<classpathentry kind="lib" path="lib/VARNAv3-93.jar"/>
<classpathentry kind="lib" path="lib/jfreesvg-2.1.jar"/>
<classpathentry kind="lib" path="lib/quaqua-filechooser-only-8.0.jar"/>
+ <classpathentry kind="lib" path="lib/htsjdk-1.133.jar"/>
<classpathentry kind="con" path="org.eclipse.jdt.USER_LIBRARY/plugin"/>
<classpathentry kind="lib" path="lib/xml-apis.jar"/>
<classpathentry kind="con" path="org.eclipse.jdt.junit.JUNIT_CONTAINER/4"/>
<classpathentry kind="lib" path="lib/java-json.jar"/>
<classpathentry kind="lib" path="lib/Jmol-14.2.14_2015.06.11.jar"/>
<classpathentry kind="con" path="org.testng.TESTNG_CONTAINER"/>
+ <classpathentry kind="lib" path="lib/biojava-core-4.1.0.jar"/>
+ <classpathentry kind="lib" path="lib/biojava-ontology-4.1.0.jar"/>
<classpathentry kind="output" path="classes"/>
</classpath>
org.eclipse.jdt.core.formatter.alignment_for_binary_expression=16
org.eclipse.jdt.core.formatter.alignment_for_compact_if=16
org.eclipse.jdt.core.formatter.alignment_for_conditional_expression=80
-org.eclipse.jdt.core.formatter.alignment_for_enum_constants=0
+org.eclipse.jdt.core.formatter.alignment_for_enum_constants=16
org.eclipse.jdt.core.formatter.alignment_for_expressions_in_array_initializer=16
org.eclipse.jdt.core.formatter.alignment_for_method_declaration=0
org.eclipse.jdt.core.formatter.alignment_for_multiple_fields=16
org.eclipse.jdt.core.formatter.brace_position_for_type_declaration=next_line
org.eclipse.jdt.core.formatter.comment.clear_blank_lines_in_block_comment=false
org.eclipse.jdt.core.formatter.comment.clear_blank_lines_in_javadoc_comment=false
-org.eclipse.jdt.core.formatter.comment.format_block_comments=true
+org.eclipse.jdt.core.formatter.comment.format_block_comments=false
org.eclipse.jdt.core.formatter.comment.format_header=false
org.eclipse.jdt.core.formatter.comment.format_html=true
org.eclipse.jdt.core.formatter.comment.format_javadoc_comments=true
quaqua: v.8.0 (latest stable) by Randel S Hofer. LGPL and BSD Modified license: downloaded from http://www.randelshofer.ch/quaqua/
+lib/htsjdk-1.120-SNAPSHOT.jar: built from maven master at https://github.com/samtools/htsjdk MIT License to Broad Institute
+
+
Additional dependencies
examples/javascript/deployJava.js : http://java.com/js/deployJava.js
-#-------------------------------------------------------------------------------
-# Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
-# Copyright (C) $$Year-Rel$$ The Jalview Authors
-#
-# This file is part of Jalview.
-#
-# Jalview is free software: you can redistribute it and/or
-# modify it under the terms of the GNU General Public License
-# as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version.
-#
-# Jalview is distributed in the hope that it will be useful, but
-# WITHOUT ANY WARRANTY; without even the implied warranty
-# of MERCHANTABILITY or FITNESS FOR A PARTICULAR
-# PURPOSE. See the GNU General Public License for more details.
-#
-# You should have received a copy of the GNU General Public License along with Jalview. If not, see <http://www.gnu.org/licenses/>.
-# The Jalview Authors are detailed in the 'AUTHORS' file.
-#-------------------------------------------------------------------------------
-ST-TURN-IIL 705b23
-GAMMA-TURN-CLASSIC 788763
+ST-TURN-IIL blue|255,0,255|absolute|20.0|95.0|below|66.0
+GAMMA-TURN-CLASSIC red|0,255,255|20.0|95.0|below|66.0
BETA-TURN-IR 9a6a94
BETA-TURN-IL d6a6ca
BETA-BULGE 1dc451
+# (exonerate delimits GFF with [START|END] OF GFF DUMP)
+# --- START OF GFF DUMP ---
+#
+#
##gff-version 2
##source-version exonerate:protein2genome:local 2.2.0
##date 2015-01-16
contig_1146 exonerate:protein2genome:local gene 8534 11269 3652 - . gene_id 0 ; sequence DDB_G0269124 ; gene_orientation .
contig_1146 exonerate:protein2genome:local cds 8534 11269 . - .
contig_1146 exonerate:protein2genome:local exon 8534 11269 . - . insertions 3 ; deletions 6
+#TODO need to understand why GFF features is from 11269 but Align is from 11270
contig_1146 exonerate:protein2genome:local similarity 8534 11269 3652 - . alignment_id 0 ; Query DDB_G0269124 ; Align 11270 143 120 ; Align 11150 187 282 ; Align 10865 281 888 ; Align 9977 578 1068 ; Align 8909 935 375
+# and a made-up alignment to a sequence in exonerateseqs.fa
+contig_1146 exonerate:protein2genome:local similarity 8534 11269 3652 - . alignment_id 0 ; Query DDB_G0280897 ; Align 11270 143 120
# --- END OF GFF DUMP ---
--- /dev/null
+##gff-version 2
+# exonerate output in gff2 format; not gff3 because
+# - 'similarity' is not a Sequence Ontology term
+# - attributes' name/values are separated by space ' ' not equals '='
+##source-version exonerate:protein2genome:local 2.2.0
+##date 2015-01-16
+##type DNA
+#
+# exonerate run with --showtargetgff generates 'features on the target' i.e. mappings to the query
+# tab-delimited
+# seqname source feature start end score strand frame attributes
+#
+seq1 exonerate:protein2genome:local gene 8 11 3652 - . gene_id 0 ; sequence seq2 ; gene_orientation .
+seq1 exonerate:protein2genome:local cds 9 11 . - .
+seq1 exonerate:protein2genome:local exon 9 11 . - . insertions 3 ; deletions 6
+#seq1 exonerate:protein2genome:local similarity 8 11 3652 - . alignment_id 0 ; Query seq2 ; Align 11 1 3
+seq1 exonerate:protein2genome:local similarity 9 11 3652 - . alignment_id 0 ; Query seq2 ; Align 11 1 3
+#
+# appending FASTA sequences is strictly a GFF3 format feature
+# but Jalview is able to handle this mixture of GFF2 / GFF3 :-)
+#
+##FASTA
+>seq1
+ACTACGACACGACGACGACGACG
+>seq2
+CDEQEATGTQDAQEQAQC
+
+
+++ /dev/null
-##gff-version 2
-##source-version exonerate:protein2genome:local 2.2.0
-##date 2015-01-16
-##type DNA
-#
-#
-# seqname source feature start end score strand frame attributes
-#
-seq1 exonerate:protein2genome:local gene 8 11 3652 - . gene_id 0 ; sequence seq2 ; gene_orientation .
-seq1 exonerate:protein2genome:local cds 9 11 . - .
-seq1 exonerate:protein2genome:local exon 9 11 . - . insertions 3 ; deletions 6
-seq1 exonerate:protein2genome:local similarity 8 11 3652 - . alignment_id 0 ; Query seq2 ; Align 11 1 3
-##FASTA
->seq1
-ACTACGACACGACGACGACGACG
->seq2
-CDEQEATGTQDAQEQAQC
-
-
conserved BLOSUM62 score (which is higher). This value is normalised
for each column, and then plotted on a scale from 0 to 1.
</p>
- <p>Multiple alignment algorithms using the BLOSUM 62 substition
+ <p>Multiple alignment algorithms using the BLOSUM 62 substitution
matrices should, in theory, maximise alignment quality for an
un-gapped alignment, and locally maximise quality for gapped
alignments.</p>
matrix, and (since 2.8.1) is available for Tree and PCA
calculations.</li>
<li><a href="#simplenucleotide">Simple Nucleotide
- Substition</a> is a (fairly) arbitrary DNA/RNA substitution matrix.</li>
+ Substitution</a> is a (fairly) arbitrary DNA/RNA substitution matrix.</li>
<!-- <li><a href="#conservation">Conservation Matrices</a> A range of matrices for distinguishing amino-acids by physicochemical property conservation.
</li> -->
</ul>
<li><em>label</em><br> Indicate that the feature
description should be used to create a colour for features of
this type.<br> <em>Note: if no threshold value is
- needed then the final '|' may be ommitted.<br> This
+ needed then the final '|' may be omitted.<br> This
keyword was added in Jalview 2.6
</em></li>
<p>
If your sequence annotation is already available in GFF Format (see
- <a href="http://www.sanger.ac.uk/resources/software/gff/spec.html">http://www.sanger.ac.uk/resources/software/gff/spec.html</a>),
+ <a href="http://gmod.org/wiki/GFF2">gmod.org/wiki/GFF2</a>),
then you can leave it as is, after first adding a line containing
only 'GFF' after any Jalview feature colour definitions (<em>this
mixed format capability was added in Jalview 2.6</em>). Alternately,
</pre>
This format allows two alternate ways of referring to a sequence,
- either by its text ID, or its index in an associated alignment.
+ either by its text ID, or its index (base 0) in an associated alignment.
Normally, sequence features are associated with sequences rather than
alignments, and the sequenceIndex field is given as "-1". In
order to specify a sequence by its index in a particular alignment,
ordering based on the average length of each feature type.
</p>
<p>
- The <strong><em>transparency slider setting</em></strong> (currently
- only available in the application version) controls the visibility
+ The <strong><em>transparency slider setting</em></strong> controls the visibility
of features rendered below other features. Reducing the transparency
will mean that features at the top of the list can obscure features
lower down, and increasing it allows the user to 'see through' the
action.link = Link
action.group_link = Group Link
action.show_chain = Show Chain
+label.highlight_selection = Highlight Selection
action.show_group = Show Group
action.fetch_db_references = Fetch DB References
action.view_flanking_regions = Show flanking regions
label.show_sequence_features = Show Sequence Features
label.nucleotide = Nucleotide
label.protein = Protein
+label.nucleotides = Nucleotides
+label.proteins = Proteins
label.to_new_alignment = To New Alignment
label.to_this_alignment = Add To This Alignment
label.apply_colour_to_all_groups = Apply Colour To All Groups
label.export_image = Export Image
label.vamsas_store = VAMSAS store
label.translate_cDNA = Translate as cDNA
-label.linked_view_title = Linked cDNA and protein view
+label.reverse = Reverse
+label.reverse_complement = Reverse Complement
+label.linked_view_title = Linked CDS and protein view
label.align = Align
label.extract_scores = Extract Scores
label.get_cross_refs = Get Cross-References
label.nw_mapping = Needleman & Wunsch Alignment
label.sifts_mapping = SIFTs Mapping
label.mapping_method = Sequence \u27f7 Structure mapping method
+label.mapping_method = Sequence \u27f7 Structure mapping method
status.waiting_for_user_to_select_output_file = Waiting for user to select {0} file.
status.cancelled_image_export_operation = Cancelled {0} export operation.
-info.error_creating_file = Error creating {0} file.
\ No newline at end of file
+info.error_creating_file = Error creating {0} file.
import java.util.Arrays;
import java.util.Hashtable;
import java.util.List;
-import java.util.Set;
/**
* Takes in a vector or array of sequences and column start and column end and
Hashtable[] hconsensus)
{
final char gapCharacter = alignment.getGapCharacter();
- Set<AlignedCodonFrame> mappings = alignment.getCodonFrames();
+ List<AlignedCodonFrame> mappings = alignment.getCodonFrames();
if (mappings == null || mappings.isEmpty())
{
return;
{
continue;
}
- char[] codon = MappingUtils.findCodonFor(seq, col, mappings);
- int codonEncoded = CodingUtils.encodeCodon(codon);
- if (codonEncoded >= 0)
+ List<char[]> codons = MappingUtils
+ .findCodonsFor(seq, col, mappings);
+ for (char[] codon : codons)
{
- codonCounts[codonEncoded + 2]++;
- ungappedCount++;
+ int codonEncoded = CodingUtils.encodeCodon(codon);
+ if (codonEncoded >= 0)
+ {
+ codonCounts[codonEncoded + 2]++;
+ ungappedCount++;
+ }
}
}
codonCounts[1] = ungappedCount;
import jalview.util.QuickSort;
import java.util.ArrayList;
+import java.util.Arrays;
import java.util.List;
/**
int start, int stop, AlignmentI alignment, String method)
{
sortByFeature(featureLabel == null ? null
- : new String[] { featureLabel }, groupLabel == null ? null
- : new String[] { groupLabel }, start, stop, alignment, method);
+ : Arrays.asList(new String[] { featureLabel }),
+ groupLabel == null ? null
+ : Arrays.asList(new String[]{ groupLabel }), start, stop, alignment, method);
}
private static boolean containsIgnoreCase(final String lab,
- final String[] labs)
+ final List<String> labs)
{
if (labs == null)
{
{
return false;
}
- for (int q = 0; q < labs.length; q++)
+ for (String label : labs)
{
- if (labs[q] != null && lab.equalsIgnoreCase(labs[q]))
+ if (lab.equalsIgnoreCase(label))
{
return true;
}
return false;
}
- public static void sortByFeature(String[] featureLabels,
- String[] groupLabels, int start, int stop, AlignmentI alignment,
+ public static void sortByFeature(List<String> featureLabels,
+ List<String> groupLabels, int start, int stop, AlignmentI alignment,
String method)
{
if (method != FEATURE_SCORE && method != FEATURE_LABEL
scoreLabel.append(start + stop + method);
// This doesn't quite work yet - we'd like to have a canonical ordering that
// can be preserved from call to call
- for (int i = 0; featureLabels != null && i < featureLabels.length; i++)
+ if (featureLabels != null)
{
- scoreLabel.append(featureLabels[i] == null ? "null"
- : featureLabels[i]);
+ for (String label : featureLabels)
+ {
+ scoreLabel.append(label);
+ }
}
- for (int i = 0; groupLabels != null && i < groupLabels.length; i++)
+ if (groupLabels != null)
{
- scoreLabel.append(groupLabels[i] == null ? "null" : groupLabels[i]);
+ for (String label : groupLabels)
+ {
+ scoreLabel.append(label);
+ }
}
/*
import jalview.datamodel.DBRefEntry;
import jalview.datamodel.DBRefSource;
import jalview.datamodel.FeatureProperties;
+import jalview.datamodel.IncompleteCodonException;
import jalview.datamodel.Mapping;
import jalview.datamodel.SearchResults;
import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyI;
import jalview.schemes.ResidueProperties;
+import jalview.util.Comparison;
import jalview.util.DBRefUtils;
import jalview.util.MapList;
import jalview.util.MappingUtils;
+import jalview.util.StringUtils;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.Collection;
+import java.util.Collections;
+import java.util.Comparator;
import java.util.HashMap;
import java.util.HashSet;
import java.util.Iterator;
import java.util.LinkedHashMap;
-import java.util.LinkedHashSet;
import java.util.List;
import java.util.Map;
import java.util.Map.Entry;
+import java.util.NoSuchElementException;
import java.util.Set;
import java.util.TreeMap;
}
else
{
- MapList map = mapProteinSequenceToCdna(aaSeq, cdnaSeq);
+ MapList map = mapCdnaToProtein(aaSeq, cdnaSeq);
if (map != null)
{
acf.addMap(cdnaSeq, aaSeq, map);
* Answers true if the mappings include one between the given (dataset)
* sequences.
