrintln("Could not make Java version check");
return true;
}
// Warn if these java.version and JAVA_COMPILE_VERSION conditions exist
return true;
}
+
+ public static String findJavaBin(boolean winConsole)
+ {
+ return findJavaBin(System.getProperty("java.home"), winConsole, true);
+ }
+
+ /*
+ * Returns a string path to the most likely java binary wanted to run this
+ * installation of Jalview.
+ *
+ * @param winConsole whether to use java.exe (console) in preference to javaw.exe
+ * (only affects Windows).
+ * @param javaHome Try this javaHome dir (defaults to the running java.home).
+ * @param generic Return a generic java command if not found.
+ */
+ public static String findJavaBin(String javaHome, boolean winConsole,
+ boolean generic)
+ {
+ String javaBin = null;
+ final String javaExe = winConsole ? "java.exe" : "javaw.exe";
+ final String java = "java";
+
+ if (javaHome != null)
+ {
+ // property "channel.app_name" is set by install4j when launching getdown
+ String propertyAppName = System.getProperty("channel.app_name");
+ final String appName = (propertyAppName != null
+ && propertyAppName.length() > 0) ? propertyAppName
+ : ChannelProperties.getProperty("app_name");
+
+ final String javaBinDir = javaHome + File.separator + "bin"
+ + File.separator;
+
+ // appName and "Jalview" will not point to javaw.exe or java.exe but in
+ // this case that's okay because the taskbar display name problem doesn't
+ // manifest in Windows. See JAL-3820, JAL-4189.
+ for (String name : new String[] { appName, "Jalview", java, javaExe })
+ {
+ if (LaunchUtils.checkJVMSymlink(javaBinDir + name, winConsole))
+ {
+ javaBin = javaBinDir + name;
+ break;
+ }
+ }
+ }
+
+ if (javaBin == null && generic)
+ {
+ javaBin = LaunchUtils.isWindows ? javaExe : java;
+ }
+
+ return javaBin;
+ }
+
+ /*
+ * checkJVMSymlink returns true if the path in testBin *is* a java binary, or
+ * points to a java binary.
+ * @param testBin The binary or symbolic link to check
+ * @param winConsole whether we are in/want a Windows console (only relevant for Windows,
+ * determines whether we use java.exe or javaw.exe)
+ */
+ private static boolean checkJVMSymlink(String testBin, boolean winConsole)
+ {
+ File testBinFile = new File(testBin);
+ if (!testBinFile.exists())
+ {
+ return false;
+ }
+ File targetFile = null;
+ try
+ {
+ targetFile = testBinFile.getCanonicalFile();
+ } catch (IOException e)
+ {
+ return false;
+ }
+ final String javaExe = winConsole ? "java.exe" : "javaw.exe";
+ if (targetFile != null && ("java".equals(targetFile.getName())
+ || javaExe.equals(targetFile.getName())))
+ {
+ return true;
+ }
+ return false;
+ }
}
init = true;
} catch (Exception e)
{
- System.err.println("Problems initializing the log4j system\n");
+ jalview.bin.Console.errPrintln("Problems initializing the log4j system\n");
e.printStackTrace(System.err);
}
}
time = mark = t;
if (msg != null)
{
- System.err.println("Platform: timer reset\t\t\t" + msg);
+ jalview.bin.Console.errPrintln("Platform: timer reset\t\t\t" + msg);
}
break;
case TIME_MARK:
}
if (msg != null)
{
- System.err.println("Platform: timer mark\t" + ((t - time) / 1000f)
+ jalview.bin.Console.errPrintln("Platform: timer mark\t" + ((t - time) / 1000f)
+ "\t" + ((t - mark) / 1000f) + "\t" + msg);
}
mark = t;
case TIME_GET:
if (msg != null)
{
- System.err.println("Platform: timer dur\t" + ((t - time) / 1000f)
+ jalview.bin.Console.errPrintln("Platform: timer dur\t" + ((t - time) / 1000f)
+ "\t" + ((duration) / 1000f) + "\t" + msg);
}
set = 0;
* info[key];
*/
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Platform id=" + id + " reading Info." + key + " = " + value);
p.put(id + "_" + key, value);
if (isJS())
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Platform adding known access-control-allow-origin * for domain "
+ domain);
/**
* @j2sNative var a =
* decodeURI((document.location.href.replace("&","?").split("?j2s")[0]
* + "?").split("?")[1].split("#")[0]); a &&
- * (System.out.println("URL arguments detected were "+a)) &&
+ * (jalview.bin.Console.outPrintln("URL arguments detected were "+a)) &&
* (J2S.thisApplet.__Info.urlargs = a.split(" "));
* (!J2S.thisApplet.__Info.args || J2S.thisApplet.__Info.args
* == "" || J2S.thisApplet.__Info.args == "??") &&
- * (J2S.thisApplet.__Info.args = a) && (System.out.println("URL
+ * (J2S.thisApplet.__Info.args = a) && (jalview.bin.Console.outPrintln("URL
* arguments were passed to J2S main."));
*/
} catch (Throwable t)
jv.clear();
if (DEBUG)
{
- System.err.println("Array from '" + delimiter
+ jalview.bin.Console.errPrintln("Array from '" + delimiter
+ "' separated List:\n" + v.length);
for (int i = 0; i < v.length; i++)
{
- System.err.println("item " + i + " '" + v[i] + "'");
+ jalview.bin.Console.errPrintln("item " + i + " '" + v[i] + "'");
}
}
return v;
}
if (DEBUG)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Empty Array from '" + delimiter + "' separated List");
}
return null;
{
System.err
.println("Returning '" + separator + "' separated List:\n");
- System.err.println(v);
+ jalview.bin.Console.errPrintln(v);
}
return v.toString();
}
if (DEBUG)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Returning empty '" + separator + "' separated List\n");
}
return "" + separator;
return min < text.length() + 1 ? min : -1;
}
+ public static boolean equalsIgnoreCase(String s1, String s2)
+ {
+ if (s1 == null || s2 == null)
+ {
+ return s1 == s2;
+ }
+ return s1.toLowerCase(Locale.ROOT).equals(s2.toLowerCase(Locale.ROOT));
+ }
+
public static int indexOfFirstWhitespace(String text)
{
int index = -1;
// debug
for (int s = 0; s <= rg.numSubs(); s++)
{
- System.err.println("Sub " + s + " : " + rg.matchedFrom(s)
+ jalview.bin.Console.errPrintln("Sub " + s + " : " + rg.matchedFrom(s)
+ " : " + rg.matchedTo(s) + " : '"
+ rg.stringMatched(s) + "'");
}
}
if (calculator.workingInvolvedWith(alignmentAnnotation))
{
- // System.err.println("grey out ("+alignmentAnnotation.label+")");
+ // jalview.bin.Console.errPrintln("grey out ("+alignmentAnnotation.label+")");
return true;
}
return false;
{
if (sequenceSetID != null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning - overwriting a sequenceSetId for a viewport!");
}
sequenceSetID = new String(newid);
{
if (aa == null)
{
- System.err.println("Null annotation row: ignoring.");
+ jalview.bin.Console.errPrintln("Null annotation row: ignoring.");
continue;
}
if (!aa.visible)
{
if (this == av)
{
- System.err.println("Ignoring recursive setCodingComplement request");
+ jalview.bin.Console.errPrintln("Ignoring recursive setCodingComplement request");
}
else
{
*/
public void setStartEndSeq(int start, int end)
{
- // System.out.println("ViewportRange setStartEndSeq " + start + " " + end);
+ // jalview.bin.Console.outPrintln("ViewportRange setStartEndSeq " + start + " " + end);
int[] oldvalues = updateStartEndSeq(start, end);
int oldstartseq = oldvalues[0];
int oldendseq = oldvalues[1];
{
vpstart = visHeight - h;
}
- // System.out.println("ViewportRanges setviewportStartAndHeight " + vpstart
+ // jalview.bin.Console.outPrintln("ViewportRanges setviewportStartAndHeight " + vpstart
// + " " + start + " " + h + " " + getVisibleAlignmentHeight());
setStartEndSeq(vpstart, vpstart + h - 1);
*/
package jalview.viewmodel.styles;
-import jalview.api.ViewStyleI;
-
import java.awt.Color;
+import jalview.api.ViewStyleI;
+
/**
* A container for holding alignment view properties. View properties are
* data-independent, which means they can be safely copied between views
{
synchronized (inProgress)
{
- // System.err.println("Worker " + worker + " marked as complete.");
+ // jalview.bin.Console.errPrintln("Worker " + worker + " marked as complete.");
inProgress.remove(worker);
List<AlignCalcWorkerI> upd = updating.get(worker.getClass());
if (upd != null)
public boolean isWorking(AlignCalcWorkerI worker)
{
synchronized (inProgress)
- {// System.err.println("isWorking : worker "+(worker!=null ?
+ {// jalview.bin.Console.errPrintln("isWorking : worker "+(worker!=null ?
// worker.getClass():"null")+ " "+hashCode());
return worker != null && inProgress.contains(worker);
}
boolean working=false;
synchronized (inProgress)
{
- // System.err.println("isWorking "+hashCode());
+ // jalview.bin.Console.errPrintln("isWorking "+hashCode());
working |= inProgress.size() > 0;
}
synchronized (updating)
* {
*
* if (isPending(worker)) { worker.abortAndDestroy(); startWorker(worker); }
- * else { System.err.println("Pending exists for " + workerClass); } }
+ * else { jalview.bin.Console.errPrintln("Pending exists for " + workerClass); } }
*/
}
.getCurrentAlignFrame().alignPanel;
if (currentAlignFrame == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Can't register calculator as no alignment window has focus");
return;
}
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Can't register calculator as no alignment window has focus");
}
}
}
while (!calcMan.notifyWorking(this))
{
- // System.err.println("Thread
+ // jalview.bin.Console.errPrintln("Thread
// (Consensus"+Thread.currentThread().getName()+") Waiting around.");
try
{
{
Console.debug("Interrupted sleep waiting for next job poll.", e);
}
- // System.out.println("I'm alive "+alTitle);
+ // jalview.bin.Console.outPrintln("I'm alive "+alTitle);
}
}
if (jobComplete && jobs != null)
}
} catch (Exception e)
{
- System.err.println("Couldn't locate PICR service instance.\n");
+ jalview.bin.Console.errPrintln("Couldn't locate PICR service instance.\n");
e.printStackTrace();
}
while (sdataset.size() > 0 && db < dbSources.length)
{
int maxqlen = 1; // default number of queries made at one time
- System.out.println("Verifying against " + dbSources[db].getDbName());
+ jalview.bin.Console.outPrintln("Verifying against " + dbSources[db].getDbName());
// iterate through db for each remaining un-verified sequence
SequenceI[] currSeqs = new SequenceI[sdataset.size()];
true);
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Exception with Picr for '" + token + "'\n");
e.printStackTrace();
}
// present, and do a transferReferences
// otherwise transfer non sequence x-references directly.
}
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Validated ID against PICR... (for what its worth):"
+ token);
addSeqId(sequence, token);
else
{
// if ()
- // System.out.println("Not querying source with
+ // jalview.bin.Console.outPrintln("Not querying source with
// token="+token+"\n");
addSeqId(sequence, token);
queries.addElement(token.toUpperCase(Locale.ROOT));
DbSourceProxy dbSourceProxy, AlignmentI retrievedAl,
boolean trimDatasetSeqs, List<String> warningMessages)
{
- // System.out.println("trimming ? " + trimDatasetSeqs);
+ // jalview.bin.Console.outPrintln("trimming ? " + trimDatasetSeqs);
if (retrievedAl == null || retrievedAl.getHeight() == 0)
{
return false;
}
}
- System.out.println("Adding dbrefs to " + sequence.getName()
+ jalview.bin.Console.outPrintln("Adding dbrefs to " + sequence.getName()
+ " from " + dbSource + " sequence : "
+ retrievedSeq.getName());
sequence.transferAnnotation(retrievedSeq, mp);
}
// } catch (OutOfMemoryError e)
// {
- // System.err.println("Out of memory when displaying status. Squashing
+ // jalview.bin.Console.errPrintln("Out of memory when displaying status. Squashing
// error.");
// wsInfo.appendProgressText(j.jobnum,
// "..\n(Out of memory when displaying status)\n");
if (!isValidReference(id))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"(AFClient) Ignoring invalid alphafold query: '" + id + "'");
stopQuery();
return null;
}
} catch (Exception e)
{
- System.err.println("Warning: problems reading temp file " + file);
+ jalview.bin.Console.errPrintln("Warning: problems reading temp file " + file);
return null;
}
return bf;
}
else
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"No record found for '" + emprefx + ":" + query + "'");
}
}
}
} catch (Exception e)
{
- System.err.println("EMBL Record Features parsing error!");
+ jalview.bin.Console.errPrintln("EMBL Record Features parsing error!");
System.err
.println("Please report the following to help@jalview.org :");
- System.err.println("EMBL Record " + accession);
- System.err.println("Resulted in exception: " + e.getMessage());
+ jalview.bin.Console.errPrintln("EMBL Record " + accession);
+ jalview.bin.Console.errPrintln("Resulted in exception: " + e.getMessage());
e.printStackTrace(System.err);
}
codonStart = Integer.parseInt(value.trim());
} catch (NumberFormatException e)
{
- System.err.println("Invalid codon_start in XML for "
+ jalview.bin.Console.errPrintln("Invalid codon_start in XML for "
+ entry.getAccession() + ": " + e.getMessage());
}
}
* workaround until we handle dna location for CDS sequence
* e.g. location="X53828.1:60..1058" correctly
*/
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Implementation Notice: EMBLCDS records not properly supported yet - Making up the CDNA region of this sequence... may be incorrect ("
+ sourceDb + ":" + entry.getAccession() + ")");
int dnaLength = dna.getLength();
if (translationLength * 3 == (1 - codonStart + dnaLength))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Not allowing for additional stop codon at end of cDNA fragment... !");
// this might occur for CDS sequences where no features are marked
exons = new int[] { dna.getStart() + (codonStart - 1),
}
if ((translationLength + 1) * 3 == (1 - codonStart + dnaLength))
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Allowing for additional stop codon at end of cDNA fragment... will probably cause an error in VAMSAs!");
exons = new int[] { dna.getStart() + (codonStart - 1),
dna.getEnd() - 3 };
if (!isValidReference(id))
{
- System.err.println("Ignoring invalid pdb query: '" + id + "'");
+ jalview.bin.Console.errPrintln("Ignoring invalid pdb query: '" + id + "'");
stopQuery();
return null;
}
String database = parseIds(ids, querystring);
if (database == null)
{
- System.err.println("Invalid Query string : '" + ids + "'");
- System.err.println("Should be of form 'dbname:q1;q2;q3;q4'");
+ jalview.bin.Console.errPrintln("Invalid Query string : '" + ids + "'");
+ jalview.bin.Console.errPrintln("Should be of form 'dbname:q1;q2;q3;q4'");
return null;
}
}
return (String[]) arl.toArray();
}
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning: response code " + responseCode + " for " + url);
} catch (OutOfMemoryError er)
{
- System.out.println("OUT OF MEMORY DOWNLOADING QUERY FROM " + database
+ jalview.bin.Console.outPrintln("OUT OF MEMORY DOWNLOADING QUERY FROM " + database
+ ":\n" + ids);
throw er;
} catch (Exception ex)
if (!ex.getMessage().startsWith(
"uk.ac.ebi.jdbfetch.exceptions.DbfNoEntryFoundException"))
{
- System.err.println("Unexpected exception when retrieving from "
+ jalview.bin.Console.errPrintln("Unexpected exception when retrieving from "
+ database + "\nQuery was : '" + ids + "'");
ex.printStackTrace(System.err);
}
public Annotate3D()
{
- System.out.println("Annotate3D");
+ jalview.bin.Console.outPrintln("Annotate3D");
// try {
// Create a URL for the desired page
// String id = "1HR2";
// OutputStream out1 = null;
// out = new BufferedWriter(new OutputStreamWriter(out1, "temp.rnaml"));
// while ((str = in.readLine()) != null) {
- // System.out.println(str);
+ // jalview.bin.Console.outPrintln(str);
// out.write(str);
// }
// in.close();
public Annotate3D(String path) throws InterruptedException
{
- System.out.println("Annotate3D");
+ jalview.bin.Console.outPrintln("Annotate3D");
try
{
// //URL url = new
// URL("http://paradise-ibmc.u-strasbg.fr/webservices/annotate3d?data="+inFile);
- // System.out.println("Step1");
+ // jalview.bin.Console.outPrintln("Step1");
// FileReader r = new FileReader(inFile);
// BufferedReader in = new BufferedReader(r);
// StringBuffer content = new StringBuffer();
- // System.out.println("Step2");
+ // jalview.bin.Console.outPrintln("Step2");
// while(in.readLine()!=null){
// content.append(in.readLine());
- // //System.out.println("Step3"+in.readLine());
+ // //jalview.bin.Console.outPrintln("Step3"+in.readLine());
// }
//
// String data = URLEncoder.encode("data", "UTF-8") + "=" +
// FileReader r = new FileReader(path);
// BufferedReader in = new BufferedReader(r);
// StringBuffer content = new StringBuffer();
- // System.out.println("Step1");
+ // jalview.bin.Console.outPrintln("Step1");
// while(in.readLine()!=null){
// content.append(in.readLine());
//
// }
- // System.out.println("Step2");
+ // jalview.bin.Console.outPrintln("Step2");
// String data = URLEncoder.encode("data", "UTF-8") + "=" +
// URLEncoder.encode(content.toString(), "UTF-8");
- // System.out.println("Step2");
+ // jalview.bin.Console.outPrintln("Step2");
// URL url = new
// URL("http://paradise-ibmc.u-strasbg.fr/webservices/annotate3d?data="+data);
// DataInputStream is = new DataInputStream(url.openStream());
// String str;
// while ((str = is.readLine()) != null) {
- // System.out.println(str);
+ // jalview.bin.Console.outPrintln(str);
// //out.write(str);
// }
FileReader r = new FileReader(path);
while ((str = in.readLine()) != null)
{
- // System.out.println(str);
+ // jalview.bin.Console.outPrintln(str);
content = content + str;
}
- System.out.println("pdbfile=" + content.toString());
- System.out.println("capacité=" + content.length());
+ jalview.bin.Console.outPrintln("pdbfile=" + content.toString());
+ jalview.bin.Console.outPrintln("capacité=" + content.length());
String paramfile = URLEncoder.encode(content.toString(), "UTF-8");
- System.out.println("param=" + paramfile);
+ jalview.bin.Console.outPrintln("param=" + paramfile);
URL url = new URL(
"http://paradise-ibmc.u-strasbg.fr/webservices/annotate3d?data="
+ content);
String str4;
while ((str4 = is.readLine()) != null)
{
- System.out.println(str4);
+ jalview.bin.Console.outPrintln(str4);
// out.write(str);
}
in.close();
// BufferedReader in1 = new BufferedReader(is);
// OutputStream out1 = null;
- // System.out.println("Step3");
+ // jalview.bin.Console.outPrintln("Step3");
// BufferedWriter out = new BufferedWriter(new OutputStreamWriter(out1,
// "temp.rnaml"));
//
// return;
- // System.out.println(data.length());
- // System.out.println("step2");
+ // jalview.bin.Console.outPrintln(data.length());
+ // jalview.bin.Console.outPrintln("step2");
// URL url = new
// URL("http://paradise-ibmc.u-strasbg.fr/webservices/annotate3d?data="+data);
- // System.out.println("step3");
+ // jalview.bin.Console.outPrintln("step3");
// URLConnection conn = url.openConnection();
// conn.setDoOutput(true);
// OutputStreamWriter writer = new
// //String line;
// while ((line = reader.readLine()) != null) {
// answer.append(line);
- // System.out.println(line);
+ // jalview.bin.Console.outPrintln(line);
// }
// writer.close();
// reader.close();
// out = new BufferedWriter(new FileWriter("temp.rnaml"));
// while ((str = in.readLine()) != null) {
- // System.out.println(str);
+ // jalview.bin.Console.outPrintln(str);
// out.write(str);
- // System.out.println(str);
+ // jalview.bin.Console.outPrintln(str);
// in.close();
// out.close();
// public BufferedWriter getReader()
// {
- // System.out.println("The buffer");
+ // jalview.bin.Console.outPrintln("The buffer");
// return out;
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"jalview.rootRegistry is not a proper url!\nWas set to "
+ RootServiceURL + "\n" + e);
}
WS1Client instance = serviceClientBindings.get(sh.getAbstractName());
if (instance == null)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"WARNING - POSSIBLE IMPLEMENTATION ERROR - cannot find WSClient implementation for "
+ sh.getAbstractName());
}
wsInfo.setProgressText(j.getJobnum(),
"Failed to submit the prediction. (Just close the window)\n"
+ "It is most likely that there is a problem with the server.\n");
- System.err.println(
+ jalview.bin.Console.errPrintln(
"JPredWS Client: Failed to submit the prediction. Quite possibly because of a server error - see below)\n"
+ e.getMessage() + "\n");
j.setJobId(jobsubmit.getJobId());
j.setSubmitted(true);
j.setSubjobComplete(false);
- // System.out.println(WsURL + " Job Id '" + jobId + "'");
+ // jalview.bin.Console.outPrintln(WsURL + " Job Id '" + jobId + "'");
}
else
{
{
// TODO: JBPNote catch timeout or other fault types explicitly