*/
- public static boolean mappingExists(Set<AlignedCodonFrame> set,
+ public static boolean mappingExists(List<AlignedCodonFrame> mappings,
SequenceI aaSeq, SequenceI cdnaSeq)
{
- if (set != null)
+ if (mappings != null)
{
- for (AlignedCodonFrame acf : set)
+ for (AlignedCodonFrame acf : mappings)
{
if (cdnaSeq == acf.getDnaForAaSeq(aaSeq))
{
}
/**
- * Build a mapping (if possible) of a protein to a cDNA sequence. The cDNA
- * must be three times the length of the protein, possibly after ignoring
- * start and/or stop codons, and must translate to the protein. Returns null
- * if no mapping is determined.
+ * Builds a mapping (if possible) of a cDNA to a protein sequence.
+ * <ul>
+ * <li>first checks if the cdna translates exactly to the protein sequence</li>
+ * <li>else checks for translation after removing a STOP codon</li>
+ * <li>else checks for translation after removing a START codon</li>
+ * <li>if that fails, inspect CDS features on the cDNA sequence</li>
+ * </ul>
+ * Returns null if no mapping is determined.
*
- * @param proteinSeqs
+ * @param proteinSeq
+ * the aligned protein sequence
* @param cdnaSeq
+ * the aligned cdna sequence
* @return
*/
- public static MapList mapProteinSequenceToCdna(SequenceI proteinSeq,
+ public static MapList mapCdnaToProtein(SequenceI proteinSeq,
SequenceI cdnaSeq)
{
/*
final int proteinEnd = proteinSeq.getEnd();
/*
- * If lengths don't match, try ignoring stop codon.
+ * If lengths don't match, try ignoring stop codon (if present)
*/
if (cdnaLength != mappedLength && cdnaLength > 2)
{
cdnaLength -= 3;
}
- if (cdnaLength != mappedLength)
+ if (translatesAs(cdnaSeqChars, startOffset, aaSeqChars))
{
- return null;
- }
- if (!translatesAs(cdnaSeqChars, startOffset, aaSeqChars))
- {
- return null;
+ /*
+ * protein is translation of dna (+/- start/stop codons)
+ */
+ MapList map = new MapList(new int[] { cdnaStart, cdnaEnd }, new int[]
+ { proteinStart, proteinEnd }, 3, 1);
+ return map;
}
- MapList map = new MapList(new int[] { cdnaStart, cdnaEnd }, new int[] {
- proteinStart, proteinEnd }, 3, 1);
- return map;
+
+ /*
+ * translation failed - try mapping CDS annotated regions of dna
+ */
+ return mapCdsToProtein(cdnaSeq, proteinSeq);
}
/**
return false;
}
- int aaResidue = 0;
- for (int i = cdnaStart; i < cdnaSeqChars.length - 2
- && aaResidue < aaSeqChars.length; i += 3, aaResidue++)
+ int aaPos = 0;
+ int dnaPos = cdnaStart;
+ for (; dnaPos < cdnaSeqChars.length - 2
+ && aaPos < aaSeqChars.length; dnaPos += 3, aaPos++)
{
- String codon = String.valueOf(cdnaSeqChars, i, 3);
+ String codon = String.valueOf(cdnaSeqChars, dnaPos, 3);
final String translated = ResidueProperties.codonTranslate(codon);
+
/*
* allow * in protein to match untranslatable in dna
*/
- final char aaRes = aaSeqChars[aaResidue];
+ final char aaRes = aaSeqChars[aaPos];
if ((translated == null || "STOP".equals(translated)) && aaRes == '*')
{
continue;
return false;
}
}
- // fail if we didn't match all of the aa sequence
- return (aaResidue == aaSeqChars.length);
+
+ /*
+ * check we matched all of the protein sequence
+ */
+ if (aaPos != aaSeqChars.length)
+ {
+ return false;
+ }
+
+ /*
+ * check we matched all of the dna except
+ * for optional trailing STOP codon
+ */
+ if (dnaPos == cdnaSeqChars.length)
+ {
+ return true;
+ }
+ if (dnaPos == cdnaSeqChars.length - 3)
+ {
+ String codon = String.valueOf(cdnaSeqChars, dnaPos, 3);
+ if ("STOP".equals(ResidueProperties.codonTranslate(codon)))
+ {
+ return true;
+ }
+ }
+ return false;
}
/**
/*
* Locate the aligned source sequence whose dataset sequence is mapped. We
- * just take the first match here (as we can't align cDNA like more than one
- * protein sequence).
+ * just take the first match here (as we can't align like more than one
+ * sequence).
*/
SequenceI alignFrom = null;
AlignedCodonFrame mapping = null;
/**
* Align sequence 'alignTo' the same way as 'alignFrom', using the mapping to
* match residues and codons. Flags control whether existing gaps in unmapped
- * (intron) and mapped (exon) regions are preserved or not. Gaps linking intro
- * and exon are only retained if both flags are set.
+ * (intron) and mapped (exon) regions are preserved or not. Gaps between
+ * intron and exon are only retained if both flags are set.
*
* @param alignTo
* @param alignFrom
boolean preserveUnmappedGaps)
{
// TODO generalise to work for Protein-Protein, dna-dna, dna-protein
- final char[] thisSeq = alignTo.getSequence();
- final char[] thatAligned = alignFrom.getSequence();
- StringBuilder thisAligned = new StringBuilder(2 * thisSeq.length);
// aligned and dataset sequence positions, all base zero
int thisSeqPos = 0;
char myGapChar = myGap.charAt(0);
int ratio = myGap.length();
- /*
- * Traverse the aligned protein sequence.
- */
int fromOffset = alignFrom.getStart() - 1;
int toOffset = alignTo.getStart() - 1;
int sourceGapMappedLength = 0;
boolean inExon = false;
+ final char[] thisSeq = alignTo.getSequence();
+ final char[] thatAligned = alignFrom.getSequence();
+ StringBuilder thisAligned = new StringBuilder(2 * thisSeq.length);
+
+ /*
+ * Traverse the 'model' aligned sequence
+ */
for (char sourceChar : thatAligned)
{
if (sourceChar == sourceGap)
}
/*
- * Found a residue. Locate its mapped codon (start) position.
+ * Found a non-gap character. Locate its mapped region if any.
*/
sourceDsPos++;
// Note mapping positions are base 1, our sequence positions base 0
if (mappedPos == null)
{
/*
- * Abort realignment if unmapped protein. Or could ignore it??
+ * unmapped position; treat like a gap
*/
- System.err.println("Can't align: no codon mapping to residue "
- + sourceDsPos + "(" + sourceChar + ")");
- return;
+ sourceGapMappedLength += ratio;
+ // System.err.println("Can't align: no codon mapping to residue "
+ // + sourceDsPos + "(" + sourceChar + ")");
+ // return;
+ continue;
}
int mappedCodonStart = mappedPos[0]; // position (1...) of codon start
}
/*
- * At end of protein sequence. Copy any remaining dna sequence, optionally
- * including (intron) gaps. We do not copy trailing gaps in protein.
+ * At end of model aligned sequence. Copy any remaining target sequence, optionally
+ * including (intron) gaps.
*/
while (thisSeqPos < thisSeq.length)
{
{
thisAligned.append(c);
}
+ sourceGapMappedLength--;
+ }
+
+ /*
+ * finally add gaps to pad for any trailing source gaps or
+ * unmapped characters
+ */
+ if (preserveUnmappedGaps)
+ {
+ while (sourceGapMappedLength > 0)
+ {
+ thisAligned.append(myGapChar);
+ sourceGapMappedLength--;
+ }
}
/*
public static int alignProteinAsDna(AlignmentI protein, AlignmentI dna)
{
List<SequenceI> unmappedProtein = new ArrayList<SequenceI>();
+ Map<AlignedCodon, Map<SequenceI, AlignedCodon>> alignedCodons = buildCodonColumnsMap(
+ protein, dna, unmappedProtein);
+ return alignProteinAs(protein, alignedCodons, unmappedProtein);
+ }
+
+ /**
+ * Builds a map whose key is an aligned codon position (3 alignment column
+ * numbers base 0), and whose value is a map from protein sequence to each
+ * protein's peptide residue for that codon. The map generates an ordering of
+ * the codons, and allows us to read off the peptides at each position in
+ * order to assemble 'aligned' protein sequences.
+ *
+ * @param protein
+ * the protein alignment
+ * @param dna
+ * the coding dna alignment
+ * @param unmappedProtein
+ * any unmapped proteins are added to this list
+ * @return
+ */
+ protected static Map<AlignedCodon, Map<SequenceI, AlignedCodon>> buildCodonColumnsMap(
+ AlignmentI protein, AlignmentI dna,
+ List<SequenceI> unmappedProtein)
+ {
+ /*
+ * maintain a list of any proteins with no mappings - these will be
+ * rendered 'as is' in the protein alignment as we can't align them
+ */
unmappedProtein.addAll(protein.getSequences());
- Set<AlignedCodonFrame> mappings = protein.getCodonFrames();
+ List<AlignedCodonFrame> mappings = protein.getCodonFrames();
/*
* Map will hold, for each aligned codon position e.g. [3, 5, 6], a map of
* {dnaSequence, {proteinSequence, codonProduct}} at that position. The
* comparator keeps the codon positions ordered.
*/
- Map<AlignedCodon, Map<SequenceI, String>> alignedCodons = new TreeMap<AlignedCodon, Map<SequenceI, String>>(
+ Map<AlignedCodon, Map<SequenceI, AlignedCodon>> alignedCodons = new TreeMap<AlignedCodon, Map<SequenceI, AlignedCodon>>(
new CodonComparator());
+
for (SequenceI dnaSeq : dna.getSequences())
{
for (AlignedCodonFrame mapping : mappings)
{
- Mapping seqMap = mapping.getMappingForSequence(dnaSeq);
SequenceI prot = mapping.findAlignedSequence(
dnaSeq.getDatasetSequence(), protein);
if (prot != null)
{
+ Mapping seqMap = mapping.getMappingForSequence(dnaSeq);
addCodonPositions(dnaSeq, prot, protein.getGapCharacter(),
seqMap, alignedCodons);
unmappedProtein.remove(prot);
}
}
}
- return alignProteinAs(protein, alignedCodons, unmappedProtein);
+
+ /*
+ * Finally add any unmapped peptide start residues (e.g. for incomplete
+ * codons) as if at the codon position before the second residue
+ */
+ int mappedSequenceCount = protein.getHeight() - unmappedProtein.size();
+ addUnmappedPeptideStarts(alignedCodons, mappedSequenceCount);
+
+ return alignedCodons;
+ }
+
+ /**
+ * Scans for any protein mapped from position 2 (meaning unmapped start
+ * position e.g. an incomplete codon), and synthesizes a 'codon' for it at the
+ * preceding position in the alignment
+ *
+ * @param alignedCodons
+ * the codon-to-peptide map
+ * @param mappedSequenceCount
+ * the number of distinct sequences in the map
+ */
+ protected static void addUnmappedPeptideStarts(
+ Map<AlignedCodon, Map<SequenceI, AlignedCodon>> alignedCodons,
+ int mappedSequenceCount)
+ {
+ // TODO delete this ugly hack once JAL-2022 is resolved
+ // i.e. we can model startPhase > 0 (incomplete start codon)
+
+ List<SequenceI> sequencesChecked = new ArrayList<SequenceI>();
+ AlignedCodon lastCodon = null;
+ Map<SequenceI, AlignedCodon> toAdd = new HashMap<SequenceI, AlignedCodon>();
+
+ for (Entry<AlignedCodon, Map<SequenceI, AlignedCodon>> entry : alignedCodons
+ .entrySet())
+ {
+ for (Entry<SequenceI, AlignedCodon> sequenceCodon : entry.getValue()
+ .entrySet())
+ {
+ SequenceI seq = sequenceCodon.getKey();
+ if (sequencesChecked.contains(seq))
+ {
+ continue;
+ }
+ sequencesChecked.add(seq);
+ AlignedCodon codon = sequenceCodon.getValue();
+ if (codon.peptideCol > 1)
+ {
+ System.err
+ .println("Problem mapping protein with >1 unmapped start positions: "
+ + seq.getName());
+ }
+ else if (codon.peptideCol == 1)
+ {
+ /*
+ * first position (peptideCol == 0) was unmapped - add it
+ */
+ if (lastCodon != null)
+ {
+ AlignedCodon firstPeptide = new AlignedCodon(lastCodon.pos1,
+ lastCodon.pos2, lastCodon.pos3, String.valueOf(seq
+ .getCharAt(0)), 0);
+ toAdd.put(seq, firstPeptide);
+ }
+ else
+ {
+ /*
+ * unmapped residue at start of alignment (no prior column) -
+ * 'insert' at nominal codon [0, 0, 0]
+ */
+ AlignedCodon firstPeptide = new AlignedCodon(0, 0, 0,
+ String.valueOf(seq.getCharAt(0)), 0);
+ toAdd.put(seq, firstPeptide);
+ }
+ }
+ if (sequencesChecked.size() == mappedSequenceCount)
+ {
+ // no need to check past first mapped position in all sequences
+ break;
+ }
+ }
+ lastCodon = entry.getKey();
+ }
+
+ /*
+ * add any new codons safely after iterating over the map
+ */
+ for (Entry<SequenceI, AlignedCodon> startCodon : toAdd.entrySet())
+ {
+ addCodonToMap(alignedCodons, startCodon.getValue(),
+ startCodon.getKey());
+ }
}
/**
* @return
*/
protected static int alignProteinAs(AlignmentI protein,
- Map<AlignedCodon, Map<SequenceI, String>> alignedCodons,
+ Map<AlignedCodon, Map<SequenceI, AlignedCodon>> alignedCodons,
List<SequenceI> unmappedProtein)
{
/*
int column = 0;
for (AlignedCodon codon : alignedCodons.keySet())
{
- final Map<SequenceI, String> columnResidues = alignedCodons
+ final Map<SequenceI, AlignedCodon> columnResidues = alignedCodons
.get(codon);
- for (Entry<SequenceI, String> entry : columnResidues.entrySet())
+ for (Entry<SequenceI, AlignedCodon> entry : columnResidues.entrySet())
{
// place translated codon at its column position in sequence
- entry.getKey().getSequence()[column] = entry.getValue().charAt(0);
+ entry.getKey().getSequence()[column] = entry.getValue().product
+ .charAt(0);
}
column++;
}
*/
static void addCodonPositions(SequenceI dna, SequenceI protein,
char gapChar, Mapping seqMap,
- Map<AlignedCodon, Map<SequenceI, String>> alignedCodons)
+ Map<AlignedCodon, Map<SequenceI, AlignedCodon>> alignedCodons)
{
Iterator<AlignedCodon> codons = seqMap.getCodonIterator(dna, gapChar);
+
+ /*
+ * add codon positions, and their peptide translations, to the alignment
+ * map, while remembering the first codon mapped
+ */
while (codons.hasNext())
{
- AlignedCodon codon = codons.next();
- Map<SequenceI, String> seqProduct = alignedCodons.get(codon);
- if (seqProduct == null)
+ try
+ {
+ AlignedCodon codon = codons.next();
+ addCodonToMap(alignedCodons, codon, protein);
+ } catch (IncompleteCodonException e)
{
- seqProduct = new HashMap<SequenceI, String>();
- alignedCodons.put(codon, seqProduct);
+ // possible incomplete trailing codon - ignore
+ } catch (NoSuchElementException e)
+ {
+ // possibly peptide lacking STOP
}
- seqProduct.put(protein, codon.product);
}
}
/**
+ * Helper method to add a codon-to-peptide entry to the aligned codons map
+ *
+ * @param alignedCodons
+ * @param codon
+ * @param protein
+ */
+ protected static void addCodonToMap(
+ Map<AlignedCodon, Map<SequenceI, AlignedCodon>> alignedCodons,
+ AlignedCodon codon, SequenceI protein)
+ {
+ Map<SequenceI, AlignedCodon> seqProduct = alignedCodons.get(codon);
+ if (seqProduct == null)
+ {
+ seqProduct = new HashMap<SequenceI, AlignedCodon>();
+ alignedCodons.put(codon, seqProduct);
+ }
+ seqProduct.put(protein, codon);
+ }
+
+ /**
* Returns true if a cDNA/Protein mapping either exists, or could be made,
* between at least one pair of sequences in the two alignments. Currently,
* the logic is:
}
AlignmentI dna = al1.isNucleotide() ? al1 : al2;
AlignmentI protein = dna == al1 ? al2 : al1;
- Set<AlignedCodonFrame> mappings = protein.getCodonFrames();
+ List<AlignedCodonFrame> mappings = protein.getCodonFrames();
for (SequenceI dnaSeq : dna.getSequences())
{
for (SequenceI proteinSeq : protein.getSequences())
* @return
*/
protected static boolean isMappable(SequenceI dnaSeq,
- SequenceI proteinSeq, Set<AlignedCodonFrame> mappings)
+ SequenceI proteinSeq, List<AlignedCodonFrame> mappings)
{
if (dnaSeq == null || proteinSeq == null)
{
SequenceI proteinDs = proteinSeq.getDatasetSequence() == null ? proteinSeq
: proteinSeq.getDatasetSequence();
- /*
- * Already mapped?
- */
for (AlignedCodonFrame mapping : mappings)
{
if (proteinDs == mapping.getAaForDnaSeq(dnaDs))
{
+ /*
+ * already mapped
+ */
return true;
}
}
* Just try to make a mapping (it is not yet stored), test whether
* successful.
*/
- return mapProteinSequenceToCdna(proteinDs, dnaDs) != null;
+ return mapCdnaToProtein(proteinDs, dnaDs) != null;
}
/**
}
/**
- * Constructs an alignment consisting of the mapped exon regions in the given
- * nucleotide sequences, and updates mappings to match.
+ * Constructs an alignment consisting of the mapped (CDS) regions in the given
+ * nucleotide sequences, and updates mappings to match. The new sequences are
+ * aligned as per the original sequence, with entirely gapped columns (codon
+ * interrupted by intron) omitted.
*
* @param dna
* aligned dna sequences
* @param mappings
* from dna to protein; these are replaced with new mappings
- * @return an alignment whose sequences are the exon-only parts of the dna
- * sequences (or null if no exons are found)
+ * @param al
+ * @return an alignment whose sequences are the cds-only parts of the dna
+ * sequences (or null if no mappings are found)
*/
- public static AlignmentI makeExonAlignment(SequenceI[] dna,
- Set<AlignedCodonFrame> mappings)
+ public static AlignmentI makeCdsAlignment(SequenceI[] dna,
+ List<AlignedCodonFrame> mappings, AlignmentI al)
{
- Set<AlignedCodonFrame> newMappings = new LinkedHashSet<AlignedCodonFrame>();
- List<SequenceI> exonSequences = new ArrayList<SequenceI>();
+ List<int[]> cdsColumns = findCdsColumns(dna);
+
+ /*
+ * create CDS sequences and new mappings
+ * (from cdna to cds, and cds to peptide)
+ */
+ List<AlignedCodonFrame> newMappings = new ArrayList<AlignedCodonFrame>();
+ List<SequenceI> cdsSequences = new ArrayList<SequenceI>();
+ char gap = al.getGapCharacter();
for (SequenceI dnaSeq : dna)
{
for (AlignedCodonFrame acf : seqMappings)
{
AlignedCodonFrame newMapping = new AlignedCodonFrame();
- final List<SequenceI> mappedExons = makeExonSequences(ds, acf,
- newMapping);
- if (!mappedExons.isEmpty())
+ final List<SequenceI> mappedCds = makeCdsSequences(dnaSeq, acf,
+ cdsColumns, newMapping, gap);
+ if (!mappedCds.isEmpty())
{
- exonSequences.addAll(mappedExons);
+ cdsSequences.addAll(mappedCds);
newMappings.add(newMapping);
}
}
}
- AlignmentI al = new Alignment(
- exonSequences.toArray(new SequenceI[exonSequences.size()]));
- al.setDataset(null);
+ AlignmentI newAl = new Alignment(
+ cdsSequences.toArray(new SequenceI[cdsSequences.size()]));
+
+ /*
+ * add new sequences to the shared dataset, set it on the new alignment
+ */
+ List<SequenceI> dsseqs = al.getDataset().getSequences();
+ for (SequenceI seq : newAl.getSequences())
+ {
+ if (!dsseqs.contains(seq.getDatasetSequence()))
+ {
+ dsseqs.add(seq.getDatasetSequence());
+ }
+ }
+ newAl.setDataset(al.getDataset());
/*
* Replace the old mappings with the new ones
mappings.clear();
mappings.addAll(newMappings);
- return al;
+ return newAl;
+ }
+
+ /**
+ * Returns a consolidated list of column ranges where at least one sequence
+ * has a CDS feature. This assumes CDS features are on genomic sequence i.e.
+ * are for contiguous CDS ranges (no gaps).
+ *
+ * @param seqs
+ * @return
+ */
+ public static List<int[]> findCdsColumns(SequenceI[] seqs)
+ {
+ // TODO use refactored code from AlignViewController
+ // markColumnsContainingFeatures, not reinvent the wheel!
+
+ List<int[]> result = new ArrayList<int[]>();
+ for (SequenceI seq : seqs)
+ {
+ result.addAll(findCdsColumns(seq));
+ }
+
+ /*
+ * sort and compact the list into ascending, non-overlapping ranges
+ */
+ Collections.sort(result, new Comparator<int[]>()
+ {
+ @Override
+ public int compare(int[] o1, int[] o2)
+ {
+ return Integer.compare(o1[0], o2[0]);
+ }
+ });
+ result = MapList.coalesceRanges(result);
+
+ return result;
+ }
+
+ public static List<int[]> findCdsColumns(SequenceI seq)
+ {
+ List<int[]> result = new ArrayList<int[]>();
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ SequenceFeature[] sfs = seq.getSequenceFeatures();
+ if (sfs != null)
+ {
+ for (SequenceFeature sf : sfs)
+ {
+ if (so.isA(sf.getType(), SequenceOntologyI.CDS))
+ {
+ int colStart = seq.findIndex(sf.getBegin());
+ int colEnd = seq.findIndex(sf.getEnd());
+ result.add(new int[] { colStart, colEnd });
+ }
+ }
+ }
+ return result;
+ }
+
+ /**
+ * Answers true if all sequences have a gap at (or do not extend to) the
+ * specified column position (base 1)
+ *
+ * @param seqs
+ * @param col
+ * @return
+ */
+ public static boolean isGappedColumn(List<SequenceI> seqs, int col)
+ {
+ if (seqs != null)
+ {
+ for (SequenceI seq : seqs)
+ {
+ if (!Comparison.isGap(seq.getCharAt(col - 1)))
+ {
+ return false;
+ }
+ }
+ }
+ return true;
+ }
+
+ /**
+ * Returns the column ranges (base 1) of each aligned sequence that are
+ * involved in any mapping. This is a helper method for aligning protein
+ * products of aligned transcripts.
+ *
+ * @param mappedSequences
+ * (possibly gapped) dna sequences
+ * @param mappings
+ * @return
+ */
+ protected static List<List<int[]>> getMappedColumns(
+ List<SequenceI> mappedSequences, List<AlignedCodonFrame> mappings)
+ {
+ List<List<int[]>> result = new ArrayList<List<int[]>>();
+ for (SequenceI seq : mappedSequences)
+ {
+ List<int[]> columns = new ArrayList<int[]>();
+ List<AlignedCodonFrame> seqMappings = MappingUtils
+ .findMappingsForSequence(seq, mappings);
+ for (AlignedCodonFrame mapping : seqMappings)
+ {
+ List<Mapping> maps = mapping.getMappingsForSequence(seq);
+ for (Mapping map : maps)
+ {
+ /*
+ * Get the codon regions as { [2, 5], [7, 12], [14, 14] etc }
+ * Find and add the overall aligned column range for each
+ */
+ for (int[] cdsRange : map.getMap().getFromRanges())
+ {
+ int startPos = cdsRange[0];
+ int endPos = cdsRange[1];
+ int startCol = seq.findIndex(startPos);
+ int endCol = seq.findIndex(endPos);
+ columns.add(new int[] { startCol, endCol });
+ }
+ }
+ }
+ result.add(columns);
+ }
+ return result;
}
/**
- * Helper method to make exon-only sequences and populate their mappings to
+ * Helper method to make cds-only sequences and populate their mappings to
* protein products
* <p>
* For example, if ggCCaTTcGAg has mappings [3, 4, 6, 7, 9, 10] to protein
* then generate a sequence CCTTGA with mapping [1, 6] to the same protein
* residues
* <p>
- * Typically eukaryotic dna will include exons encoding for a single peptide
+ * Typically eukaryotic dna will include cds encoding for a single peptide
* sequence i.e. return a single result. Bacterial dna may have overlapping
- * exon mappings coding for multiple peptides so return multiple results
+ * cds mappings coding for multiple peptides so return multiple results
* (example EMBL KF591215).
*
* @param dnaSeq
- * a dna dataset sequence
+ * a dna aligned sequence
* @param mapping
* containing one or more mappings of the sequence to protein
- * @param newMapping
- * the new mapping to populate, from the exon-only sequences to their
+ * @param ungappedCdsColumns
+ * @param newMappings
+ * the new mapping to populate, from the cds-only sequences to their
* mapped protein sequences
* @return
*/
- protected static List<SequenceI> makeExonSequences(SequenceI dnaSeq,
- AlignedCodonFrame mapping, AlignedCodonFrame newMapping)
+ protected static List<SequenceI> makeCdsSequences(SequenceI dnaSeq,
+ AlignedCodonFrame mapping, List<int[]> ungappedCdsColumns,
+ AlignedCodonFrame newMappings, char gapChar)
{
- List<SequenceI> exonSequences = new ArrayList<SequenceI>();
+ List<SequenceI> cdsSequences = new ArrayList<SequenceI>();
List<Mapping> seqMappings = mapping.getMappingsForSequence(dnaSeq);
- final char[] dna = dnaSeq.getSequence();
+
for (Mapping seqMapping : seqMappings)
{
- StringBuilder newSequence = new StringBuilder(dnaSeq.getLength());
+ SequenceI cds = makeCdsSequence(dnaSeq, seqMapping,
+ ungappedCdsColumns, gapChar);
+ cds.createDatasetSequence();
+ cdsSequences.add(cds);
/*
- * Get the codon regions as { [2, 5], [7, 12], [14, 14] etc }
+ * add new mappings, from dna to cds, and from cds to peptide
*/
- final List<int[]> dnaExonRanges = seqMapping.getMap().getFromRanges();
- for (int[] range : dnaExonRanges)
+ MapList dnaToCds = addCdsMappings(dnaSeq.getDatasetSequence(), cds,
+ seqMapping, newMappings);
+
+ /*
+ * transfer any features on dna that overlap the CDS
+ */
+ transferFeatures(dnaSeq, cds, dnaToCds, null, SequenceOntologyI.CDS);
+ }
+ return cdsSequences;
+ }
+
+ /**
+ * Transfers co-located features on 'fromSeq' to 'toSeq', adjusting the
+ * feature start/end ranges, optionally omitting specified feature types.
+ * Returns the number of features copied.
+ *
+ * @param fromSeq
+ * @param toSeq
+ * @param select
+ * if not null, only features of this type are copied (including
+ * subtypes in the Sequence Ontology)
+ * @param mapping
+ * the mapping from 'fromSeq' to 'toSeq'
+ * @param omitting
+ */
+ public static int transferFeatures(SequenceI fromSeq, SequenceI toSeq,
+ MapList mapping, String select, String... omitting)
+ {
+ SequenceI copyTo = toSeq;
+ while (copyTo.getDatasetSequence() != null)
+ {
+ copyTo = copyTo.getDatasetSequence();
+ }
+
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ int count = 0;
+ SequenceFeature[] sfs = fromSeq.getSequenceFeatures();
+ if (sfs != null)
+ {
+ for (SequenceFeature sf : sfs)
{
- for (int pos = range[0]; pos <= range[1]; pos++)
+ String type = sf.getType();
+ if (select != null && !so.isA(type, select))
{
- newSequence.append(dna[pos - 1]);
+ continue;
+ }
+ boolean omit = false;
+ for (String toOmit : omitting)
+ {
+ if (type.equals(toOmit))
+ {
+ omit = true;
+ }
+ }
+ if (omit)
+ {
+ continue;
+ }
+
+ /*
+ * locate the mapped range - null if either start or end is
+ * not mapped (no partial overlaps are calculated)
+ */
+ int start = sf.getBegin();
+ int end = sf.getEnd();
+ int[] mappedTo = mapping.locateInTo(start, end);
+ /*
+ * if whole exon range doesn't map, try interpreting it
+ * as 5' or 3' exon overlapping the CDS range
+ */
+ if (mappedTo == null)
+ {
+ mappedTo = mapping.locateInTo(end, end);
+ if (mappedTo != null)
+ {
+ /*
+ * end of exon is in CDS range - 5' overlap
+ * to a range from the start of the peptide
+ */
+ mappedTo[0] = 1;
+ }
+ }
+ if (mappedTo == null)
+ {
+ mappedTo = mapping.locateInTo(start, start);
+ if (mappedTo != null)
+ {
+ /*
+ * start of exon is in CDS range - 3' overlap
+ * to a range up to the end of the peptide
+ */
+ mappedTo[1] = toSeq.getLength();
+ }
+ }
+ if (mappedTo != null)
+ {
+ SequenceFeature copy = new SequenceFeature(sf);
+ copy.setBegin(Math.min(mappedTo[0], mappedTo[1]));
+ copy.setEnd(Math.max(mappedTo[0], mappedTo[1]));
+ copyTo.addSequenceFeature(copy);
+ count++;
}
}
+ }
+ return count;
+ }
- SequenceI exon = new Sequence(dnaSeq.getName(),
- newSequence.toString());
+ /**
+ * Creates and adds mappings
+ * <ul>
+ * <li>from cds to peptide</li>
+ * <li>from dna to cds</li>
+ * </ul>
+ * and returns the dna-to-cds mapping
+ *
+ * @param dnaSeq
+ * @param cdsSeq
+ * @param dnaMapping
+ * @param newMappings
+ * @return
+ */
+ protected static MapList addCdsMappings(SequenceI dnaSeq,
+ SequenceI cdsSeq, Mapping dnaMapping,
+ AlignedCodonFrame newMappings)
+ {
+ cdsSeq.createDatasetSequence();
- /*
- * Locate any xrefs to CDS database on the protein product and attach to
- * the CDS sequence. Also add as a sub-token of the sequence name.