// For unexpected errors
- System.err.println(WebServiceName
+ jalview.bin.Console.errPrintln(WebServiceName
+ "Client: Failed to submit the sequences for alignment (probably a server side problem)\n"
+ "When contacting Server:" + WsUrl + "\n" + e.toString()
+ "\n");
results++;
// if (Cache.isDebugEnabled())
// {
- // System.out.println("Job lob for job
+ // jalview.bin.Console.outPrintln("Job lob for job
// "+jobs[j].getJobId()+":"+jobs[j].getJobnum());
- // System.out.println(jobs[j].getStatus());
+ // jalview.bin.Console.outPrintln(jobs[j].getStatus());
// }
vamsas.objects.simple.Alignment valign = ((MsaResult) ((MsaWSJob) jobs[j]).result)
}
else
{
- System.out.println("MERGE WITH OLD FRAME");
+ jalview.bin.Console.outPrintln("MERGE WITH OLD FRAME");
// TODO: modify alignment in original frame, replacing old for new
// alignment using the commands.EditCommand model to ensure the update can
// be undone
}
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to parse the annotation file associated with the alignment.");
- System.err.println(">>>EOF" + inFile + "\n<<<EOF\n");
+ jalview.bin.Console.errPrintln(">>>EOF" + inFile + "\n<<<EOF\n");
e.printStackTrace(System.err);
}
}
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to parse the Features file associated with the alignment.");
- System.err.println(">>>EOF" + inFile + "\n<<<EOF\n");
+ jalview.bin.Console.errPrintln(">>>EOF" + inFile + "\n<<<EOF\n");
e.printStackTrace(System.err);
}
jalview.io.NewickFile nf = null;
}
} catch (Exception e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to parse the treeFile associated with the alignment.");
- System.err.println(">>>EOF" + inFile + "\n<<<EOF\n");
+ jalview.bin.Console.errPrintln(">>>EOF" + inFile + "\n<<<EOF\n");
e.printStackTrace(System.err);
}
j.setJobId(jobsubmit.getJobId());
j.setSubmitted(true);
j.setSubjobComplete(false);
- // System.out.println(WsURL + " Job Id '" + jobId + "'");
+ // jalview.bin.Console.outPrintln(WsURL + " Job Id '" + jobId + "'");
}
else
{
{
// TODO: JBPNote catch timeout or other fault types explicitly
// For unexpected errors
- System.err.println(WebServiceName
+ jalview.bin.Console.errPrintln(WebServiceName
+ "Client: Failed to submit the sequences for alignment (probably a server side problem)\n"
+ "When contacting Server:" + WsUrl + "\n" + e.toString()
+ "\n");
{
if (!newFrame)
{
- System.err.println("MERGE WITH OLD FRAME NOT IMPLEMENTED");
+ jalview.bin.Console.errPrintln("MERGE WITH OLD FRAME NOT IMPLEMENTED");
return;
}
// each subjob is an independent alignment for the moment
{
if (cancelJob(rslt))
{
- System.err.println("Cancelled AACon job: " + rslt);
+ jalview.bin.Console.errPrintln("Cancelled AACon job: " + rslt);
}
else
{
- System.err.println("FAILED TO CANCEL AACon job: " + rslt);
+ jalview.bin.Console.errPrintln("FAILED TO CANCEL AACon job: " + rslt);
}
} catch (Exception x)
catch (JobSubmissionException x)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"submission error with " + getServiceActionText() + " :");
x.printStackTrace();
calcMan.disableWorker(this);
} catch (ResultNotAvailableException x)
{
- System.err.println("collection error:\nJob ID: " + rslt);
+ jalview.bin.Console.errPrintln("collection error:\nJob ID: " + rslt);
x.printStackTrace();
calcMan.disableWorker(this);
String id = rslt;
if (cancelJob(rslt))
{
- System.err.println("Cancelled job " + id);
+ jalview.bin.Console.errPrintln("Cancelled job " + id);
}
else
{
- System.err.println("Job " + id + " couldn't be cancelled.");
+ jalview.bin.Console.errPrintln("Job " + id + " couldn't be cancelled.");
}
} catch (Exception q)
{
}
else
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Warning: Ignoring parameter set instance of type "
+ paramset.getClass()
+ " : Bound but not applicable for service at "
registry = Jws2Client.connectToRegistry(jwsserver);
if (registry != null)
{
- // System.err.println("Test Services Output\n"
+ // jalview.bin.Console.errPrintln("Test Services Output\n"
// + registry.testAllServices());
// TODO: enumerate services and test those that haven't been tested
// in the last n-days/hours/etc.
srv_set = registry.getSupportedServices();
// dan test
- System.out.println(
+ jalview.bin.Console.outPrintln(
"registry.getSupportedServices: " + srv_set.toString());
svccategories = registry.getServiceCategories();
// dan test
- // System.out.println("registry.getServiceCategories: " +
+ // jalview.bin.Console.outPrintln("registry.getServiceCategories: " +
// svccategories.toString());
}
} catch (Exception ex)
{
- System.err.println("Exception whilst trying to get at registry:");
+ jalview.bin.Console.errPrintln("Exception whilst trying to get at registry:");
ex.printStackTrace();
// if that failed, then we are probably working with a JABAWS1 server.
// in that case, look for each service endpoint
- System.err.println("JWS2 Discoverer: " + jwsserver
+ jalview.bin.Console.errPrintln("JWS2 Discoverer: " + jwsserver
+ " is a JABAWS1 server. Using hardwired list.");
for (Services srv : JABAWS1SERVERS)
{
service = Jws2Client.connect(jwsserver, srv);
} catch (Exception e)
{
- System.err.println("Jws2 Discoverer: Problem on " + jwsserver
+ jalview.bin.Console.errPrintln("Jws2 Discoverer: Problem on " + jwsserver
+ " with service " + srv + ":\n" + e.getMessage());
if (!(e instanceof javax.xml.ws.WebServiceException))
{
result = true;
} catch (MalformedURLException e)
{
- System.err.println("Invalid server URL: " + server);
+ jalview.bin.Console.errPrintln("Invalid server URL: " + server);
result = false;
} catch (IOException e)
{
- System.err.println("Error connecting to server: " + server + ": "
+ jalview.bin.Console.errPrintln("Error connecting to server: " + server + ": "
+ e.toString());
result = false;
}
List<AlignmentAnnotation> ourAnnot, String typeName,
String calcId, SequenceI dseq, int base, Score scr)
{
- System.out.println("Creating annotation on dseq:" + dseq.getStart()
+ jalview.bin.Console.outPrintln("Creating annotation on dseq:" + dseq.getStart()
+ " base is " + base + " and length=" + dseq.getLength()
+ " == " + scr.getScores().size());
// AlignmentAnnotation annotation = new AlignmentAnnotation(
List<AlignmentAnnotation> ourAnnot, String typeName,
String calcId, SequenceI dseq, int base, Score scr)
{
- System.out.println("Creating annotation on dseq:" + dseq.getStart()
+ jalview.bin.Console.outPrintln("Creating annotation on dseq:" + dseq.getStart()
+ " base is " + base + " and length=" + dseq.getLength()
+ " == " + scr.getScores().size());
// AlignmentAnnotation annotation = new AlignmentAnnotation(
.loadClass("compbio.ws.client.Jws2Client");
} catch (ClassNotFoundException e)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Not enabling JABA Webservices : client jar is not available."
+ "\nPlease check that your webstart JNLP file is up to date!");
running = false;
{
services = new Vector<>();
}
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Discovered service: " + jwsservers + " " + service.toString());
// Jws2Instance service = new Jws2Instance(jwsservers, srv.toString(),
// service2);
{
if (getDiscoverer().services != null)
{
- System.out.println("Changesupport: There are now "
+ jalview.bin.Console.outPrintln("Changesupport: There are now "
+ getDiscoverer().services.size() + " services");
int i = 1;
for (Jws2Instance instance : getDiscoverer().services)
{
- System.out.println("Service " + i++ + " "
+ jalview.bin.Console.outPrintln("Service " + i++ + " "
+ instance.getClass() + "@" + instance.getHost()
+ ": " + instance.getActionText());
}
{
j.setSubmitted(true);
j.setSubjobComplete(false);
- // System.out.println(WsURL + " Job Id '" + jobId + "'");
+ // jalview.bin.Console.outPrintln(WsURL + " Job Id '" + jobId + "'");
return;
}
else
} catch (Error e)
{
// For unexpected errors
- System.err.println(WebServiceName
+ jalview.bin.Console.errPrintln(WebServiceName
+ "Client: Failed to submit the sequences for alignment (probably a server side problem)\n"
+ "When contacting Server:" + WsUrl + "\n");
e.printStackTrace(System.err);
} catch (Exception e)
{
// For unexpected errors
- System.err.println(WebServiceName
+ jalview.bin.Console.errPrintln(WebServiceName
+ "Client: Failed to submit the sequences for alignment (probably a server side problem)\n"
+ "When contacting Server:" + WsUrl + "\n");
e.printStackTrace(System.err);
if (Console.isDebugEnabled())
{
- System.out.println("Job Execution file for job: "
+ jalview.bin.Console.outPrintln("Job Execution file for job: "
+ msjob.getJobId() + " on server " + WsUrl);
- System.out.println(msjob.getStatus());
- System.out.println("*** End of status");
+ jalview.bin.Console.outPrintln(msjob.getStatus());
+ jalview.bin.Console.outPrintln("*** End of status");
}
try
else
{
// TODO 2.9.x feature
- System.out.println("MERGE WITH OLD FRAME");
+ jalview.bin.Console.outPrintln("MERGE WITH OLD FRAME");
// TODO: modify alignment in original frame, replacing old for new
// alignment using the commands.EditCommand model to ensure the update can
// be undone
Option o = options.getArgumentByOptionName(oname);
if (o == null)
{
- System.out.println("WARN ignoring unsuppoted parameter: " + oname);
+ jalview.bin.Console.outPrintln("WARN ignoring unsuppoted parameter: " + oname);
continue;
}
if (o instanceof Parameter)
: param);
} catch (WrongParameterException e)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Problem setting value for the parameter: " + param);
e.printStackTrace();
}
}
} catch (Exception ex)
{
- System.err.println("Exception when retrieving presets for service "
+ jalview.bin.Console.errPrintln("Exception when retrieving presets for service "
+ serviceType + " at " + hosturl);
}
}
* try { URL serviceurl = new URL(hosturl); if (serviceurl.getPort()!=80) {
* return serviceurl.getHost()+":"+serviceurl.getPort(); } return
* serviceurl.getHost(); } catch (Exception e) {
- * System.err.println("Failed to parse service URL '" + hosturl +
+ * jalview.bin.Console.errPrintln("Failed to parse service URL '" + hosturl +
* "' as a valid URL!"); } return null;
*/
}
: null));
} catch (Exception ex)
{
- System.err.println("Unexpected exception creating JabaParamStore.");
+ jalview.bin.Console.errPrintln("Unexpected exception creating JabaParamStore.");
ex.printStackTrace();
}
}
} catch (Exception ex)
{
- System.err.println("Couldn't transform string\n" + content
+ jalview.bin.Console.errPrintln("Couldn't transform string\n" + content
+ "\nException was :");
ex.printStackTrace(System.err);
}
@Override
public void cancelJob()
{
- System.err.println("Cannot cancel this job type: " + service);
+ jalview.bin.Console.errPrintln("Cannot cancel this job type: " + service);
}
@Override
}
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Serious - RSBS descriptions in user preferences are corrupt!");
ex.printStackTrace();
}
public void pollJob(AWsJob job) throws Exception
{
assert (job instanceof RestJob);
- System.err.println("Debug RestJob: Polling Job");
+ jalview.bin.Console.errPrintln("Debug RestJob: Polling Job");
doPoll((RestJob) job);
}
assert (job instanceof RestJob);
try
{
- System.err.println("Debug RestJob: Posting Job");
+ jalview.bin.Console.errPrintln("Debug RestJob: Posting Job");
doPost((RestJob) job);
} catch (NoValidInputDataException erex)
{
if (!rj.hasValidInput())
{
// invalid input for this job
- System.err.println("Job " + rj.getJobnum()
+ jalview.bin.Console.errPrintln("Job " + rj.getJobnum()
+ " has invalid input. ( " + rj.getStatus() + ")");
if (rj.hasStatus() && !_warnings.contains(rj.getStatus()))
{
seqset = fetcher.getSequenceRecords(qsb.toString());
} catch (Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to retrieve the following from " + db);
- System.err.println(qsb);
+ jalview.bin.Console.errPrintln(qsb);
ex.printStackTrace(System.err);
}
// TODO: Merge alignment together - perhaps
{
if (fetcher.getRawRecords() != null)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"# Retrieved from " + db + ":" + qsb.toString());
StringBuffer rrb = fetcher.getRawRecords();
/*
/*
* } else { hdr = "# part "+rr; }
*/
- System.out.println(hdr);
+ jalview.bin.Console.outPrintln(hdr);
if (rrb != null)
{
- System.out.println(rrb);
+ jalview.bin.Console.outPrintln(rrb);
}
- System.out.println("# end of " + hdr);
+ jalview.bin.Console.outPrintln("# end of " + hdr);
}
}
}
if (queriesMade.size() > 0)
{
- System.out.println("# Adding " + queriesMade.size()
+ jalview.bin.Console.outPrintln("# Adding " + queriesMade.size()
+ " ids back to queries list for searching again (" + db
+ ")");
queriesLeft.addAll(queriesMade);
Exception ex)
{
- System.err.println(
+ jalview.bin.Console.errPrintln(
"Failed to retrieve the following references from " + db);
int n = 0;
for (String qv : queriesMade)
System.err.print(" " + qv + ";");
if (n++ > 10)
{
- System.err.println();
+ jalview.bin.Console.errPrintln();
n = 0;
}
}
- System.err.println();
+ jalview.bin.Console.errPrintln();
ex.printStackTrace();
}
try (InputStream in = new FileInputStream(siftFile);
GZIPInputStream gzis = new GZIPInputStream(in);)
{
- // System.out.println("File : " + siftFile.getAbsolutePath());
+ // jalview.bin.Console.outPrintln("File : " + siftFile.getAbsolutePath());
JAXBContext jc = JAXBContext.newInstance("jalview.xml.binding.sifts");
XMLStreamReader streamReader = XMLInputFactory.newInstance()
.createXMLStreamReader(gzis);
if (siftsFile.exists())
{
// The line below is required for unit testing... don't comment it out!!!
- System.out.println(">>> SIFTS File already downloaded for " + pdbId);
+ jalview.bin.Console.outPrintln(">>> SIFTS File already downloaded for " + pdbId);
if (isFileOlderThanThreshold(siftsFile,
SiftsSettings.getCacheThresholdInDays()))
diffInDays = (int) ((new Date().getTime()
- attr.lastModifiedTime().toMillis())
/ (1000 * 60 * 60 * 24));
- // System.out.println("Diff in days : " + diffInDays);
+ // jalview.bin.Console.outPrintln("Diff in days : " + diffInDays);
} catch (IOException e)
{
e.printStackTrace();
}
}
- // System.out.println(">> Download ftp url : " + siftsFileFTPURL);
+ // jalview.bin.Console.outPrintln(">> Download ftp url : " + siftsFileFTPURL);
// long now = System.currentTimeMillis();
URL url = new URL(siftsFileFTPURL);
URLConnection conn = url.openConnection();
}
outputStream.close();
inputStream.close();
- // System.out.println(">>> File downloaded : " + downloadedSiftsFile
+ // jalview.bin.Console.outPrintln(">>> File downloaded : " + downloadedSiftsFile
// + " took " + (System.currentTimeMillis() - now) + "ms");
return downloadTo;
}
seq = seq.getDatasetSequence();
}
structId = (chain == null) ? pdbId : pdbId + "|" + chain;
- System.out.println("Getting SIFTS mapping for " + structId + ": seq "
+ jalview.bin.Console.outPrintln("Getting SIFTS mapping for " + structId + ": seq "
+ seq.getName());
final StringBuilder mappingDetails = new StringBuilder(128);
{
List<Integer> omitNonObserved = new ArrayList<>();
int nonObservedShiftIndex = 0, pdbeNonObserved = 0;
- // System.out.println("Generating mappings for : " + entityId);
+ // jalview.bin.Console.outPrintln("Generating mappings for : " + entityId);
Entity entity = null;
entity = getEntityById(entityId);
String originalSeq = AlignSeq.extractGaps(
int firstPDBResNum = UNASSIGNED;
for (Segment segment : segments)
{
- // System.out.println("Mapping segments : " + segment.getSegId() + "\\"s
+ // jalview.bin.Console.outPrintln("Mapping segments : " + segment.getSegId() + "\\"s
// + segStartEnd);
List<Residue> residues = segment.getListResidue().getResidue();
for (Residue residue : residues)
// Arrays.sort(keys);
int firstIndex = keys[0];
int lastIndex = keys[keys.length - 1];
- // System.out.println("Min value " + firstIndex);
- // System.out.println("Max value " + lastIndex);
+ // jalview.bin.Console.outPrintln("Min value " + firstIndex);
+ // jalview.bin.Console.outPrintln("Max value " + lastIndex);
for (int x = firstIndex; x <= lastIndex; x++)
{
if (!resNumMap.containsKey(x) && !omitNonObserved.contains(x))
*/
public Entity getEntityByMostOptimalMatchedId(String chainId)
{
- // System.out.println("---> advanced greedy entityId matching block
+ // jalview.bin.Console.outPrintln("---> advanced greedy entityId matching block
// entered..");
List<Entity> entities = siftsEntry.getEntity();
SiftsEntitySortPojo[] sPojo = new SiftsEntitySortPojo[entities.size()];
++count;
}
Arrays.sort(sPojo, Collections.reverseOrder());
- // System.out.println("highest matched entity : " + sPojo[0].entityId);
- // System.out.println("highest matched pid : " + sPojo[0].pid);
+ // jalview.bin.Console.outPrintln("highest matched entity : " + sPojo[0].entityId);
+ // jalview.bin.Console.outPrintln("highest matched pid : " + sPojo[0].pid);
if (sPojo[0].entityId != null)
{
}
} catch (IOException e)
{
- System.out.println(
+ jalview.bin.Console.outPrintln(
"Exception while closing download file output stream: "
+ e.getMessage());
}
}
} catch (IOException e)
{
- System.out.println("Exception while closing download channel: "
+ jalview.bin.Console.outPrintln("Exception while closing download channel: "
+ e.getMessage());
}
try
}
} catch (IOException e)
{
- System.out.println("Exception while deleting download temp file: "
+ jalview.bin.Console.outPrintln("Exception while deleting download temp file: "
+ e.getMessage());
}
}
--- /dev/null
+>101
+P.I...A..Q..I.....H.....I........L.......E........G.......R.......S....D.......E.......Q.....K....E.
+T..LI....RE...V.S.E...A...I......S.......R...S.......L........D....A.....P......L...................
+..........T......S.......V.......R......V...I....I.......T......E.....M........A....K.........G.....
+.H..........F..........G........I..........G........G......E........L....A...SK
+>UPI
+P.Hye.V..S..V.....T.....M........P.......T........G.......Wl......N....T.......V.......R.....K....Q.
+G..MI....DA...V.T.R...A...L......L.......E...A.......I........A....T.....P......F...................
+..........D......Essrfr..V.......R......C...L....I.......P......E.....I........P....D.........G.....
+.N..........W..........G........S..........G........Gya....L........P....L...S-
+>SRR
+P.H...V..A..V.....K.....L........Y.......P........G.......R.......T....E.......Q.......Q.....K....E.
+Q..LA....RA...I.A.D...D...V......M.......R...I.......L........G....S.....S......E...................
+..........A......S.......V.......S......V...S....I.......E......E.....V........D....A.........A.....
+.D..........W..........A........EkvyrplivegG........G......T........L....Y...KK
+>SRR
+P.H...V..I..V.....K.....L........W.......P........G.......R.......S....E.......P.......Q.....K....Q.
+K..LV....ES...V.T.K...A...V......T.......T...S.......L........G....Y.....S......D...................
+..........E......A.......V.......S......V...S....L.......Q......E.....V........P....S.........D.....
+.Q..........WtekvyrpdilG........T..........A........G......R........L....Y...KK
+>MGY
+P.I...V..R..I.....T.....M........F.......E........G.......R.......T....K.......E.......Q.....K....Q.
+E..LA....RV...I.T.E...A...V......V.......N...I.......A........K....T.....T......P...................
+..........D......A.......T.......E......VkdqI....L.......Q......K.....VllvrslrlP....PppasrrqvsG.....
+.A..........W..........S........A..........D........G......K........P....T...SE
+>446
+P.H...V..I..V.....K.....L........W.......P........G.......K.......S....E.......R.......E.....E....T.
+Q..LA....EA...I.T.K...S...V......T.......E...T.......L........N....F.....G......P...................
+..........E......S.......V.......S......V...A....F.......E......E.....I........P....A.........K.....
+.D..........W..........AskvyhadiI..........Gne......G......K........L....Y...KK
+>SRR
+P.L...V..R..I.....T.....Y........P.......R........Ga......L.......S....P.......E.......H.....K....T.
+R..IA....RA...L.T.E...I...V......L.......D...Vevdaa..T........D....A.....G......R...................
+..........M......V.......T.......V......V...H....F.......N......E.....A........A....P.........D.....
+.D..........W..........A........V..........G........G......Eirs.....T....A...AE
+>SRR
+P.L...V..R..I.....T.....Y........P.......R........Ga......L.......S....P.......D.......H.....K....R.