- */
- // default to "CDS" if we can't locate an actual gene id
- String cdsAccId = FeatureProperties
- .getCodingFeature(DBRefSource.EMBL);
- DBRefEntry[] cdsRefs = DBRefUtils.selectRefs(seqMapping.getTo()
- .getDBRefs(), DBRefSource.CODINGDBS);
- if (cdsRefs != null)
+ /*
+ * CDS to peptide is just a contiguous 3:1 mapping, with
+ * the peptide ranges taken unchanged from the dna mapping
+ */
+ List<int[]> cdsRanges = new ArrayList<int[]>();
+ SequenceI cdsDataset = cdsSeq.getDatasetSequence();
+ cdsRanges.add(new int[] { 1, cdsDataset.getLength() });
+ MapList cdsToPeptide = new MapList(cdsRanges, dnaMapping.getMap()
+ .getToRanges(), 3, 1);
+ newMappings.addMap(cdsDataset, dnaMapping.getTo(), cdsToPeptide);
+
+ /*
+ * dna 'from' ranges map 1:1 to the contiguous extracted CDS
+ */
+ MapList dnaToCds = new MapList(dnaMapping.getMap().getFromRanges(),
+ cdsRanges, 1, 1);
+ newMappings.addMap(dnaSeq, cdsDataset, dnaToCds);
+ return dnaToCds;
+ }
+
+ /**
+ * Makes and returns a CDS-only sequence, where the CDS regions are identified
+ * as the 'from' ranges of the mapping on the dna.
+ *
+ * @param dnaSeq
+ * nucleotide sequence
+ * @param seqMapping
+ * mappings from CDS regions of nucleotide
+ * @param ungappedCdsColumns
+ * @return
+ */
+ protected static SequenceI makeCdsSequence(SequenceI dnaSeq,
+ Mapping seqMapping, List<int[]> ungappedCdsColumns, char gapChar)
+ {
+ int cdsWidth = MappingUtils.getLength(ungappedCdsColumns);
+
+ /*
+ * populate CDS columns with the aligned
+ * column character if that column is mapped (which may be a gap
+ * if an intron interrupts a codon), else with a gap
+ */
+ List<int[]> fromRanges = seqMapping.getMap().getFromRanges();
+ char[] cdsChars = new char[cdsWidth];
+ int pos = 0;
+ for (int[] columns : ungappedCdsColumns)
+ {
+ for (int i = columns[0]; i <= columns[1]; i++)
{
- for (DBRefEntry cdsRef : cdsRefs)
+ char dnaChar = dnaSeq.getCharAt(i - 1);
+ if (Comparison.isGap(dnaChar))
{
- exon.addDBRef(new DBRefEntry(cdsRef));
- cdsAccId = cdsRef.getAccessionId();
+ cdsChars[pos] = gapChar;
+ }
+ else
+ {
+ int seqPos = dnaSeq.findPosition(i - 1);
+ if (MappingUtils.contains(fromRanges, seqPos))
+ {
+ cdsChars[pos] = dnaChar;
+ }
+ else
+ {
+ cdsChars[pos] = gapChar;
+ }
}
+ pos++;
}
- exon.setName(exon.getName() + "|" + cdsAccId);
- exon.createDatasetSequence();
+ }
+ SequenceI cdsSequence = new Sequence(dnaSeq.getName(),
+ String.valueOf(cdsChars));
+
+ transferDbRefs(seqMapping.getTo(), cdsSequence);
+
+ return cdsSequence;
+ }
+
+ /**
+ * Locate any xrefs to CDS databases on the protein product and attach to the
+ * CDS sequence. Also add as a sub-token of the sequence name.
+ *
+ * @param from
+ * @param to
+ */
+ protected static void transferDbRefs(SequenceI from, SequenceI to)
+ {
+ String cdsAccId = FeatureProperties.getCodingFeature(DBRefSource.EMBL);
+ DBRefEntry[] cdsRefs = DBRefUtils.selectRefs(from.getDBRefs(),
+ DBRefSource.CODINGDBS);
+ if (cdsRefs != null)
+ {
+ for (DBRefEntry cdsRef : cdsRefs)
+ {
+ to.addDBRef(new DBRefEntry(cdsRef));
+ cdsAccId = cdsRef.getAccessionId();
+ }
+ }
+ if (!to.getName().contains(cdsAccId))
+ {
+ to.setName(to.getName() + "|" + cdsAccId);
+ }
+ }
+ /**
+ * Returns a mapping from dna to protein by inspecting sequence features of
+ * type "CDS" on the dna.
+ *
+ * @param dnaSeq
+ * @param proteinSeq
+ * @return
+ */
+ public static MapList mapCdsToProtein(SequenceI dnaSeq,
+ SequenceI proteinSeq)
+ {
+ List<int[]> ranges = findCdsPositions(dnaSeq);
+ int mappedDnaLength = MappingUtils.getLength(ranges);
+
+ int proteinLength = proteinSeq.getLength();
+ int proteinStart = proteinSeq.getStart();
+ int proteinEnd = proteinSeq.getEnd();
+
+ /*
+ * incomplete start codon may mean X at start of peptide
+ * we ignore both for mapping purposes
+ */
+ if (proteinSeq.getCharAt(0) == 'X')
+ {
+ // todo JAL-2022 support startPhase > 0
+ proteinStart++;
+ proteinLength--;
+ }
+ List<int[]> proteinRange = new ArrayList<int[]>();
+
+ /*
+ * dna length should map to protein (or protein plus stop codon)
+ */
+ int codesForResidues = mappedDnaLength / 3;
+ if (codesForResidues == (proteinLength + 1))
+ {
+ // assuming extra codon is for STOP and not in peptide
+ codesForResidues--;
+ }
+ if (codesForResidues == proteinLength)
+ {
+ proteinRange.add(new int[] { proteinStart, proteinEnd });
+ return new MapList(ranges, proteinRange, 3, 1);
+ }
+ return null;
+ }
+
+ /**
+ * Returns a list of CDS ranges found (as sequence positions base 1), i.e. of
+ * start/end positions of sequence features of type "CDS" (or a sub-type of
+ * CDS in the Sequence Ontology)
+ *
+ * @param dnaSeq
+ * @return
+ */
+ public static List<int[]> findCdsPositions(SequenceI dnaSeq)
+ {
+ List<int[]> result = new ArrayList<int[]>();
+ SequenceFeature[] sfs = dnaSeq.getSequenceFeatures();
+ if (sfs == null)
+ {
+ return result;
+ }
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ for (SequenceFeature sf : sfs)
+ {
/*
- * Build new mappings - from the same protein regions, but now to
- * contiguous exons
+ * process a CDS feature (or a sub-type of CDS)
*/
- List<int[]> exonRange = new ArrayList<int[]>();
- exonRange.add(new int[] { 1, newSequence.length() });
- MapList map = new MapList(exonRange, seqMapping.getMap()
- .getToRanges(), 3, 1);
- newMapping.addMap(exon.getDatasetSequence(), seqMapping.getTo(), map);
- MapList cdsToDnaMap = new MapList(dnaExonRanges, exonRange, 1, 1);
- newMapping.addMap(dnaSeq, exon.getDatasetSequence(), cdsToDnaMap);
+ if (so.isA(sf.getType(), SequenceOntologyI.CDS))
+ {
+ int phase = 0;
+ try {
+ phase = Integer.parseInt(sf.getPhase());
+ } catch (NumberFormatException e)
+ {
+ // ignore
+ }
+ /*
+ * phase > 0 on first codon means 5' incomplete - skip to the start
+ * of the next codon; example ENST00000496384
+ */
+ int begin = sf.getBegin();
+ int end = sf.getEnd();
+ if (result.isEmpty())
+ {
+ // TODO JAL-2022 support start phase > 0
+ begin += phase;
+ if (begin > end)
+ {
+ continue; // shouldn't happen?
+ }
+ }
+ result.add(new int[] { begin, end });
+ }
+ }
+ return result;
+ }
+
+ /**
+ * Maps exon features from dna to protein, and computes variants in peptide
+ * product generated by variants in dna, and adds them as sequence_variant
+ * features on the protein sequence. Returns the number of variant features
+ * added.
+ *
+ * @param dnaSeq
+ * @param peptide
+ * @param dnaToProtein
+ */
+ public static int computeProteinFeatures(SequenceI dnaSeq,
+ SequenceI peptide, MapList dnaToProtein)
+ {
+ while (dnaSeq.getDatasetSequence() != null)
+ {
+ dnaSeq = dnaSeq.getDatasetSequence();
+ }
+ while (peptide.getDatasetSequence() != null)
+ {
+ peptide = peptide.getDatasetSequence();
+ }
+
+ transferFeatures(dnaSeq, peptide, dnaToProtein,
+ SequenceOntologyI.EXON);
+
+ LinkedHashMap<Integer, String[][]> variants = buildDnaVariantsMap(
+ dnaSeq, dnaToProtein);
+
+ /*
+ * scan codon variations, compute peptide variants and add to peptide sequence
+ */
+ int count = 0;
+ for (Entry<Integer, String[][]> variant : variants.entrySet())
+ {
+ int peptidePos = variant.getKey();
+ String[][] codonVariants = variant.getValue();
+ String residue = String.valueOf(peptide.getCharAt(peptidePos - 1)); // 0-based
+ List<String> peptideVariants = computePeptideVariants(codonVariants,
+ residue);
+ if (!peptideVariants.isEmpty())
+ {
+ String desc = StringUtils.listToDelimitedString(peptideVariants,
+ ", ");
+ SequenceFeature sf = new SequenceFeature(
+ SequenceOntologyI.SEQUENCE_VARIANT, desc, peptidePos,
+ peptidePos, 0f, null);
+ peptide.addSequenceFeature(sf);
+ count++;
+ }
+ }
+
+ /*
+ * ugly sort to get sequence features in start position order
+ * - would be better to store in Sequence as a TreeSet instead?
+ */
+ Arrays.sort(peptide.getSequenceFeatures(),
+ new Comparator<SequenceFeature>()
+ {
+ @Override
+ public int compare(SequenceFeature o1, SequenceFeature o2)
+ {
+ int c = Integer.compare(o1.getBegin(), o2.getBegin());
+ return c == 0 ? Integer.compare(o1.getEnd(), o2.getEnd())
+ : c;
+ }
+ });
+ return count;
+ }
+
+ /**
+ * Builds a map whose key is position in the protein sequence, and value is an
+ * array of all variants for the coding codon positions
+ *
+ * @param dnaSeq
+ * @param dnaToProtein
+ * @return
+ */
+ static LinkedHashMap<Integer, String[][]> buildDnaVariantsMap(
+ SequenceI dnaSeq, MapList dnaToProtein)
+ {
+ /*
+ * map from peptide position to all variant features of the codon for it
+ * LinkedHashMap ensures we add the peptide features in sequence order
+ */
+ LinkedHashMap<Integer, String[][]> variants = new LinkedHashMap<Integer, String[][]>();
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+
+ SequenceFeature[] dnaFeatures = dnaSeq.getSequenceFeatures();
+ if (dnaFeatures == null)
+ {
+ return variants;
+ }
+
+ int dnaStart = dnaSeq.getStart();
+ int[] lastCodon = null;
+ int lastPeptidePostion = 0;
+
+ /*
+ * build a map of codon variations for peptides
+ */
+ for (SequenceFeature sf : dnaFeatures)
+ {
+ int dnaCol = sf.getBegin();
+ if (dnaCol != sf.getEnd())
+ {
+ // not handling multi-locus variant features
+ continue;
+ }
+ if (so.isA(sf.getType(), SequenceOntologyI.SEQUENCE_VARIANT))
+ {
+ int[] mapsTo = dnaToProtein.locateInTo(dnaCol, dnaCol);
+ if (mapsTo == null)
+ {
+ // feature doesn't lie within coding region
+ continue;
+ }
+ int peptidePosition = mapsTo[0];
+ String[][] codonVariants = variants.get(peptidePosition);
+ if (codonVariants == null)
+ {
+ codonVariants = new String[3][];
+ variants.put(peptidePosition, codonVariants);
+ }
+
+ /*
+ * extract dna variants to a string array
+ */
+ String alls = (String) sf.getValue("alleles");
+ if (alls == null)
+ {
+ continue;
+ }
+ String[] alleles = alls.toUpperCase().split(",");
+ int i = 0;
+ for (String allele : alleles)
+ {
+ alleles[i++] = allele.trim(); // lose any space characters "A, G"
+ }
+
+ /*
+ * get this peptide's codon positions e.g. [3, 4, 5] or [4, 7, 10]
+ */
+ int[] codon = peptidePosition == lastPeptidePostion ? lastCodon
+ : MappingUtils.flattenRanges(dnaToProtein.locateInFrom(
+ peptidePosition, peptidePosition));
+ lastPeptidePostion = peptidePosition;
+ lastCodon = codon;
+
+ /*
+ * save nucleotide (and this variant) for each codon position
+ */
+ for (int codonPos = 0; codonPos < 3; codonPos++)
+ {
+ String nucleotide = String.valueOf(
+ dnaSeq.getCharAt(codon[codonPos] - dnaStart))
+ .toUpperCase();
+ if (codonVariants[codonPos] == null)
+ {
+ /*
+ * record current dna base
+ */
+ codonVariants[codonPos] = new String[] { nucleotide };
+ }
+ if (codon[codonPos] == dnaCol)
+ {
+ /*
+ * add alleles to dna base (and any previously found alleles)
+ */
+ String[] known = codonVariants[codonPos];
+ String[] dnaVariants = new String[alleles.length + known.length];
+ System.arraycopy(known, 0, dnaVariants, 0, known.length);
+ System.arraycopy(alleles, 0, dnaVariants, known.length,
+ alleles.length);
+ codonVariants[codonPos] = dnaVariants;
+ }
+ }
+ }
+ }
+ return variants;
+ }
- exonSequences.add(exon);
+ /**
+ * Returns a sorted, non-redundant list of all peptide translations generated
+ * by the given dna variants, excluding the current residue value
+ *
+ * @param codonVariants
+ * an array of base values (acgtACGT) for codon positions 1, 2, 3
+ * @param residue
+ * the current residue translation
+ * @return
+ */
+ static List<String> computePeptideVariants(
+ String[][] codonVariants, String residue)
+ {
+ List<String> result = new ArrayList<String>();
+ for (String base1 : codonVariants[0])
+ {
+ for (String base2 : codonVariants[1])
+ {
+ for (String base3 : codonVariants[2])
+ {
+ String codon = base1 + base2 + base3;
+ /*
+ * get peptide translation of codon e.g. GAT -> D
+ * note that variants which are not single alleles,
+ * e.g. multibase variants or HGMD_MUTATION etc
+ * are ignored here
+ */
+ String peptide = codon.contains("-") ? "-"
+ : (codon.length() > 3 ? null : ResidueProperties
+ .codonTranslate(codon));
+ if (peptide != null && !result.contains(peptide)
+ && !peptide.equalsIgnoreCase(residue))
+ {
+ result.add(peptide);
+ }
+ }
+ }
}
- return exonSequences;
+
+ /*
+ * sort alphabetically with STOP at the end
+ */
+ Collections.sort(result, new Comparator<String>()
+ {
+
+ @Override
+ public int compare(String o1, String o2)
+ {
+ if ("STOP".equals(o1))
+ {
+ return 1;
+ }
+ else if ("STOP".equals(o2))
+ {
+ return -1;
+ }
+ else
+ {
+ return o1.compareTo(o2);
+ }
+ }
+ });
+ return result;
}
}
import jalview.datamodel.AlignmentI;
import jalview.datamodel.DBRefEntry;
import jalview.datamodel.DBRefSource;
+import jalview.datamodel.Mapping;
import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
import jalview.util.DBRefUtils;
+import jalview.util.MapList;
import jalview.ws.SequenceFetcher;
import jalview.ws.seqfetcher.ASequenceFetcher;
*/
public class CrossRef
{
+ /*
+ * A sub-class that ignores Parent attribute when comparing sequence
+ * features. This avoids 'duplicate' CDS features that only
+ * differ in their parent Transcript ids.