+R..IA....RE...L.T.E...I...V......L.......D...Vevdaa..T........D....A.....G......R...................
+..........M......V.......T.......V......I...H....F.......N......E.....A........A....A.........D.....
+.D..........W..........A........V..........G........G......Eirs.....T....A...AE
+>SRR
+P.R...Y..R..Vip...T.....V........P.......E........G.......Qy......S....N.......E.......S.....R....K.
+A..LV....KD...V.T.E...A...V......V.......R...A.......D........G....G.....K......Y...................
+..........E......Dvapr...V.......W......V...F....P.......T......E.....I........P....D.........G.....
+.Q..........W..........G........S..........R........Gvi....R........P....L...PE
+>SRR
+P.R...Y..R..Iip...T.....V........P.......E........G.......Qy......S....N.......E.......S.....R....K.
+A..LV....KD...V.T.E...A...V......V.......R...A.......D........G....G.....K......Y...................
+..........E......Dvapr...V.......W......V...F....P.......T......E.....I........P....D.........G.....
+.Q..........W..........G........S..........R........Gvi....R........P....L...PE
+>SRR
+P.V...I..E..M.....F.....V........P.......E........G.......La......D....A.......E.......A.....K....R.
+A..LH....DR...V.S.R...Q...V......L.......E...V.......E........G....AtydesP......L...................
+..........A......Qsi.....T.......W......M...L....I.......Q......E.....V........L....E.........C.....
+.G..........W..........S........V..........G........S......K........Avw..A...SE
+>SRR
+P.I...I..E..M.....H.....V........Q.......E........Gv......L.......D....E.......E.......T.....K....R.
+T..LH....ER...V.G.R...Q...V......L.......E...I.......E........G....Any...D......E...................
+..........N......D.......Varllt..F......M...F....I.......R......E.....H........P....E.........G.....
+.G..........F..........S........I..........G........G......E........M....It..SE
+>SRR
+P.Lyr.V..D..V.....T.....V........P.......E........Gsmihg..Q.......G....Pwal....S.......R.....R....R.
+A..IV....RE...V.T.E...I...V......L.......E...A.......E........G....S.....D......P...................
+..........Slgeaw.R.......V.......W......V...V....L.......R......E.....V........G....D.........A.....
+.F..........W..........G........A..........A........G......E........L....-...--
+>SRR
+P.Lyr.V..Q..I.....T.....V........P.......E........Gsmlhg..Q.......G....Pwai....E.......R.....R....R.
+E..LV....RA...V.S.K...A...V......L.......D...A.......E........G....Teyn..P......A...................
+..........Saw....R.......V.......W......V...L....M.......S......E.....I........S....E.........T.....
+.H..........W..........G........A..........A........G......E........-....-...--
+>SRR
+P.L...V..E..M.....S.....F........P.......V........Gv......L.......T....L.......D.......Q.....K....A.
+A..MI....KS...V.T.D...V...V......R.......G...A.......M........K....L.....P......P...................
+..........Dpar...K.......L.......F......V...E....I.......F......E.....T........P....G.........G.....
+.G..........F..........G........Vtakvvvvp..G........Gky....R........P....A...P-
+>SRR
+P.L...V..E..I.....D.....L........L.......E........A.......W.......A....P.......D.......Q.....I....D.
+A..IA....DA...I.H.E...A...M......V.......E...T.......L........G....V.....P......Eraagrdsatkqhfysrfaa
+llaeratvqsA......D.......L.......T......A...V....L.......V......E.....N........S....R.........D.....
+.D..........W..........S........F..........Gm.......G......Q........-....-...--
--- /dev/null
+--nonews
+--nosplash
+--open=./test/files/annotation_label_width/sample.a2m
+--colour=gecos:flower
+--gui
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3.pdb
+--paematrix=./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_2_model_4.pdb
+--paematrix=./examples/test_fab41.result/test_fab41_unrelaxed_rank_2_model_4_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_3_model_2.pdb
+--paematrix=./examples/test_fab41.result/test_fab41_unrelaxed_rank_3_model_2_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_4_model_5.pdb
+--paematrix=./examples/test_fab41.result/test_fab41_unrelaxed_rank_4_model_5_scores.json
+--structure=[structureviewer=none]./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1.pdb
+--paematrix=./examples/test_fab41.result/test_fab41_unrelaxed_rank_5_model_1_scores.json
String ln = null;
while ((ln = worker.getOutputReader().readLine()) != null)
{
- System.out.println(ln);
+ System.out.println("STDOUT: " + ln);
successfulCMDs.add(ln);
}
while ((ln = worker.getErrorReader().readLine()) != null)
{
- System.err.println(ln);
+ System.err.println("STDERR: " + ln);
+ successfulCMDs.add(ln);
}
}
// number of lines expected on STDERR when Jalview starts up normally
// may need to adjust this if Jalview is excessively noisy ?
+ final int STDOUT_SETUPLINES = 50;
final int STDERR_SETUPLINES = 50;
// thread monitors stderr - bails after SETUP_TIMEOUT or when
public void run()
{
String ln = null;
- int count = 0;
+ int stdoutcount = 0;
+ int stderrcount = 0;
try
{
while ((ln = worker.getOutputReader().readLine()) != null)
{
System.out.println(ln);
successfulCMDs.add(ln);
- if (++count > STDERR_SETUPLINES)
+ if (++stdoutcount > STDOUT_SETUPLINES)
+ {
+ break;
+ }
+ }
+ while ((ln = worker.getErrorReader().readLine()) != null)
+ {
+ System.err.println(ln);
+ successfulCMDs.add(ln);
+ if (++stderrcount > STDERR_SETUPLINES)
{
break;
}
import java.io.File;
import java.io.IOException;
import java.io.InputStreamReader;
+import java.nio.file.Files;
import java.nio.file.Path;
import java.nio.file.Paths;
import java.util.ArrayList;
private Worker getJalviewDesktopRunner(boolean withAwt, String cmd,
int timeout)
{
+ return getJalviewDesktopRunner(withAwt, cmd, timeout, true);
+ }
+
+ private Worker getJalviewDesktopRunner(boolean withAwt, String cmd,
+ int timeout, boolean testoutput)
+ {
/*
boolean win = System.getProperty("os.name").indexOf("Win") >= 0;
String pwd = "";
Worker worker = null;
try
{
- cmd = " --testoutput " + cmd;
+ cmd = cmd + (testoutput ? " --testoutput " : "");
System.out.println("Running '" + _cmd + cmd + "'");
ls2_proc = Runtime.getRuntime().exec(_cmd + cmd);
} catch (Throwable e1)
file.delete();
}
+ @Test(
+ groups =
+ { "Functional", "testTask1" },
+ dataProvider = "headlessModeOutputToStdout")
+ public void testHeadlessModeOutputToStdout(String args,
+ String comparisonFile, int timeout)
+ {
+ String cmd = args;
+ File file = new File(comparisonFile);
+ Worker worker = getJalviewDesktopRunner(true, cmd, timeout, false);
+ int b = -1;
+ StringBuilder sb = new StringBuilder();
+ try
+ {
+ while ((b = worker.getOutputReader().read()) != -1)
+ {
+ sb.append(Character.toChars(b));
+ }
+ } catch (IOException e)
+ {
+ Assert.fail("IOException whilst trying to read from jalview process");
+ }
+
+ String comparisonContent = null;
+ try
+ {
+ comparisonContent = new String(Files.readAllBytes(file.toPath()));
+ } catch (IOException e)
+ {
+ Assert.fail("IOException whilst trying to read comparison file");
+ }
+
+ Assert.assertEquals(sb.toString(), comparisonContent,
+ "STDOUT from jalview command did not match the comparison file");
+ }
+
@DataProvider(name = "allInputOperationsData")
public Object[][] getHeadlessModeInputParams()
{
//
};
}
+
+ @DataProvider(name = "headlessModeOutputToStdout")
+ public static Object[][] getHeadlessModeOutputToStdout()
+ {
+ // JBPNote: I'm not clear why need to specify full path for output file
+ // when running tests on build server, but we will keep this patch for now
+ // since it works.
+ // https://issues.jalview.org/browse/JAL-1889?focusedCommentId=21609&page=com.atlassian.jira.plugin.system.issuetabpanels:comment-tabpanel#comment-21609
+ String workingDir = "test/jalview/bin";
+ return new Object[][] {
+ //
+ { "--open=examples/uniref50.fa --output=-",
+ workingDir + "/uniref50-output.fa", TEST_TIMEOUT },
+ { "--open examples/uniref50.fa --output -",
+ workingDir + "/uniref50-output.fa", TEST_TIMEOUT },
+ { "--open examples/uniref50.fa --output=[format=blc]-",
+ workingDir + "/uniref50-output.blc", TEST_TIMEOUT },
+ { "--open examples/uniref50.fa --output - --format blc",
+ workingDir + "/uniref50-output.blc", TEST_TIMEOUT },
+ { "./examples/uniref50.fa --output=-",
+ workingDir + "/uniref50-output.fa", TEST_TIMEOUT },
+ { "./examples/uniref50.fa --output - --format blc",
+ workingDir + "/uniref50-output.blc", TEST_TIMEOUT },
+ // remember you can't use shell wildcards for filenames in a test
+ { "./test/jalview/bin/argparser/testfiles/test1.fa ./test/jalview/bin/argparser/testfiles/test2.fa ./test/jalview/bin/argparser/testfiles/test3.fa --all --output -",
+ workingDir + "/test1-3.fa", TEST_TIMEOUT },
+ // but you can use java wildcards when using an equals sign
+ { "--open=./test/jalview/bin/argparser/testfiles/test*.fa --all --output -",
+ workingDir + "/test1-3.fa", TEST_TIMEOUT },
+ //
+ };
+ }
}
{
Desktop.closeDesktop();
}
-
- public static void callJalviewMain(String[] args) {
- if (Jalview.getInstance()!=null) {
+
+ public static void callJalviewMain(String[] args)
+ {
+ if (Jalview.getInstance() != null)
+ {
Jalview.getInstance().doMain(args);
- } else {
+ }
+ else
+ {
Jalview.main(args);
}
}
}
}
- @Test(groups = {"Functional","testTask1"}, dataProvider = "structureImageOutputFiles")
+ @Test(
+ groups =
+ { "Functional", "testTask1" },
+ dataProvider = "structureImageOutputFiles")
public void structureImageOutputTest(String cmdLine, String[] filenames)
throws IOException
{
{
cleanupFiles(filenames);
String[] args = (cmdLine + " --gui").split("\\s+");
- try {
- callJalviewMain(args);
- Commands cmds = Jalview.getInstance().getCommands();
- Assert.assertNotNull(cmds);
- File lastFile = null;
- for (String filename : filenames)
+ try
{
- File file = new File(filename);
- Assert.assertTrue(file.exists(), "File '" + filename
- + "' was not created by '" + cmdLine + "'");
- Assert.assertTrue(file.isFile(), "File '" + filename
- + "' is not a file from '" + cmdLine + "'");
- Assert.assertTrue(Files.size(file.toPath()) > 0, "File '" + filename
- + "' has no content from '" + cmdLine + "'");
- // make sure the successive output files get bigger!
- if (lastFile != null)
- Assert.assertTrue(
- Files.size(file.toPath()) > Files.size(lastFile.toPath()));
- }
+ callJalviewMain(args);
+ Commands cmds = Jalview.getInstance().getCommands();
+ Assert.assertNotNull(cmds);
+ File lastFile = null;
+ for (String filename : filenames)
+ {
+ File file = new File(filename);
+ Assert.assertTrue(file.exists(), "File '" + filename
+ + "' was not created by '" + cmdLine + "'");
+ Assert.assertTrue(file.isFile(), "File '" + filename
+ + "' is not a file from '" + cmdLine + "'");
+ Assert.assertTrue(Files.size(file.toPath()) > 0, "File '" + filename
+ + "' has no content from '" + cmdLine + "'");
+ // make sure the successive output files get bigger!
+ if (lastFile != null)
+ Assert.assertTrue(Files.size(file.toPath()) > Files
+ .size(lastFile.toPath()));
+ }
} catch (Exception x)
{
- Assert.fail("Unexpected exception during argFilesGlobAndSubstitutions",
+ Assert.fail(
+ "Unexpected exception during argFilesGlobAndSubstitutions",
x);
} finally
{
{ testfiles + "/structureimage1.png",
testfiles + "/structureimage2.png",
testfiles + "/structureimage3.png" } },
- /*
{ "--headless --noquit --open=./examples/test_fab41.result/sample.a2m "
+ "--structure=./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3.pdb "
+ "--structureimage=" + testfiles + "/structureimage1.png "
{ testfiles + "/structureimage1.png",
testfiles + "/structureimage2.png",
testfiles + "/structureimage3.png" } },
+ /*
*/
//
};
--- /dev/null
+>TEST1/1-4
+AAAA
+>TEST2/1-4
+LLLL
+>TEST3/1-5
+AAARG
--- /dev/null
+>FER_CAPAA/1-97 Ferredoxin
+>FER_CAPAN/1-144 Ferredoxin, chloroplast precursor
+>FER1_SOLLC/1-144 Ferredoxin-1, chloroplast precursor
+>Q93XJ9_SOLTU/1-144 Ferredoxin I precursor
+>FER1_PEA/1-149 Ferredoxin-1, chloroplast precursor
+>Q7XA98_TRIPR/1-152 Ferredoxin I
+>FER1_MESCR/1-148 Ferredoxin-1, chloroplast precursor
+>FER1_SPIOL/1-147 Ferredoxin-1, chloroplast precursor
+>FER3_RAPSA/1-96 Ferredoxin, leaf L-A
+>FER2_ARATH/1-148 Ferredoxin-2, chloroplast precursor
+>FER_BRANA/1-96 Ferredoxin
+>FER1_ARATH/1-148 Ferredoxin-1, chloroplast precursor
+>Q93Z60_ARATH/1-118 At1g10960/T19D16_12
+>FER1_MAIZE/1-150 Ferredoxin-1, chloroplast precursor
+>O80429_MAIZE/1-140 Ferredoxin
+* iteration 1
+-MMMMMMM-M-MMMM
+-AAAAAAA-A-AAAA
+----TTAA-S-SSTA
+----TTTT-T-TTVT
+-------------L-
+-------------G-
+------TT-----S-
+----PPAT-----P-
+-SSSAAAT-A-AAR-
+-VIILLLM-L-LLA-
+-SSSYYSM-S-SSP-
+-AGGGGGG-S-SSA-
+-TTTTTA--A-AAF-
+-MMMAAT--I-IIFA
+-IIIVVMM-V-VVFL
+-SSSSSSA-G-SSSS
+-TTTTTTT-T-TTSM
+-SSSSSAT-S-SSSS
+-FFFFFFF-F-FFSI
+-MLLLMAV-I-LLLL
+-PPPRRPP-R-RRRR
+-RRRTRKK-R-RRA-
+-KKKQQ-P-S-QQA-
+-PPPPP-Q-P-QQP-
+-AAVMVTA-A-TTAA
+-VVVPPPP-P-PPPP
+-TTTMMPP-I-IITP
+-SSSSSMM-S-SSAP
+-LLLVVTM-L-LLVC
+------AA-R-RR-F
+-KKKTAAA-S-SS-S
+-PAATTLL-L-LLAS
+-IIITTPP-P-PPLP
+-PSSKTTS-S-FFPL
+-NNNATNN-A-AAAR
+-VVVFTVT-N-NNAL
+-GGGSKGG-T-TTKR
+-EEENARR-Q-QQVV
+-----F---------
+-----P---------
+-AAAGSAS-S-SSGA
+-LLLFGLL-L-LLIV
+-FFFLFFF-F-FFMA
+-GGGGGGG-G-GGGK
+-LLLLLLL-L-LLRP
+-KKKKKKK-K-KKSL
+-SSSTSST-S-SSAA
+-----V---------
+-AGGSSSG-G-SSSA
+----LTAS-T-TTSP
+----KKSR-A-AARM
+-NRRRRR--R-RRRR
+-GNNGG---G-GG-R
+-GGGDDGG-G-GG-Q
+-KRRLLRG-R-RRRL
+-VIIAAVR-V-VVLL
+-TTTVVTM-T-TTRR
+-CCCAAAT-A-AAAA
+-MMMMMMM-M-MMQQ
+AAAAAAAAAAAAAAA
+SSSSSTAATTTTTTT
+YYYYYYYYYYYYYYY
+KKKKKKKKKKKKKNN
+VVVVVVVVVVVVVVV
+KKKKKKTTKKKKKKK
+LLLLLLLLFFFFFLL
+IIIIVIVVIIIIIII
+TTTTTTTTTTTTTTT
+PPPPPPPPPPPPPPP
+DDEDDEETEEEEEEE
+GGGGGGGGGGGGGGG
+PPPPTPKNEEEEEEE
+IIIIQQQVQLQQQVV
+EEEEEEEEEEEEEEE
+FFFFFFLFVVVVVLL
+DDEEEDEQEEEEEQQ
+CCCCCCCCCCCCCVV
+PPPPPPPPDDDEEPP
+DDDDSDDDDDDEEDD
+DNDDDDDDDDDDDDD
+VVVVVVVVVVVVVVV
+YYYYYYYYYYYYYYY
+IIIIIIIIVVVVVII
+LLLLLLLLLLLLLLL
+DDDDDDDDDDDDDDD
+QQQQHHAAAAAAAQF
+AAAAAAAAAAAAAAA
+EEEEEEEEEEEEEEE
+EEEEEEEEEEEEEEE
+AAEEVVAEAAAAADE
+GGGGGGGGGGGGGGG
+HHHHIIIIIIILLII
+DDDDDEDDDDDDDDD
+LLLLLLLLLLLLLLL
+PPPPPPPPPPPPPPP
+YYYYYYYYYYYYYYF
+SSSSSSSSSSSSSSS
+CCCCCCCCCCCCCCC
+RRRRRRRRRRRRRRR
+AAAAAAAAAAAAAAA
+GGGGGGGGGGGGGGG
+SSSSSSSSSSSSSSS
+CCCCCCCCCCCCCCC
+SSSSSSSSSSSSSSS
+SSSSSSSSSSSSSSS
+CCCCCCCCCCCCCCC
+AAAAAAAAAAAAAAA
+GGGGGGGGGGGGGGG
+KKKKKKKKKKKKKKK
+IIVVVVVLVVVVVVV
+AATTVVTKVVVVVVV
+GGAAGNSTSSSSSSS
+GGGGGGGGGGGGGGG
+AASTENSSSSFSSSS
+VVVVVVVLVVVIIVV
+DDDDDNNNDDDDDDD
+QQQQQQQQQQQQQQQ
+TTSSSEDDSSSSSSS
+DDDDDDDDDDDDDDD
+GGGGGGGQQQEQQQQ
+NNNKSSSSSSSSSSS
+FFFFFFFFFFFFFYF
+LLLLLLLLLLLLLLL
+DDDDDDDDDDDDDDN
+DDEDDDDDDDDDDDD
+DDDDEEDDDEDE-GN
+QQQQQQQQQQQQ-QQ
+LLEEIIIIIIIM-IV
+EEAAEEKDAGAS-AA
+EEAAAGEEEEEE-DD
+GGGGGGGGGGGG-GG
+WWFFFWWWFFFY-WW
+VVVVVVVVVVVV-VV
+LLLLLLLLLLLL-LL
+TTTTTTTTTTTT-TT
+CCCCCCCCCCCC-CC
+VVVVVVVAAAAV-HA
+AAAAAAAAAAAA-AA
+YYYYYFYYYYYY-YY
+PPPPPPPPPPPP-PP
+QQKKTTTVTTTT-TT
+SSGCSSGSSSSS-SS
+DDDDDDDDDDDD-DD
+VVVVVVVVVVVV-VV
+TTTTVTTTTTTV-VV
+IIIIIIIIIIII-II
+EEEEEEEEEEEE-EE
+TTTTTTTTTTTT-TT
+HHHHHHHHHHHH-HH
+KKKKKKKKRKKK-KK
+EEEEEEEEEEEE-EE
+AAEEEEEEEEEE-ED
+EEEEDEEEDDEA-ED
+LLLLLLLLMILI-LL
+VVTTTTTTVVVM-TL
+GGAAAAAA-----G-
+-------------A-
+*
--- /dev/null
+>FER_CAPAA/1-97 Ferredoxin
+-----------------------------------------------------------ASYKVKLITPDGP
+IEFDCPDDVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLEEGWVLTCVAYPQSDV
+TIETHKEAELVG-
+>FER_CAPAN/1-144 Ferredoxin, chloroplast precursor
+MA------SVSATMISTSFMPRKPAVTSL-KPIPNVGE--ALFGLKS-A--NGGKVTCMASYKVKLITPDGP
+IEFDCPDNVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLEEGWVLTCVAYPQSDV
+TIETHKEAELVG-
+>FER1_SOLLC/1-144 Ferredoxin-1, chloroplast precursor
+MA------SISGTMISTSFLPRKPAVTSL-KAISNVGE--ALFGLKS-G--RNGRITCMASYKVKLITPEGP
+IEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGSVDQSDGNFLDEDQEAAGFVLTCVAYPKGDV
+TIETHKEEELTA-
+>Q93XJ9_SOLTU/1-144 Ferredoxin I precursor
+MA------SISGTMISTSFLPRKPVVTSL-KAISNVGE--ALFGLKS-G--RNGRITCMASYKVKLITPDGP
+IEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGKFLDDDQEAAGFVLTCVAYPKCDV
+TIETHKEEELTA-
+>FER1_PEA/1-149 Ferredoxin-1, chloroplast precursor
+MATT---PALYGTAVSTSFLRTQPMPMSV-TTTKAFSN--GFLGLKT-SLKRGDLAVAMASYKVKLVTPDGT
+QEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDDEQIEAGFVLTCVAYPTSDV
+VIETHKEEDLTA-
+>Q7XA98_TRIPR/1-152 Ferredoxin I
+MATT---PALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGFGLKSVSTKRGDLAVAMATYKVKLITPEGP
+QEFDCPDDVYILDHAEEVGIELPYSCRAGSCSSCAGKVVNGNVNQEDGSFLDDEQIEGGWVLTCVAFPTSDV
+TIETHKEEELTA-
+>FER1_MESCR/1-148 Ferredoxin-1, chloroplast precursor
+MAAT--TAALSGATMSTAFAPK--TPPMTAALPTNVGR--ALFGLKS-SASR-GRVTAMAAYKVTLVTPEGK
+QELECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVTSGSVNQDDGSFLDDDQIKEGWVLTCVAYPTGDV
+TIETHKEEELTA-
+>FER1_SPIOL/1-147 Ferredoxin-1, chloroplast precursor
+MAAT--TTTMMG--MATTFVPKPQAPPMMAALPSNTGR--SLFGLKT-GSR--GGRMTMAAYKVTLVTPTGN
+VEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDV
+TIETHKEEELTA-
+>FER3_RAPSA/1-96 Ferredoxin, leaf L-A
+-----------------------------------------------------------ATYKVKFITPEGE
+QEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQIAEGFVLTCAAYPTSDV
+TIETHREEDMV--
+>FER2_ARATH/1-148 Ferredoxin-2, chloroplast precursor
+MAST----ALSSAIVGTSFIRRSPAPISLRSLPSANTQ--SLFGLKS-GTARGGRVTAMATYKVKFITPEGE
+LEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDV
+TIETHKEEDIV--
+>FER_BRANA/1-96 Ferredoxin
+-----------------------------------------------------------ATYKVKFITPEGE
+QEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFVDQSDESFLDDDQIAEGFVLTCAAYPTSDV
+TIETHKEEELV--
+>FER1_ARATH/1-148 Ferredoxin-1, chloroplast precursor
+MAST----ALSSAIVSTSFLRRQQTPISLRSLPFANTQ--SLFGLKS-STARGGRVTAMATYKVKFITPEGE
+QEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDV
+VIETHKEEAIM--
+>Q93Z60_ARATH/1-118 At1g10960/T19D16_12
+MAST----ALSSAIVSTSFLRRQQTPISLRSLPFANTQ--SLFGLKS-STARGGRVTAMATYKVKFITPEGE
+QEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDD-------------------
+-------------