+ */
+ class MySequenceFeature extends SequenceFeature
+ {
+ private SequenceFeature feat;
+
+ MySequenceFeature(SequenceFeature sf)
+ {
+ this.feat = sf;
+ }
+
+ @Override
+ public boolean equals(Object o)
+ {
+ return feat.equals(o, true);
+ }
+ }
+
/**
* Select just the DNA or protein references for a protein or dna sequence
*
{
String[] dbrefs = null;
List<String> refs = new ArrayList<String>();
- for (int s = 0; s < seqs.length; s++)
+ for (SequenceI seq : seqs)
{
- if (seqs[s] != null)
+ if (seq != null)
{
- SequenceI dss = seqs[s];
+ SequenceI dss = seq;
while (dss.getDatasetSequence() != null)
{
dss = dss.getDatasetSequence();
}
DBRefEntry[] rfs = findXDbRefs(dna, dss.getDBRefs());
- for (int r = 0; rfs != null && r < rfs.length; r++)
+ if (rfs != null)
{
- if (!refs.contains(rfs[r].getSource()))
+ for (DBRefEntry ref : rfs)
{
- refs.add(rfs[r].getSource());
+ if (!refs.contains(ref.getSource()))
+ {
+ refs.add(ref.getSource());
+ }
}
}
if (dataset != null)
{
// search for references to this sequence's direct references.
- DBRefEntry[] lrfs = CrossRef
- .findXDbRefs(!dna, seqs[s].getDBRefs());
+ DBRefEntry[] lrfs = CrossRef.findXDbRefs(!dna, seq.getDBRefs());
List<SequenceI> rseqs = new ArrayList<SequenceI>();
- CrossRef.searchDatasetXrefs(seqs[s], !dna, lrfs, dataset, rseqs,
+ CrossRef.searchDatasetXrefs(seq, !dna, lrfs, dataset, rseqs,
null); // don't need to specify codon frame for mapping here
for (SequenceI rs : rseqs)
{
- DBRefEntry[] xrs = findXDbRefs(dna, rs.getDBRefs()); // not used??
- for (int r = 0; rfs != null && r < rfs.length; r++)
+ DBRefEntry[] xrs = findXDbRefs(dna, rs.getDBRefs());
+ if (xrs != null)
{
- if (!refs.contains(rfs[r].getSource()))
+ for (DBRefEntry ref : xrs)
{
- refs.add(rfs[r].getSource());
+ if (!refs.contains(ref.getSource()))
+ {
+ refs.add(ref.getSource());
+ }
}
}
+ // looks like copy and paste - change rfs to xrs?
+ // for (int r = 0; rfs != null && r < rfs.length; r++)
+ // {
+ // if (!refs.contains(rfs[r].getSource()))
+ // {
+ // refs.add(rfs[r].getSource());
+ // }
+ // }
}
}
}
return dbrefs;
}
- /*
- * if (dna) { if (rfs[r].hasMap()) { // most likely this is a protein cross
- * reference if (!refs.contains(rfs[r].getSource())) {
- * refs.addElement(rfs[r].getSource()); } } }
- */
public static boolean hasCdnaMap(SequenceI[] seqs)
{
+ // TODO unused - remove?
String[] reftypes = findSequenceXrefTypes(false, seqs);
for (int s = 0; s < reftypes.length; s++)
{
public static SequenceI[] getCdnaMap(SequenceI[] seqs)
{
+ // TODO unused - remove?
Vector cseqs = new Vector();
for (int s = 0; s < seqs.length; s++)
{
/**
*
- * @param dna
- * @param seqs
- * @return
- */
- public static Alignment findXrefSequences(SequenceI[] seqs, boolean dna,
- String source)
- {
- return findXrefSequences(seqs, dna, source, null);
- }
-
- /**
- *
* @param seqs
+ * sequences whose xrefs are being retrieved
* @param dna
+ * true if sequences are nucleotide
* @param source
- * @param dataset
- * alignment to search for product sequences.
+ * @param al
+ * alignment to search for cross-referenced sequences (and possibly
+ * add to)
+ * @param addedPeers
+ * a list of sequences to add to if 'peers' to the original sequences
+ * are found e.g. alternative protein products for a protein's gene
* @return products (as dataset sequences)
*/
- public static Alignment findXrefSequences(SequenceI[] seqs, boolean dna,
- String source, AlignmentI dataset)
+ public static Alignment findXrefSequences(SequenceI[] seqs,
+ final boolean dna, final String source, AlignmentI al,
+ List<SequenceI> addedPeers)
{
+ AlignmentI dataset = al.getDataset() == null ? al : al.getDataset();
List<SequenceI> rseqs = new ArrayList<SequenceI>();
- Alignment ral = null;
- AlignedCodonFrame cf = new AlignedCodonFrame(); // nominal width
- for (int s = 0; s < seqs.length; s++)
+ AlignedCodonFrame cf = new AlignedCodonFrame();
+ for (SequenceI seq : seqs)
{
- SequenceI dss = seqs[s];
+ SequenceI dss = seq;
while (dss.getDatasetSequence() != null)
{
dss = dss.getDatasetSequence();
if ((xrfs == null || xrfs.length == 0) && dataset != null)
{
System.out.println("Attempting to find ds Xrefs refs.");
- DBRefEntry[] lrfs = CrossRef.findXDbRefs(!dna, seqs[s].getDBRefs());
+ // FIXME should be dss not seq here?
+ DBRefEntry[] lrfs = CrossRef.findXDbRefs(!dna, seq.getDBRefs());
// less ambiguous would be a 'find primary dbRefEntry' method.
// filter for desired source xref here
found = CrossRef.searchDatasetXrefs(dss, !dna, lrfs, dataset,
}
for (int r = 0; xrfs != null && r < xrfs.length; r++)
{
- if (source != null && !source.equals(xrfs[r].getSource()))
+ DBRefEntry xref = xrfs[r];
+ if (source != null && !source.equals(xref.getSource()))
{
continue;
}
- if (xrfs[r].hasMap())
+ if (xref.hasMap())
{
- if (xrfs[r].getMap().getTo() != null)
+ if (xref.getMap().getTo() != null)
{
- SequenceI rsq = new Sequence(xrfs[r].getMap().getTo());
+ SequenceI rsq = new Sequence(xref.getMap().getTo());
rseqs.add(rsq);
- if (xrfs[r].getMap().getMap().getFromRatio() != xrfs[r]
+ if (xref.getMap().getMap().getFromRatio() != xref
.getMap().getMap().getToRatio())
{
// get sense of map correct for adding to product alignment.
if (dna)
{
// map is from dna seq to a protein product
- cf.addMap(dss, rsq, xrfs[r].getMap().getMap());
+ cf.addMap(dss, rsq, xref.getMap().getMap());
}
else
{
// map should be from protein seq to its coding dna
- cf.addMap(rsq, dss, xrfs[r].getMap().getMap().getInverse());
+ cf.addMap(rsq, dss, xref.getMap().getMap().getInverse());
}
}
found = true;
// xrefs on this sequence.
if (dataset != null)
{
- found |= searchDataset(dss, xrfs[r], dataset, rseqs, cf); // ,false,!dna);
+ found |= searchDataset(dss, xref, dataset, rseqs, cf, false,
+ !dna);
+ // ,false,!dna);
if (found)
{
xrfs[r] = null; // we've recovered seqs for this one.
xrfs = t;
try
{
- retrieved = sftch.getSequences(xrfs); // problem here is we don't
- // know which of xrfs
- // resulted in which
+ retrieved = sftch.getSequences(xrfs, !dna);
+ // problem here is we don't know which of xrfs resulted in which
// retrieved element
} catch (Exception e)
{
System.err
.println("Problem whilst retrieving cross references for Sequence : "
- + seqs[s].getName());
+ + seq.getName());
e.printStackTrace();
}
+
if (retrieved != null)
{
+ updateDbrefMappings(dna, seq, xrfs, retrieved, cf);
+
+ List<SequenceFeature> copiedFeatures = new ArrayList<SequenceFeature>();
+ CrossRef me = new CrossRef();
for (int rs = 0; rs < retrieved.length; rs++)
{
// TODO: examine each sequence for 'redundancy'
- jalview.datamodel.DBRefEntry[] dbr = retrieved[rs]
- .getDBRefs();
+ DBRefEntry[] dbr = retrieved[rs].getDBRefs();
if (dbr != null && dbr.length > 0)
{
for (int di = 0; di < dbr.length; di++)
{
// find any entry where we should put in the sequence being
// cross-referenced into the map
- jalview.datamodel.Mapping map = dbr[di].getMap();
+ Mapping map = dbr[di].getMap();
if (map != null)
{
if (map.getTo() != null && map.getMap() != null)
int sf = map.getMap().getToLowest();
int st = map.getMap().getToHighest();
SequenceI mappedrg = ms.getSubSequence(sf, st);
- SequenceI loc = dss.getSubSequence(sf, st);
+ // SequenceI loc = dss.getSubSequence(sf, st);
if (mappedrg.getLength() > 0
- && mappedrg.getSequenceAsString().equals(
- loc.getSequenceAsString()))
+ && ms.getSequenceAsString().equals(
+ dss.getSequenceAsString()))
+ // && mappedrg.getSequenceAsString().equals(
+ // loc.getSequenceAsString()))
{
- System.err
- .println("Mapping updated for retrieved crossreference");
+ String msg = "Mapping updated from "
+ + ms.getName()
+ + " to retrieved crossreference "
+ + dss.getName();
+ System.out.println(msg);
// method to update all refs of existing To on
// retrieved sequence with dss and merge any props
// on To onto dss.
map.setTo(dss);
+ /*
+ * copy sequence features as well, avoiding
+ * duplication (e.g. from 2 transcripts)
+ */
+ SequenceFeature[] sfs = ms
+ .getSequenceFeatures();
+ if (sfs != null)
+ {
+ for (SequenceFeature feat : sfs)
+ {
+ /*
+ * we override SequenceFeature.equals here (but
+ * not elsewhere) to ignore Parent attribute
+ * TODO not quite working yet!
+ */
+ if (!copiedFeatures
+ .contains(me.new MySequenceFeature(
+ feat)))
+ {
+ dss.addSequenceFeature(feat);
+ copiedFeatures.add(feat);
+ }
+ }
+ }
+ cf.addMap(retrieved[rs].getDatasetSequence(),
+ dss, map.getMap());
+ }
+ else
+ {
+ addedPeers.add(map.getTo());
+ cf.addMap(retrieved[rs].getDatasetSequence(),
+ map.getTo(), map.getMap());
}
} catch (Exception e)
{
}
}
}
+
+ Alignment ral = null;
if (rseqs.size() > 0)
{
- SequenceI[] rsqs = new SequenceI[rseqs.size()];
- rseqs.toArray(rsqs);
- ral = new Alignment(rsqs);
- if (cf != null && cf.getProtMappings() != null)
+ ral = new Alignment(rseqs.toArray(new SequenceI[rseqs.size()]));
+ if (cf != null && !cf.isEmpty())
{
ral.addCodonFrame(cf);
}
}
/**
+ * Updates any empty mappings in the cross-references with one to a compatible
+ * retrieved sequence if found, and adds any new mappings to the
+ * AlignedCodonFrame
+ *
+ * @param dna
+ * @param mapFrom
+ * @param xrefs
+ * @param retrieved
+ * @param acf
+ */
+ static void updateDbrefMappings(boolean dna, SequenceI mapFrom,
+ DBRefEntry[] xrefs, SequenceI[] retrieved, AlignedCodonFrame acf)
+ {
+ SequenceIdMatcher matcher = new SequenceIdMatcher(retrieved);
+ for (DBRefEntry xref : xrefs)
+ {
+ if (!xref.hasMap())
+ {
+ String targetSeqName = xref.getSource() + "|"
+ + xref.getAccessionId();
+ SequenceI[] matches = matcher.findAllIdMatches(targetSeqName);
+ if (matches == null)
+ {
+ return;
+ }
+ for (SequenceI seq : matches)
+ {
+ MapList mapping = null;
+ if (dna)
+ {
+ mapping = AlignmentUtils.mapCdnaToProtein(seq, mapFrom);
+ }
+ else
+ {
+ mapping = AlignmentUtils.mapCdnaToProtein(mapFrom, seq);
+ if (mapping != null)
+ {
+ mapping = mapping.getInverse();
+ }
+ }
+ if (mapping != null)
+ {
+ xref.setMap(new Mapping(seq, mapping));
+ if (dna)
+ {
+ AlignmentUtils.computeProteinFeatures(mapFrom, seq, mapping);
+ }
+ if (dna)
+ {
+ acf.addMap(mapFrom, seq, mapping);
+ }
+ else
+ {
+ acf.addMap(seq, mapFrom, mapping.getInverse());
+ }
+ continue;
+ }
+ }
+ }
+ }
+ }
+
+ /**
* find references to lrfs in the cross-reference set of each sequence in
* dataset (that is not equal to sequenceI) Identifies matching DBRefEntry
* based on source and accession string only - Map and Version are nulled.
}
}
}
+
+ /**
+ * Returns an alignment consisting of the reversed (and optionally
+ * complemented) sequences set in this object's constructor
+ *
+ * @param complement
+ * @return
+ */
+ public AlignmentI reverseCdna(boolean complement)
+ {
+ int sSize = selection.size();
+ List<SequenceI> reversed = new ArrayList<SequenceI>();
+ for (int s = 0; s < sSize; s++)
+ {
+ SequenceI newseq = reverseSequence(selection.get(s).getName(),
+ seqstring[s], complement);
+
+ if (newseq != null)
+ {
+ reversed.add(newseq);
+ }
+ }
+
+ SequenceI[] newseqs = reversed.toArray(new SequenceI[reversed.size()]);
+ AlignmentI al = new Alignment(newseqs);
+ ((Alignment) al).createDatasetAlignment();
+ return al;
+ }
+
+ /**
+ * Returns a reversed, and optionally complemented, sequence. The new
+ * sequence's name is the original name with "|rev" or "|revcomp" appended.
+ * aAcCgGtT and DNA ambiguity codes are complemented, any other characters are
+ * left unchanged.
+ *
+ * @param seq
+ * @param complement
+ * @return
+ */
+ public static SequenceI reverseSequence(String seqName, String sequence,
+ boolean complement)
+ {
+ String newName = seqName + "|rev" + (complement ? "comp" : "");
+ char[] originalSequence = sequence.toCharArray();
+ int length = originalSequence.length;
+ char[] reversedSequence = new char[length];
+
+ for (int i = 0; i < length; i++)
+ {
+ reversedSequence[length - i - 1] = complement ? getComplement(originalSequence[i])
+ : originalSequence[i];
+ }
+ SequenceI reversed = new Sequence(newName, reversedSequence, 1, length);
+ return reversed;
+ }
+
+ /**
+ * Returns dna complement (preserving case) for aAcCgGtTuU. Ambiguity codes
+ * are treated as on http://reverse-complement.com/. Anything else is left
+ * unchanged.
+ *
+ * @param c
+ * @return
+ */
+ public static char getComplement(char c)
+ {
+ char result = c;
+ switch (c) {
+ case 'a':
+ result = 't';
+ break;
+ case 'A':
+ result = 'T';
+ break;
+ case 'c':
+ result = 'g';
+ break;
+ case 'C':
+ result = 'G';
+ break;
+ case 'g':
+ result = 'c';
+ break;
+ case 'G':
+ result = 'C';
+ break;
+ case 't':
+ result = 'a';
+ break;
+ case 'T':
+ result = 'A';
+ break;
+ case 'u':
+ result = 'a';
+ break;
+ case 'U':
+ result = 'A';
+ break;
+ case 'r':
+ result = 'y';
+ break;
+ case 'R':
+ result = 'Y';
+ break;
+ case 'y':
+ result = 'r';
+ break;
+ case 'Y':
+ result = 'R';
+ break;
+ case 'k':
+ result = 'm';
+ break;
+ case 'K':
+ result = 'M';
+ break;
+ case 'm':
+ result = 'k';
+ break;
+ case 'M':
+ result = 'K';
+ break;
+ case 'b':
+ result = 'v';
+ break;
+ case 'B':
+ result = 'V';
+ break;
+ case 'v':
+ result = 'b';
+ break;
+ case 'V':
+ result = 'B';
+ break;
+ case 'd':
+ result = 'h';
+ break;
+ case 'D':
+ result = 'H';
+ break;
+ case 'h':
+ result = 'd';
+ break;
+ case 'H':
+ result = 'D';
+ break;
+ }
+
+ return result;
+ }
}
}
if (s instanceof SeqIdName)
{
- return this.equals((SeqIdName) s);
+ return this.equals(((SeqIdName) s).id);
}
else
{
* todo: (JBPNote) Set separator characters appropriately
*
* @param s
- * SeqIdName
* @return boolean
*/
- public boolean equals(SeqIdName s)
- {
- // TODO: JAL-732 patch for cases when name includes a list of IDs, and the
- // match contains one ID flanked
- if (id.length() > s.id.length())
- {
- return id.startsWith(s.id) ? (WORD_SEP.indexOf(id.charAt(s.id
- .length())) > -1) : false;
- }
- else
- {
- return s.id.startsWith(id) ? (s.id.equals(id) ? true : (WORD_SEP
- .indexOf(s.id.charAt(id.length())) > -1)) : false;
- }
- }
-
public boolean equals(String s)
{
if (id.length() > s.length())
import jalview.util.Comparison;
import java.util.ArrayList;
-import java.util.Arrays;
import java.util.Hashtable;
import java.util.List;
public float[][] findDistances(AlignmentView seqData)
{
int nofeats = 0;
- List<String> dft = Arrays.asList(fr.getDisplayedFeatureTypes());
+ List<String> dft = fr.getDisplayedFeatureTypes();
- if (dft != null)
- {
- nofeats = dft.size();
- }
+ nofeats = dft.size();
SequenceI[] sequenceString = seqData.getVisibleAlignment(
Comparison.GapChars.charAt(0)).getSequencesArray();
return true;
}
+ @Override
public String toString()
{
return "Score between sequences based on hamming distance between binary vectors marking features displayed at each column";
*/
package jalview.api;
+import java.util.List;
+
/**
* prototype abstract controller for a Jalview alignment view
*
* @param typ
* list of feature names or null to use currently displayed features
*/
- void sortAlignmentByFeatureScore(String[] typ);
+ void sortAlignmentByFeatureScore(List<String> typ);
/**
* sort the alignment or current selection by distribution of the given set of
* @param typ
* list of feature names or null to use currently displayed features
*/
- void sortAlignmentByFeatureDensity(String[] typ);
+ void sortAlignmentByFeatureDensity(List<String> typ);
/**
* add a features file of some kind to the current view
--- /dev/null
+package jalview.api;
+
+import java.awt.Color;
+
+public interface FeatureColourI
+{
+
+ /**
+ * Answers true when either isColourByLabel, isAboveThreshold or
+ * isBelowThreshold answers true
+ *
+ * @return
+ */
+ boolean isGraduatedColour();
+
+ /**
+ * Returns the feature colour (when isGraduatedColour answers false)
+ *
+ * @return
+ */
+ Color getColour();
+
+ /**
+ * Returns the minimum colour (when isGraduatedColour answers true)
+ *
+ * @return
+ */
+ Color getMinColour();
+
+ /**
+ * Returns the maximum colour (when isGraduatedColour answers true)
+ *
+ * @return
+ */
+ Color getMaxColour();
+
+ /**
+ * Answers true if the feature is coloured by label (description); only
+ * applicable when isGraduatedColour answers true
+ *
+ * @return
+ */
+ boolean isColourByLabel();
+
+ /**
+ * Answers true if the feature is coloured below a threshold value; only
+ * applicable when isGraduatedColour answers true
+ *
+ * @return
+ */
+ boolean isBelowThreshold();
+
+ /**
+ * Answers true if the feature is coloured above a threshold value; only
+ * applicable when isGraduatedColour answers true
+ *
+ * @return
+ */
+ boolean isAboveThreshold();
+
+ /**
+ * Answers true if the threshold is the min (or max) of the colour range; only
+ * applicable when isGraduatedColour answers true
+ *
+ * @return
+ */
+ boolean isThresholdMinMax();
+
+ /**
+ * Returns the threshold value (if any), else zero
+ *
+ * @return
+ */
+ float getThreshold();
+
+ /**
+ * Answers true if ?
+ *
+ * @return
+ */
+ boolean isLowToHigh();
+}
boolean isTransparencyAvailable();
/**
- * get current displayed types
+ * get current displayed types, in ordering of rendering (on top last)
*
- * @return
+ * @return a (possibly empty) list of feature types
*/
- String[] getDisplayedFeatureTypes();
+ List<String> getDisplayedFeatureTypes();
/**
* get current displayed groups
*
- * @return
+ * @return a (possibly empty) list of feature groups
*/
- String[] getDisplayedFeatureGroups();
+ List<String> getDisplayedFeatureGroups();
/**
* display all features of these types
--- /dev/null
+package jalview.api;
+
+import java.util.Comparator;
+
+/**
+ * An interface that describes the settings configurable in the Feature Settings
+ * dialog.
+ *
+ * @author gmcarstairs
+ *
+ */
+public interface FeatureSettingsI extends Comparator<String>
+{
+ // note Java 8 will allow default implementations of these methods in the
+ // interface, simplifying instantiating classes
+
+ /**
+ * Answers true if the specified feature type is displayed
+ *
+ * @param type
+ * @return
+ */
+ boolean isFeatureDisplayed(String type);
+
+ /**
+ * Answers true if the specified feature group is displayed
+ *
+ * @param group
+ * @return
+ */
+ boolean isGroupDisplayed(String group);
+
+ /**
+ * Returns the colour (or graduated colour) for the feature type, or null if
+ * not known
+ *
+ * @param type
+ * @return
+ */
+ FeatureColourI getFeatureColour(String type);
+
+ /**
+ * Returns the transparency value, from 0 (fully transparent) to 1 (fully
+ * opaque)
+ *
+ * @return
+ */
+ float getTransparency();
+
+ /**
+ * Returns -1 if feature1 'precedes' (is displayed on top of) feature 2, +1 if
+ * feature2 is on top of feature1, or 0 if we don't care
+ *
+ * @param feature1
+ * @param feature2
+ * @return
+ */
+ @Override
+ int compare(String feature1, String feature2);
+
+ /**
+ * Answers true if features should be initially sorted so that features with a
+ * shorter average length are displayed on top of those with a longer average
+ * length
+ *
+ * @return
+ */
+ boolean optimiseOrder();
+}
int getVisibleFeatureCount();
- int getRegisterdFeaturesCount();
+ int getRegisteredFeaturesCount();
}
--- /dev/null
+package jalview.api;
+
+/**
+ * A tagging interface to mark a source of sequence features
+ */
+public interface FeaturesSourceI
+{
+}
public boolean parseFeaturesFile(String file, String type,
boolean autoenabledisplay)
{
- // TODO: test if importing a features file onto an alignment which already
- // has features with links overwrites the original links.
-
- Hashtable featureLinks = new Hashtable();
boolean featuresFile = false;
try
{
- featuresFile = new jalview.io.FeaturesFile(file, type).parse(viewport
- .getAlignment(), alignPanel.seqPanel.seqCanvas
- .getFeatureRenderer().getFeatureColours(), featureLinks,
- true, viewport.applet.getDefaultParameter("relaxedidmatch",
- false));
+ Map<String, Object> colours = alignPanel.seqPanel.seqCanvas
+ .getFeatureRenderer().getFeatureColours();
+ boolean relaxedIdMatching = viewport.applet.getDefaultParameter(
+ "relaxedidmatch", false);
+ featuresFile = new FeaturesFile(file, type).parse(
+ viewport.getAlignment(), colours, true, relaxedIdMatching);
} catch (Exception ex)
{
ex.printStackTrace();
if (featuresFile)
{
- if (featureLinks.size() > 0)
- {
- alignPanel.seqPanel.seqCanvas.getFeatureRenderer().featureLinks = featureLinks;
- }
if (autoenabledisplay)
{
viewport.setShowSequenceFeatures(true);
public String outputFeatures(boolean displayTextbox, String format)
{
String features;
+ FeaturesFile formatter = new FeaturesFile();
if (format.equalsIgnoreCase("Jalview"))
{
- features = new FeaturesFile().printJalviewFormat(viewport
+ features = formatter.printJalviewFormat(viewport
.getAlignment().getSequencesArray(),
getDisplayedFeatureCols());
}
else
{
- features = new FeaturesFile().printGFFFormat(viewport.getAlignment()
+ features = formatter.printGffFormat(viewport.getAlignment()
.getSequencesArray(), getDisplayedFeatureCols());
}
import jalview.analysis.AlignmentUtils;
import jalview.api.ComplexAlignFile;
+import jalview.api.FeaturesSourceI;
import jalview.bin.JalviewLite;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.ColumnSelection;
addSequences.setVisible(false);
}
+ @Override
public void actionPerformed(ActionEvent evt)
{
if (evt.getSource() == accept)
{
AlignmentI al = null;
- String format = new IdentifyFile().Identify(text,
+ String format = new IdentifyFile().identify(text,
AppletFormatAdapter.PASTE);
AppletFormatAdapter afa = new AppletFormatAdapter(alignFrame.alignPanel);
try
{
af = new AlignFrame(al, alignFrame.viewport.applet,
"Cut & Paste input - " + format, false);
+ if (source instanceof FeaturesSourceI)
+ {
+ af.getAlignViewport().setShowSequenceFeatures(true);
+ }
}
af.statusBar
this.add(textarea, java.awt.BorderLayout.CENTER);
}
+ @Override
public void mousePressed(MouseEvent evt)
{
if (textarea.getText().startsWith(
}
}
+ @Override
public void mouseReleased(MouseEvent evt)
{
}
+ @Override
public void mouseClicked(MouseEvent evt)
{
}
+ @Override
public void mouseEntered(MouseEvent evt)
{
}
+ @Override
public void mouseExited(MouseEvent evt)
{
}
import java.awt.TextField;
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
-import java.util.Hashtable;
/**
* DOCUMENT ME!
public class FeatureRenderer extends
jalview.renderer.seqfeatures.FeatureRenderer
{
-
- // Holds web links for feature groups and feature types
- // in the form label|link
- Hashtable featureLinks = null;
-
/**
* Creates a new FeatureRenderer object.