+>FER1_MAIZE/1-150 Ferredoxin-1, chloroplast precursor
+MATVLGSPRAPAFFFSSSSLRAAPAPTAV--ALPAAKV--GIMGRSA-SSRR--RLRAQATYNVKLITPEGE
+VELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDV
+VIETHKEEELTGA
+>O80429_MAIZE/1-140 Ferredoxin
+MAAT---------ALSMSILR---APPPCFSSPLRLRV--AVAKPLA-APMRRQLLRAQATYNVKLITPEGE
+VELQVPDDVYILDFAEEEGIDLPFSCRAGSCSSCAGKVVSGSVDQSDQSFLNDNQVADGWVLTCAAYPTSDV
+VIETHKEDDLL--
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.gui;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertTrue;
+
+import java.io.File;
+
+import org.testng.annotations.AfterMethod;
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.BeforeMethod;
+import org.testng.annotations.DataProvider;
+import org.testng.annotations.Test;
+
+import jalview.bin.Cache;
+import jalview.bin.Jalview;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.SequenceI;
+import jalview.gui.StructureViewer.ViewerType;
+import jalview.io.DataSourceType;
+import jalview.io.FileLoader;
+import jalview.structure.StructureImportSettings.TFType;
+
+public class AnnotationLabelsTest2
+{
+ @BeforeClass(alwaysRun = true)
+ public static void setUpBeforeClass() throws Exception
+ {
+ if (Desktop.instance != null)
+ Desktop.instance.closeAll_actionPerformed(null);
+
+ setUpJvOptionPane();
+ /*
+ * use read-only test properties file
+ */
+ Cache.loadProperties("test/jalview/io/testProps.jvprops");
+ Jalview.main(new String[] { "--nonews", "--nosplash", });
+ }
+
+ @AfterMethod(alwaysRun = true)
+ public void tearDown()
+ {
+ if (Desktop.instance != null)
+ Desktop.instance.closeAll_actionPerformed(null);
+ }
+
+ /**
+ * configure (read-only) properties for test to ensure Consensus is computed
+ * for colour Above PID testing
+ */
+ @BeforeMethod(alwaysRun = true)
+ public void setUp()
+ {
+ Cache.loadProperties("test/jalview/io/testProps.jvprops");
+ Cache.applicationProperties.setProperty("SHOW_IDENTITY",
+ Boolean.TRUE.toString());
+
+ }
+
+ public static void setUpJvOptionPane()
+ {
+ JvOptionPane.setInteractiveMode(false);
+ JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
+ }
+
+ @Test(
+ groups =
+ { "Functional", "testTask1" },
+ dataProvider = "openFilesWithIdWidthChanges")
+ public void testIdWidthChanges(String alignmentFilename, boolean wrap,
+ int idWidth1min, int idWidth1max, int manualWidth,
+ String structureFilename, String paeFilename,
+ boolean secondaryStructureView, TFType temperatureFactorType,
+ ViewerType viewerType, int idWidth2min, int idWidth2max)
+ {
+ AlignFrame af = new FileLoader()
+ .LoadFileWaitTillLoaded(alignmentFilename, DataSourceType.FILE);
+ try
+ {
+ Thread.sleep(200); // to allow alignment annotations to open
+ } catch (InterruptedException e)
+ {
+ // TODO Auto-generated catch block
+ e.printStackTrace();
+ }
+ AlignViewport av = af.getCurrentView();
+
+ int idWidth = 0;
+
+ idWidth = av.getIdWidth();
+ assertTrue(idWidth > idWidth1min,
+ "idWidth (" + idWidth + ") is not greater than " + idWidth1min);
+ assertTrue(idWidth < idWidth1max,
+ "idWidth (" + idWidth + ") is not narrower than" + idWidth1max);
+
+ // set wrap
+ if (wrap)
+ {
+ af.setWrapFormat(true, false);
+ idWidth = av.getIdWidth();
+ assertTrue(idWidth > idWidth1min, "After wrap idWidth (" + idWidth
+ + ") is not greater than " + idWidth1min);
+ assertTrue(idWidth < idWidth1max, "After wrap idWidth (" + idWidth
+ + ") is not narrower than" + idWidth1max);
+ }
+
+ AlignmentI al = av.getAlignment();
+ SequenceI s = al.getSequenceAt(0);
+ AlignmentPanel ap = af.alignPanel;
+
+ File structureFile = new File(structureFilename);
+ File paeFile = new File(paeFilename);
+
+ StructureViewer sv = StructureChooser.openStructureFileForSequence(null,
+ null, ap, s, false, structureFile.getAbsolutePath(),
+ temperatureFactorType, paeFile.getAbsolutePath(), true,
+ secondaryStructureView, false, viewerType);
+ // give time for annotations to open
+ try
+ {
+ Thread.sleep(200); // to allow alignment annotations to open
+ } catch (InterruptedException e)
+ {
+ // TODO Auto-generated catch block
+ e.printStackTrace();
+ }
+
+ // idWidth = ap.getIdPanel().getWidth();
+ idWidth = av.getIdWidth();
+ assertTrue(idWidth > idWidth2min,
+ "idWidth (" + idWidth + ") is not greater than " + idWidth2min);
+ assertTrue(idWidth < idWidth2max,
+ "idWidth (" + idWidth + ") is not narrower than" + idWidth2max);
+ }
+
+ @Test(
+ groups =
+ { "Functional", "testTask1" },
+ dataProvider = "openFilesWithIdWidthChanges")
+ public void testIdWidthNoChanges(String alignmentFilename, boolean wrap,
+ int idWidth1min, int idWidth1max, int manualWidth,
+ String structureFilename, String paeFilename,
+ boolean secondaryStructureView, TFType temperatureFactorType,
+ ViewerType viewerType, int idWidth2min, int idWidth2max)
+ {
+ AlignFrame af = new FileLoader()
+ .LoadFileWaitTillLoaded(alignmentFilename, DataSourceType.FILE);
+ try
+ {
+ Thread.sleep(200); // to allow alignment annotations to open
+ } catch (InterruptedException e)
+ {
+ // TODO Auto-generated catch block
+ e.printStackTrace();
+ }
+ AlignViewport av = af.getCurrentView();
+
+ int idWidth = 0;
+
+ idWidth = av.getIdWidth();
+ assertTrue(idWidth > idWidth1min,
+ "idWidth (" + idWidth + ") is not greater than " + idWidth1min);
+ assertTrue(idWidth < idWidth1max,
+ "idWidth (" + idWidth + ") is not narrower than" + idWidth1max);
+
+ AlignmentI al = av.getAlignment();
+ SequenceI s = al.getSequenceAt(0);
+ AlignmentPanel ap = af.alignPanel;
+
+ // set width manually
+ av.setIdWidth(manualWidth);
+ ap.validateAnnotationDimensions(false);
+ ap.paintAlignment(true, false);
+ ap.getIdPanel().getIdCanvas().setManuallyAdjusted(true);
+
+ idWidth = av.getIdWidth();
+ assertEquals(idWidth, manualWidth,
+ "idWidth is not set to the manually set width " + manualWidth);
+
+ File structureFile = new File(structureFilename);
+ File paeFile = new File(paeFilename);
+
+ StructureViewer sv = StructureChooser.openStructureFileForSequence(null,
+ null, ap, s, false, structureFile.getAbsolutePath(),
+ temperatureFactorType, paeFile.getAbsolutePath(), false,
+ secondaryStructureView, false, viewerType);
+
+ idWidth = ap.getIdPanel().getWidth();// av.getIdWidth();
+ idWidth = av.getIdWidth();
+ assertEquals(idWidth, manualWidth,
+ "idWidth is not set to the manually set width " + manualWidth
+ + " after adding structure annotations");
+ assertFalse(idWidth > idWidth2min,
+ "idWidth (" + idWidth + ") is greater than " + idWidth2min);
+ }
+
+ @DataProvider(name = "openFilesWithIdWidthChanges")
+ public Object[][] openFilesWithIdWidthChanges()
+ {
+ /*
+ String alignmentFilename,
+ boolean wrap,
+ int idWidth1min,
+ int idWidth1max,
+ int manualWidth, // ignored by testIdWidthChanges()
+ String structureFilename,
+ String paeFilename,
+ boolean secondaryStructureView,
+ TFType temperatureFactorType,
+ ViewerType viewerType,
+ int idWidth2min,
+ int idWidth2max,
+ */
+ return new Object[][] {
+ //
+ /*
+ */
+ { "./test/files/annotation_label_width/sample.a2m", false, 50, 70,
+ 100,
+ "./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3.pdb",
+ "./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3_scores.json",
+ true, TFType.PLDDT, null, 115, 130 },
+ { "./test/files/annotation_label_width/sample.a2m", true, 50, 70,
+ 100,
+ "./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3.pdb",
+ "./examples/test_fab41.result/test_fab41_unrelaxed_rank_1_model_3_scores.json",
+ true, TFType.PLDDT, null, 115, 130 },
+ /*
+ */
+ };
+ }
+
+}
--- /dev/null
+#!/usr/bin/env bash
+
+###############################
+# Wrapper for Jalview
+#
+# 2023-08-16 Jalview 2.11.3.0 has new command line arguments
+# Old command line arguments are currently detected and actioned
+# but are no longer supported and will be removed at a later date.