*
super(null);
}
+ @Override
public void paint(Graphics g)
{
Dimension d = getSize();
overlaps.addItemListener(new java.awt.event.ItemListener()
{
+ @Override
public void itemStateChanged(java.awt.event.ItemEvent e)
{
int index = overlaps.getSelectedIndex();
dialog.buttonPanel.add(deleteButton, 1);
deleteButton.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent evt)
{
deleteFeature = true;
// TODO: render the graduated color in the box.
colourPanel.addMouseListener(new java.awt.event.MouseAdapter()
{
+ @Override
public void mousePressed(java.awt.event.MouseEvent evt)
{
if (!colourPanel.isGcol)
import java.awt.event.MouseMotionListener;
import java.awt.event.WindowAdapter;
import java.awt.event.WindowEvent;
+import java.util.Arrays;
import java.util.Enumeration;
import java.util.Hashtable;
import java.util.List;
final FeatureSettings me = this;
frame.addWindowListener(new WindowAdapter()
{
+ @Override
public void windowClosing(WindowEvent e)
{
if (me.av.featureSettings == me)
width, height);
}
+ @Override
public void paint(Graphics g)
{
g.setColor(Color.black);
scr.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
- me.ap.alignFrame.avc
- .sortAlignmentByFeatureScore(new String[] { type });
+ me.ap.alignFrame.avc.sortAlignmentByFeatureScore(Arrays
+ .asList(new String[] { type }));
}
});
dens.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
- me.ap.alignFrame.avc
- .sortAlignmentByFeatureDensity(new String[] { type });
+ me.ap.alignFrame.avc.sortAlignmentByFeatureDensity(Arrays
+ .asList(new String[] { type }));
}
});
mxcol.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
if (typeCol instanceof Color)
for (String group : fr.getFeatureGroups())
{
boolean vis = fr.checkGroupVisibility(group, false);
- Checkbox check = new MyCheckbox(group, vis,
- (fr.featureLinks != null && fr.featureLinks
- .containsKey(group)));
+ Checkbox check = new MyCheckbox(group, vis, false);
check.addMouseListener(this);
check.setFont(new Font("Serif", Font.BOLD, 12));
check.addItemListener(groupItemListener);
selected = true;
}
- check = new MyCheckbox(
- type,
- selected,
- (fr.featureLinks != null && fr.featureLinks.containsKey(type)),
+ check = new MyCheckbox(type, selected, false,
fr.getFeatureStyle(type));
check.addMouseListener(this);
}
}
+ @Override
public void actionPerformed(ActionEvent evt)
{
for (int i = 0; i < featurePanel.getComponentCount(); i++)
private ItemListener groupItemListener = new ItemListener()
{
+ @Override
public void itemStateChanged(ItemEvent evt)
{
Checkbox source = (Checkbox) evt.getSource();
};
};
+ @Override
public void itemStateChanged(ItemEvent evt)
{
selectionChanged();
boolean dragging = false;
- public void mousePressed(MouseEvent evt)
- {
-
- selectedCheck = (MyCheckbox) evt.getSource();
-
- if (fr.featureLinks != null
- && fr.featureLinks.containsKey(selectedCheck.type))
- {
- if (evt.getX() > selectedCheck.stringWidth + 20)
- {
- evt.consume();
- }
- }
-
- }
-
+ @Override
public void mouseDragged(MouseEvent evt)
{
if (((Component) evt.getSource()).getParent() != featurePanel)
dragging = true;
}
+ @Override
public void mouseReleased(MouseEvent evt)
{
if (((Component) evt.getSource()).getParent() != featurePanel)
ap.paintAlignment(true);
}
+ @Override
public void mouseEntered(MouseEvent evt)
{
}
+ @Override
public void mouseExited(MouseEvent evt)
{
}
+ @Override
public void mouseClicked(MouseEvent evt)
{
MyCheckbox check = (MyCheckbox) evt.getSource();
{
this.popupSort(check, fr.getMinMax(), evt.getX(), evt.getY());
}
- if (fr.featureLinks != null && fr.featureLinks.containsKey(check.type))
- {
- if (evt.getX() > check.stringWidth + 20)
- {
- evt.consume();
- String link = fr.featureLinks.get(check.type).toString();
- ap.alignFrame.showURL(link.substring(link.indexOf("|") + 1),
- link.substring(0, link.indexOf("|")));
- }
- }
if (check.getParent() != featurePanel)
{
}
}
+ @Override
public void mouseMoved(MouseEvent evt)
{
}
+ @Override
public void adjustmentValueChanged(AdjustmentEvent evt)
{
fr.setTransparency((100 - transparency.getValue()) / 100f);
updateColor(featureStyle);
}
+ @Override
public void paint(Graphics g)
{
Dimension d = getSize();
}
}
+ @Override
+ public void mousePressed(MouseEvent e)
+ {
+ }
+
}
protocol = jalview.io.AppletFormatAdapter.checkProtocol(file);
- format = new jalview.io.IdentifyFile().Identify(file, protocol);
+ format = new jalview.io.IdentifyFile().identify(file, protocol);
AlignFrame af = fileLoader.LoadFileWaitTillLoaded(file, protocol,
format);
}
else
{
- format = new jalview.io.IdentifyFile().Identify(file, protocol);
+ format = new jalview.io.IdentifyFile().identify(file, protocol);
}
startUpAlframe = fileLoader.LoadFileWaitTillLoaded(file, protocol,
{
AlignmentI al = null;
- String format = new IdentifyFile().Identify(text,
+ String format = new IdentifyFile().identify(text,
AppletFormatAdapter.PASTE);
try
{
return null;
}
String resolvedFile = resolveFileProtocol(fileParam);
- String format = new IdentifyFile().Identify(resolvedFile, protocol);
+ String format = new IdentifyFile().identify(resolvedFile, protocol);
dbgMsg("File identified as '" + format + "'");
AlignmentI al = null;
try
String format = getParameter("format");
if (format == null || format.length() == 0)
{
- format = new jalview.io.IdentifyFile().Identify(file, protocol);
+ format = new jalview.io.IdentifyFile().identify(file, protocol);
System.out.println("Format is " + format);
}
else
import jalview.util.MessageManager;
import java.awt.Color;
-import java.util.ArrayList;
import java.util.BitSet;
import java.util.List;
}
@Override
- public void sortAlignmentByFeatureDensity(String[] typ)
+ public void sortAlignmentByFeatureDensity(List<String> typ)
{
sortBy(typ, "Sort by Density", AlignmentSorter.FEATURE_DENSITY);
}
- protected void sortBy(String[] typ, String methodText, final String method)
+ protected void sortBy(List<String> typ, String methodText,
+ final String method)
{
FeatureRenderer fr = alignPanel.getFeatureRenderer();
- if (typ == null)
+ if (typ == null && fr != null)
{
- typ = fr == null ? null : fr.getDisplayedFeatureTypes();
+ typ = fr.getDisplayedFeatureTypes();
}
- String gps[] = null;
- gps = fr == null ? null : fr.getDisplayedFeatureGroups();
- if (typ != null)
+ List<String> gps = null;
+ if (fr != null)
{
- List<String> types = new ArrayList<String>();
- for (String displayed : typ)
- {
- if (displayed != null)
- {
- types.add(displayed);
- }
- }
- typ = new String[types.size()];
- types.toArray(typ);
- }
- if (gps != null)
- {
- List<String> grps = new ArrayList<String>();
-
- for (int i = 0; i < gps.length; i++)
- {
- if (gps[i] != null)
- {
- grps.add(gps[i]);
- }
- }
- gps = new String[grps.size()];
- grps.toArray(gps);
+ gps = fr.getDisplayedFeatureGroups();
}
AlignmentI al = viewport.getAlignment();
}
@Override
- public void sortAlignmentByFeatureScore(String[] typ)
+ public void sortAlignmentByFeatureScore(List<String> typ)
{
sortBy(typ, "Sort by Feature Score", AlignmentSorter.FEATURE_SCORE);
}
boolean featuresFile = false;
try
{
- featuresFile = new FeaturesFile(file, protocol).parse(viewport
+ featuresFile = new FeaturesFile(false, file, protocol).parse(viewport
.getAlignment().getDataset(), alignPanel.getFeatureRenderer()
.getFeatureColours(), false, relaxedIdMatching);
} catch (Exception ex)
*
* Example: in "G-AT-C-GA" the aligned codons are (0, 2, 3) and (5, 7, 8).
*
- * JBPComment: Is this useful anywhere other than jalview.analysis.Dna ?
- *
* @author gmcarstairs
*
*/
public final class AlignedCodon
{
+ // base 1 aligned sequence position (base 0)
public final int pos1;
+ // base 2 aligned sequence position (base 0)
public final int pos2;
+ // base 3 aligned sequence position (base 0)
public final int pos3;
+ // peptide aligned sequence position (base 0)
+ public final int peptideCol;
+
+ // peptide coded for by this codon
public final String product;
public AlignedCodon(int i, int j, int k)
{
- this(i, j, k, null);
+ this(i, j, k, null, 0);
}
- public AlignedCodon(int i, int j, int k, String prod)
+ public AlignedCodon(int i, int j, int k, String prod, int prodCol)
{
pos1 = i;
pos2 = j;
pos3 = k;
product = prod;
+ peptideCol = prodCol;
}
/**
public class AlignedCodonFrame
{
- /**
- * tied array of na Sequence objects.
+ /*
+ * Data bean to hold mappings from one sequence to another
*/
- private SequenceI[] dnaSeqs = null;
+ private class SequenceToSequenceMapping
+ {
+ private SequenceI fromSeq;
- /**
- * tied array of Mappings to protein sequence Objects and SequenceI[]
- * aaSeqs=null; MapLists where each maps from the corresponding dnaSeqs
- * element to corresponding aaSeqs element
- */
- private Mapping[] dnaToProt = null;
+ private Mapping mapping;
+
+ SequenceToSequenceMapping(SequenceI from, Mapping map)
+ {
+ this.fromSeq = from;
+ this.mapping = map;
+ }
+
+ /**
+ * Readable representation for debugging only, not guaranteed not to change
+ */
+ @Override
+ public String toString()
+ {
+ return String.format("From %s %s", fromSeq.getName(),
+ mapping.toString());
+ }
+ }
+
+ private List<SequenceToSequenceMapping> mappings;
/**
* Constructor
*/
public AlignedCodonFrame()
{
+ mappings = new ArrayList<SequenceToSequenceMapping>();
}
/**
*/
public void addMap(SequenceI dnaseq, SequenceI aaseq, MapList map)
{
- int nlen = 1;
- if (dnaSeqs != null)
- {
- nlen = dnaSeqs.length + 1;
- }
- SequenceI[] ndna = new SequenceI[nlen];
- Mapping[] ndtp = new Mapping[nlen];
- if (dnaSeqs != null)
- {
- System.arraycopy(dnaSeqs, 0, ndna, 0, dnaSeqs.length);
- System.arraycopy(dnaToProt, 0, ndtp, 0, dnaSeqs.length);
- }
- dnaSeqs = ndna;
- dnaToProt = ndtp;
- nlen--;
- dnaSeqs[nlen] = (dnaseq.getDatasetSequence() == null) ? dnaseq : dnaseq
- .getDatasetSequence();
- Mapping mp = new Mapping(map);
// JBPNote DEBUG! THIS !
// dnaseq.transferAnnotation(aaseq, mp);
// aaseq.transferAnnotation(dnaseq, new Mapping(map.getInverse()));
- mp.to = (aaseq.getDatasetSequence() == null) ? aaseq : aaseq
+
+ SequenceI fromSeq = (dnaseq.getDatasetSequence() == null) ? dnaseq
+ : dnaseq.getDatasetSequence();
+ SequenceI toSeq = (aaseq.getDatasetSequence() == null) ? aaseq : aaseq
.getDatasetSequence();
- dnaToProt[nlen] = mp;
+
+ /*
+ * if we already hold a mapping between these sequences, just add to it
+ */
+ for (SequenceToSequenceMapping ssm : mappings)
+ {
+ if (ssm.fromSeq == fromSeq && ssm.mapping.to == toSeq)
+ {
+ ssm.mapping.map.addMapList(map);
+ return;
+ }
+ }
+
+ /*
+ * otherwise, add a new sequence mapping
+ */
+ Mapping mp = new Mapping(toSeq, map);
+ mappings.add(new SequenceToSequenceMapping(fromSeq, mp));
}
public SequenceI[] getdnaSeqs()
{
- return dnaSeqs;
+ // TODO return a list instead?
+ // return dnaSeqs;
+ List<SequenceI> seqs = new ArrayList<SequenceI>();
+ for (SequenceToSequenceMapping ssm : mappings)
+ {
+ seqs.add(ssm.fromSeq);
+ }
+ return seqs.toArray(new SequenceI[seqs.size()]);
}
public SequenceI[] getAaSeqs()
{
- if (dnaToProt == null)
+ // TODO not used - remove?
+ List<SequenceI> seqs = new ArrayList<SequenceI>();
+ for (SequenceToSequenceMapping ssm : mappings)
{
- return null;
- }
- SequenceI[] sqs = new SequenceI[dnaToProt.length];
- for (int sz = 0; sz < dnaToProt.length; sz++)
- {
- sqs[sz] = dnaToProt[sz].to;
+ seqs.add(ssm.mapping.to);
}
- return sqs;
+ return seqs.toArray(new SequenceI[seqs.size()]);
}
public MapList[] getdnaToProt()
{
- if (dnaToProt == null)
- {
- return null;
- }
- MapList[] sqs = new MapList[dnaToProt.length];
- for (int sz = 0; sz < dnaToProt.length; sz++)
+ List<MapList> maps = new ArrayList<MapList>();
+ for (SequenceToSequenceMapping ssm : mappings)
{
- sqs[sz] = dnaToProt[sz].map;
+ maps.add(ssm.mapping.map);
}
- return sqs;
+ return maps.toArray(new MapList[maps.size()]);
}
public Mapping[] getProtMappings()
{
- return dnaToProt;
+ List<Mapping> maps = new ArrayList<Mapping>();
+ for (SequenceToSequenceMapping ssm : mappings)
+ {
+ maps.add(ssm.mapping);
+ }
+ return maps.toArray(new Mapping[maps.size()]);
}
/**
*/
public Mapping getMappingForSequence(SequenceI seq)
{
- if (dnaSeqs == null)
- {
- return null;
- }
SequenceI seqDs = seq.getDatasetSequence();
seqDs = seqDs != null ? seqDs : seq;
- for (int ds = 0; ds < dnaSeqs.length; ds++)
+ for (SequenceToSequenceMapping ssm : mappings)
{
- if (dnaSeqs[ds] == seqDs || dnaToProt[ds].to == seqDs)
+ if (ssm.fromSeq == seqDs || ssm.mapping.to == seqDs)
{
- return dnaToProt[ds];
+ return ssm.mapping;
}
}
return null;
*/
public SequenceI getAaForDnaSeq(SequenceI dnaSeqRef)
{
- if (dnaSeqs == null)
- {
- return null;
- }
SequenceI dnads = dnaSeqRef.getDatasetSequence();
- for (int ds = 0; ds < dnaSeqs.length; ds++)
+ for (SequenceToSequenceMapping ssm : mappings)
{
- if (dnaSeqs[ds] == dnaSeqRef || dnaSeqs[ds] == dnads)
+ if (ssm.fromSeq == dnaSeqRef || ssm.fromSeq == dnads)
{
- return dnaToProt[ds].to;
+ return ssm.mapping.to;
}
}
return null;
*/
public SequenceI getDnaForAaSeq(SequenceI aaSeqRef)
{
- if (dnaToProt == null)
- {
- return null;
- }
SequenceI aads = aaSeqRef.getDatasetSequence();
- for (int as = 0; as < dnaToProt.length; as++)
+ for (SequenceToSequenceMapping ssm : mappings)
{
- if (dnaToProt[as].to == aaSeqRef || dnaToProt[as].to == aads)
+ if (ssm.mapping.to == aaSeqRef || ssm.mapping.to == aads)
{
- return dnaSeqs[as];
+ return ssm.fromSeq;
}
}
return null;
public void markMappedRegion(SequenceI seq, int index,
SearchResults results)
{
- if (dnaToProt == null)
- {
- return;
- }
int[] codon;
SequenceI ds = seq.getDatasetSequence();
- for (int mi = 0; mi < dnaToProt.length; mi++)
+ for (SequenceToSequenceMapping ssm : mappings)
{
- if (dnaSeqs[mi] == seq || dnaSeqs[mi] == ds)
+ if (ssm.fromSeq == seq || ssm.fromSeq == ds)
{
- // DEBUG System.err.println("dna pos "+index);
- codon = dnaToProt[mi].map.locateInTo(index, index);
+ codon = ssm.mapping.map.locateInTo(index, index);
if (codon != null)
{
for (int i = 0; i < codon.length; i += 2)
{
- results.addResult(dnaToProt[mi].to, codon[i], codon[i + 1]);
+ results.addResult(ssm.mapping.to, codon[i], codon[i + 1]);
}
}
}
- else if (dnaToProt[mi].to == seq || dnaToProt[mi].to == ds)
+ else if (ssm.mapping.to == seq || ssm.mapping.to == ds)
{
- // DEBUG System.err.println("aa pos "+index);
{
- codon = dnaToProt[mi].map.locateInFrom(index, index);
+ codon = ssm.mapping.map.locateInFrom(index, index);
if (codon != null)
{
for (int i = 0; i < codon.length; i += 2)
{
- results.addResult(dnaSeqs[mi], codon[i], codon[i + 1]);
+ results.addResult(ssm.fromSeq, codon[i], codon[i + 1]);
}
}
}
* Adapted from markMappedRegion().