+#
+# See
+# Jalview -> Help -> Documentation -> Command Line -> introduction and reference
+# or
+# https://www.jalview.org/help/html/features/clarguments.html
+# for details of the new command line arguments.
+#
+# Note, in order to run commandline-only calls use
+# --headless
+#
+# By default, this wrapper executes java -version to determine the JRE version
+# Set JALVIEW_JRE=j1.8 or JALVIEW_JRE=j11 to skip the version check.
+#
+# By default, this wrapper does NOT restrict the memory consumption of Jalview.
+# Set eg. JALVIEW_MAXMEM=1g to set the maximal memory of Jalview's VM
+#
+# This script is maintained in the Jalview repository in utils/conda/jalview.sh
+###############################
+
+declare -a ARGS=("${@}")
+ARG1=$1
+
+# this function is because there's no readlink -f in Darwin/macOS
+function readlinkf() {
+ FINDFILE="$1"
+ FILE="${FINDFILE}"
+ PREVFILE=""
+ C=0
+ MAX=100 # just in case we end up in a loop
+ FOUND=0
+ while [ "${C}" -lt "${MAX}" -a "${FILE}" != "${PREVFILE}" -a "${FOUND}" -ne 1 ]; do
+ PREVFILE="${FILE}"
+ FILE="$(readlink "${FILE}")"
+ if [ -z "${FILE}" ]; then
+ # the readlink is empty means we've arrived at the script, let's canonicalize with pwd
+ FILE="$(cd "$(dirname "${PREVFILE}")" &> /dev/null && pwd -P)"/"$(basename "${PREVFILE}")"
+ FOUND=1
+ elif [ "${FILE#/}" = "${FILE}" ]; then
+ # FILE is not an absolute path link, we need to add the relative path to the previous dir
+ FILE="$(dirname "${PREVFILE}")/${FILE}"
+ fi
+ C=$((C+1))
+ done
+ if [ "${FOUND}" -ne 1 ]; then
+ echo "Could not determine path to actual file '$(basename "${FINDFILE}")'" >&2
+ exit 1
+ fi
+ echo "${FILE}"
+}
+
+ISMACOS=0
+if [ "$( uname -s )" = "Darwin" ]; then
+ ISMACOS=1
+fi
+
+# check for headless mode
+HEADLESS=0
+GUI=0
+HELP=0
+DEBUG=0
+for RAWARG in "${@}"; do
+ ARG="${RAWARG%%=*}"
+ case "${ARG}" in
+ --headless|--output|--image|--structureimage)
+ HEADLESS=1
+ ;;
+ --help|--help-*|--version)
+ HELP=1
+ ;;
+ --gui)
+ GUI=1
+ ;;
+ --debug)
+ DEBUG=1
+ ;;
+ esac
+
+ if [ "${HELP}" = 1 ]; then
+ # --help takes precedence
+ HEADLESS=1
+ GUI=0
+ elif [ "${GUI}" = 1 ]; then
+ # --gui takes precedence over --headless
+ HEADLESS=0
+ fi
+done
+
+declare -a JVMARGS=()
+
+# set vars for being inside the macos App Bundle
+if [ "${ISMACOS}" = 1 ]; then
+# MACOS ONLY
+ DIR="$(dirname "$(readlinkf "$0")")"
+ JVMARGS=( "${JVMARGS[@]}" "-Xdock:icon=${DIR}/jalview_logo.png" )
+else
+# NOT MACOS
+ DIR="$(dirname "$(readlink -f "$0")")"
+fi
+
+if [ "${HEADLESS}" = 1 ]; then
+ # this suppresses the Java icon appearing in the macOS Dock and maybe other things in other OSes
+ JVMARGS=( "${JVMARGS[@]}" "-Djava.awt.headless=true" )
+fi
+
+JAVA=java
+
+# decide which jalview jar to launch - either 'j11' or 'j1.8'
+if [[ "$JALVIEW_JRE" != "j11" && "$JALVIEW_JRE" != "j1.8" ]]; then
+ JALVIEW_JRE="j11"
+ # if java 8 is installed we pick the j1.8 build
+ if [[ $( "${JAVA}" -version 2>&1 | grep '"1.8' ) != "" ]]; then
+ JALVIEW_JRE="j1.8"
+ fi
+fi
+
+JARPATH="${DIR}/jalview-all-${JALVIEW_JRE}.jar"
+
+# check if memory maximum is set and if so forward to java-based jalview call
+if [ \! -z "$JALVIEW_MAXMEM" ]; then
+ JVMARGS=( "${JVMARGS[@]}" "-Xmx${JALVIEW_MAXMEM}" )
+fi
+
+# WINDOWS ONLY (Cygwin or WSL)
+# change paths for Cygwin or Windows Subsystem for Linux (WSL)
+if [ "${ISMACOS}" != 1 ]; then # older macos doesn't like uname -o, best to avoid
+ if [ "$(uname -o)" = "Cygwin" ]; then
+ # CYGWIN
+ JARPATH="$(cygpath -pw "${JARPATH}")"
+ # now for some arg paths fun. only translating paths starting with './', '../', '/' or '~'
+ ARGS=()
+ for ARG in "${@}"; do
+ if [ "${ARG}" != "${ARG#@(/|./|../|~)}" ]; then
+ ARGS=( "${ARGS[@]}" "$(cygpath -aw "${ARG}")" )
+ else
+ ARGS=( "${ARGS[@]}" "${ARG}" )
+ fi
+ done
+ elif uname -r | grep -i microsoft | grep -i wsl >/dev/null; then
+ # WSL
+ JARPATH="$(wslpath -aw "${JARPATH}")"
+ ARGS=()
+ for ARG in "${@}"; do
+ if [ "${ARG}" != "${ARG#@(/|./|../|~)}" ]; then
+ # annoyingly wslpath does not work if the file doesn't exist!
+ ARGBASENAME="$(basename "${ARG}")"
+ ARGDIRNAME="$(dirname "${ARG}")"
+ ARGS=( "${ARGS[@]}" "$(wslpath -aw "${ARGDIRNAME}")\\${ARGBASENAME}" )
+ else
+ ARGS=( "${ARGS[@]}" "${ARG}" )
+ fi
+ done
+ JAVA="${JAVA}.exe"
+ fi
+fi
+
+# get console width -- three ways to try, just in case
+if command -v tput 2>&1 >/dev/null; then
+ COLUMNS=$(tput cols) 2>/dev/null
+elif command -v stty 2>&1 >/dev/null; then
+ COLUMNS=$(stty size | cut -d" " -f2) 2>/dev/null
+elif command -v resize 2>&1 >/dev/null; then
+ COLUMNS=$(resize -u | grep COLUMNS= | sed -e 's/.*=//;s/;//') 2>/dev/null
+fi
+JVMARGS=( "${JVMARGS[@]}" "-DCONSOLEWIDTH=${COLUMNS}" )
+
+if [ "${DEBUG}" = 1 ]; then
+ echo Shell running: "${JAVA}" "${JVMARGS[@]}" -jar \""${JARPATH}"\" "${ARGS[@]}"
+fi
+
+"${JAVA}" "${JVMARGS[@]}" -jar "${JARPATH}" "${ARGS[@]}"
ISMACOS=1
fi
+# check for headless mode
+HEADLESS=0
+GUI=0
+HELP=0
+DEBUG=0
+for RAWARG in "${@}"; do
+ ARG="${RAWARG%%=*}"
+ case "${ARG}" in
+ --headless|--output|--image|--structureimage)
+ HEADLESS=1
+ ;;
+ --help|--help-*|--version)
+ HELP=1
+ ;;
+ --gui)
+ GUI=1
+ ;;
+ --debug)
+ DEBUG=1
+ ;;
+ esac
+
+ if [ "${HELP}" = 1 ]; then
+ # --help takes precedence
+ HEADLESS=1
+ GUI=0
+ elif [ "${GUI}" = 1 ]; then
+ # --gui takes precedence over --headless
+ HEADLESS=0
+ fi
+done
+
declare -a JVMARGS=()
# set vars for being inside the macos App Bundle
if [ "${ISMACOS}" = 1 ]; then
# MACOS ONLY
DIR="$(dirname "$(readlinkf "$0")")"
- APP="${DIR%.app/Contents/*}".app
- if [ "${APP}" = "${APP%.app}" ]; then
- echo "Could not find Jalview.app" >&2
- exit 2
- fi
- APPDIR="${APP}/Contents/Resources/app"
+ APPDIR="${DIR%/bin}"
JAVA="${APPDIR}/jre/Contents/Home/bin/java"
JVMARGS=( "${JVMARGS[@]}" "-Xdock:icon=${APPDIR}/resource/jalview_logo.png" )
else
JAVA="${APPDIR}/jre/bin/java"
fi
+if [ "${HEADLESS}" = 1 ]; then
+ # this suppresses the Java icon appearing in the macOS Dock and maybe other things in other OSes
+ JVMARGS=( "${JVMARGS[@]}" "-Djava.awt.headless=true" )
+fi
+
SYSJAVA=java
GETDOWNTXT="${APPDIR}/getdown.txt"
echo "Cannot find bundled java, using system ${JAVA} and hoping for the best!" >&2
fi
+if [ "${DEBUG}" = 1 ]; then
+ echo Shell running: \""${JAVA}"\" \""${JVMARGS[@]}"\" -cp \""${CLASSPATH}"\" jalview.bin.Launcher "${ARGS[@]}"
+fi
+
"${JAVA}" "${JVMARGS[@]}" -cp "${CLASSPATH}" jalview.bin.Launcher "${ARGS[@]}"