*/
MapList ml = null;
- for (int i = 0; i < dnaToProt.length; i++)
+ int i = 0;
+ for (SequenceToSequenceMapping ssm : mappings)
{
- if (dnaSeqs[i] == seq)
+ if (ssm.fromSeq == seq)
{
ml = getdnaToProt()[i];
break;
}
+ i++;
}
return ml == null ? null : ml.locateInFrom(aaPos, aaPos);
}
/*
* Search mapped protein ('to') sequences first.
*/
- if (this.dnaToProt != null)
+ for (SequenceToSequenceMapping ssm : mappings)
{
- for (int i = 0; i < dnaToProt.length; i++)
+ if (ssm.fromSeq == seq)
{
- if (this.dnaSeqs[i] == seq)
+ for (SequenceI sourceAligned : al.getSequences())
{
- for (SequenceI sourceAligned : al.getSequences())
+ if (ssm.mapping.to == sourceAligned.getDatasetSequence()
+ || ssm.mapping.to == sourceAligned)
{
- if (this.dnaToProt[i].to == sourceAligned.getDatasetSequence())
- {
- return sourceAligned;
- }
+ return sourceAligned;
}
}
}
/*
* Then try mapped dna sequences.
*/
- if (this.dnaToProt != null)
+ for (SequenceToSequenceMapping ssm : mappings)
{
- for (int i = 0; i < dnaToProt.length; i++)
+ if (ssm.mapping.to == seq)
{
- if (this.dnaToProt[i].to == seq)
+ for (SequenceI sourceAligned : al.getSequences())
{
- for (SequenceI sourceAligned : al.getSequences())
+ if (ssm.fromSeq == sourceAligned.getDatasetSequence())
{
- if (this.dnaSeqs[i] == sourceAligned.getDatasetSequence())
- {
- return sourceAligned;
- }
+ return sourceAligned;
}
}
}
}
/**
- * Returns the region in the 'mappedFrom' sequence's dataset that is mapped to
- * position 'pos' (base 1) in the 'mappedTo' sequence's dataset. The region is
- * a set of start/end position pairs.
+ * Returns the region in the target sequence's dataset that is mapped to the
+ * given position (base 1) in the query sequence's dataset. The region is a
+ * set of start/end position pairs.
*
- * @param mappedFrom
- * @param mappedTo
- * @param pos
+ * @param target
+ * @param query
+ * @param queryPos
* @return
*/
- public int[] getMappedRegion(SequenceI mappedFrom, SequenceI mappedTo,
- int pos)
+ public int[] getMappedRegion(SequenceI target, SequenceI query,
+ int queryPos)
{
- SequenceI targetDs = mappedFrom.getDatasetSequence() == null ? mappedFrom
- : mappedFrom.getDatasetSequence();
- SequenceI sourceDs = mappedTo.getDatasetSequence() == null ? mappedTo
- : mappedTo.getDatasetSequence();
- if (targetDs == null || sourceDs == null || dnaToProt == null)
+ SequenceI targetDs = target.getDatasetSequence() == null ? target
+ : target.getDatasetSequence();
+ SequenceI queryDs = query.getDatasetSequence() == null ? query : query
+ .getDatasetSequence();
+ if (targetDs == null || queryDs == null /*|| dnaToProt == null*/)
{
return null;
}
- for (int mi = 0; mi < dnaToProt.length; mi++)
+ for (SequenceToSequenceMapping ssm : mappings)
{
- if (dnaSeqs[mi] == targetDs && dnaToProt[mi].to == sourceDs)
+ /*
+ * try mapping from target to query
+ */
+ if (ssm.fromSeq == targetDs && ssm.mapping.to == queryDs)
+ {
+ int[] codon = ssm.mapping.map.locateInFrom(queryPos, queryPos);
+ if (codon != null)
+ {
+ return codon;
+ }
+ }
+ /*
+ * else try mapping from query to target
+ */
+ else if (ssm.fromSeq == queryDs && ssm.mapping.to == targetDs)
{
- int[] codon = dnaToProt[mi].map.locateInFrom(pos, pos);
+ int[] codon = ssm.mapping.map.locateInTo(queryPos, queryPos);
if (codon != null)
{
return codon;
}
/**
- * Returns the DNA codon for the given position (base 1) in a mapped protein
- * sequence, or null if no mapping is found.
+ * Returns the mapped DNA codons for the given position in a protein sequence,
+ * or null if no mapping is found. Returns a list of (e.g.) ['g', 'c', 't']
+ * codons. There may be more than one codon mapped to the protein if (for
+ * example), there are mappings to cDNA variants.
*
* @param protein
* the peptide dataset sequence
* residue position (base 1) in the peptide sequence
* @return
*/
- public char[] getMappedCodon(SequenceI protein, int aaPos)
+ public List<char[]> getMappedCodons(SequenceI protein, int aaPos)
{
- if (dnaToProt == null)
- {
- return null;
- }
MapList ml = null;
SequenceI dnaSeq = null;
- for (int i = 0; i < dnaToProt.length; i++)
+ List<char[]> result = new ArrayList<char[]>();
+
+ for (SequenceToSequenceMapping ssm : mappings)
{
- if (dnaToProt[i].to == protein)
+ if (ssm.mapping.to == protein)
{
- ml = getdnaToProt()[i];
- dnaSeq = dnaSeqs[i];
- break;
+ ml = ssm.mapping.map;
+ dnaSeq = ssm.fromSeq;
+
+ int[] codonPos = ml.locateInFrom(aaPos, aaPos);
+ if (codonPos == null)
+ {
+ return null;
+ }
+
+ /*
+ * Read off the mapped nucleotides (converting to position base 0)
+ */
+ codonPos = MappingUtils.flattenRanges(codonPos);
+ char[] dna = dnaSeq.getSequence();
+ int start = dnaSeq.getStart();
+ result.add(new char[] { dna[codonPos[0] - start],
+ dna[codonPos[1] - start], dna[codonPos[2] - start] });
}
}
- if (ml == null)
- {
- return null;
- }
- int[] codonPos = ml.locateInFrom(aaPos, aaPos);
- if (codonPos == null)
- {
- return null;
- }
-
- /*
- * Read off the mapped nucleotides (converting to position base 0)
- */
- codonPos = MappingUtils.flattenRanges(codonPos);
- char[] dna = dnaSeq.getSequence();
- int start = dnaSeq.getStart();
- return new char[] { dna[codonPos[0] - start], dna[codonPos[1] - start],
- dna[codonPos[2] - start] };
+ return result.isEmpty() ? null : result;
}
/**
public List<Mapping> getMappingsForSequence(SequenceI seq)
{
List<Mapping> result = new ArrayList<Mapping>();
- if (dnaSeqs == null)
- {
- return result;
- }
List<SequenceI> related = new ArrayList<SequenceI>();
SequenceI seqDs = seq.getDatasetSequence();
seqDs = seqDs != null ? seqDs : seq;
- for (int ds = 0; ds < dnaSeqs.length; ds++)
+ for (SequenceToSequenceMapping ssm : mappings)
{
- final Mapping mapping = dnaToProt[ds];
- if (dnaSeqs[ds] == seqDs || mapping.to == seqDs)
+ final Mapping mapping = ssm.mapping;
+ if (ssm.fromSeq == seqDs || mapping.to == seqDs)
{
if (!related.contains(mapping.to))
{
}
return result;
}
+
+ /**
+ * Test whether the given sequence is substitutable for one or more dummy
+ * sequences in this mapping
+ *
+ * @param map
+ * @param seq
+ * @return
+ */
+ public boolean isRealisableWith(SequenceI seq)
+ {
+ return realiseWith(seq, false) > 0;
+ }
+
+ /**
+ * Replace any matchable mapped dummy sequences with the given real one.
+ * Returns the count of sequence mappings instantiated.
+ *
+ * @param seq
+ * @return
+ */
+ public int realiseWith(SequenceI seq)
+ {
+ return realiseWith(seq, true);
+ }
+
+ /**
+ * Returns the number of mapped dummy sequences that could be replaced with
+ * the given real sequence.
+ *
+ * @param seq
+ * a dataset sequence
+ * @param doUpdate
+ * if true, performs replacements, else only counts
+ * @return
+ */
+ protected int realiseWith(SequenceI seq, boolean doUpdate)
+ {
+ SequenceI ds = seq.getDatasetSequence() != null ? seq
+ .getDatasetSequence() : seq;
+ int count = 0;
+
+ /*
+ * check for replaceable DNA ('map from') sequences
+ */
+ for (SequenceToSequenceMapping ssm : mappings)
+ {
+ SequenceI dna = ssm.fromSeq;
+ if (dna instanceof SequenceDummy
+ && dna.getName().equals(ds.getName()))
+ {
+ Mapping mapping = ssm.mapping;
+ int mapStart = mapping.getMap().getFromLowest();
+ int mapEnd = mapping.getMap().getFromHighest();
+ boolean mappable = couldRealiseSequence(dna, ds, mapStart, mapEnd);
+ if (mappable)
+ {
+ count++;
+ if (doUpdate)
+ {
+ // TODO: new method ? ds.realise(dna);
+ // might want to copy database refs as well
+ ds.setSequenceFeatures(dna.getSequenceFeatures());
+ // dnaSeqs[i] = ds;
+ ssm.fromSeq = ds;
+ System.out.println("Realised mapped sequence " + ds.getName());
+ }
+ }
+ }
+
+ /*
+ * check for replaceable protein ('map to') sequences
+ */
+ Mapping mapping = ssm.mapping;
+ SequenceI prot = mapping.getTo();
+ int mapStart = mapping.getMap().getToLowest();
+ int mapEnd = mapping.getMap().getToHighest();
+ boolean mappable = couldRealiseSequence(prot, ds, mapStart, mapEnd);
+ if (mappable)
+ {
+ count++;
+ if (doUpdate)
+ {
+ // TODO: new method ? ds.realise(dna);
+ // might want to copy database refs as well
+ ds.setSequenceFeatures(dna.getSequenceFeatures());
+ ssm.mapping.setTo(ds);
+ }
+ }
+ }
+ return count;
+ }
+
+ /**
+ * Helper method to test whether a 'real' sequence could replace a 'dummy'
+ * sequence in the map. The criteria are that they have the same name, and
+ * that the mapped region overlaps the candidate sequence.
+ *
+ * @param existing
+ * @param replacement
+ * @param mapStart
+ * @param mapEnd
+ * @return
+ */
+ protected static boolean couldRealiseSequence(SequenceI existing,
+ SequenceI replacement, int mapStart, int mapEnd)
+ {
+ if (existing instanceof SequenceDummy
+ && !(replacement instanceof SequenceDummy)
+ && existing.getName().equals(replacement.getName()))
+ {
+ int start = replacement.getStart();
+ int end = replacement.getEnd();
+ boolean mappingOverlapsSequence = (mapStart >= start && mapStart <= end)
+ || (mapEnd >= start && mapEnd <= end);
+ if (mappingOverlapsSequence)
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * Change any mapping to the given sequence to be to its dataset sequence
+ * instead. For use when mappings are created before their referenced
+ * sequences are instantiated, for example when parsing GFF data.
+ *
+ * @param seq
+ */
+ public void updateToDataset(SequenceI seq)
+ {
+ if (seq == null || seq.getDatasetSequence() == null)
+ {
+ return;
+ }
+ SequenceI ds = seq.getDatasetSequence();
+
+ for (SequenceToSequenceMapping ssm : mappings)
+ /*
+ * 'from' sequences
+ */
+ {
+ if (ssm.fromSeq == seq)
+ {
+ ssm.fromSeq = ds;
+ }
+
+ /*
+ * 'to' sequences
+ */
+ if (ssm.mapping.to == seq)
+ {
+ ssm.mapping.to = ds;
+ }
+ }
+ }
+
+ /**
+ * Answers true if this object contains no mappings
+ *
+ * @return
+ */
+ public boolean isEmpty()
+ {
+ return mappings.isEmpty();
+ }
}
import jalview.analysis.AlignmentUtils;
import jalview.io.FastaFile;
+import jalview.util.Comparison;
import jalview.util.MessageManager;
import java.util.ArrayList;
+import java.util.Collections;
import java.util.Enumeration;
import java.util.HashSet;
import java.util.Hashtable;
-import java.util.LinkedHashSet;
import java.util.List;
import java.util.Map;
import java.util.Set;
protected List<SequenceI> sequences;
- protected List<SequenceGroup> groups = java.util.Collections
- .synchronizedList(new ArrayList<SequenceGroup>());
+ protected List<SequenceGroup> groups;
protected char gapCharacter = '-';
public boolean hasRNAStructure = false;
- /** DOCUMENT ME!! */
public AlignmentAnnotation[] annotations;
- HiddenSequences hiddenSequences = new HiddenSequences(this);
+ HiddenSequences hiddenSequences;
public Hashtable alignmentProperties;
- private Set<AlignedCodonFrame> codonFrameList = new LinkedHashSet<AlignedCodonFrame>();
+ private List<AlignedCodonFrame> codonFrameList;
private void initAlignment(SequenceI[] seqs)
{
- int i = 0;
+ groups = Collections.synchronizedList(new ArrayList<SequenceGroup>());
+ hiddenSequences = new HiddenSequences(this);
+ codonFrameList = new ArrayList<AlignedCodonFrame>();
- if (jalview.util.Comparison.isNucleotide(seqs))
+ if (Comparison.isNucleotide(seqs))
{
type = NUCLEOTIDE;
}
type = PROTEIN;
}
- sequences = java.util.Collections
- .synchronizedList(new ArrayList<SequenceI>());
+ sequences = Collections.synchronizedList(new ArrayList<SequenceI>());
- for (i = 0; i < seqs.length; i++)
+ for (int i = 0; i < seqs.length; i++)
{
sequences.add(seqs[i]);
}
seqs[i] = new Sequence(seqs[i]);
}
+ initAlignment(seqs);
+
/*
- * Share the same dataset sequence mappings (if any). TODO: find a better
- * place for these to live (alignment dataset?).
+ * Share the same dataset sequence mappings (if any).
*/
- this.codonFrameList = ((Alignment) al).codonFrameList;
-
- initAlignment(seqs);
+ this.setCodonFrames(al.getCodonFrames());
}
/**
{
if (dataset == null && data == null)
{
- // Create a new dataset for this alignment.
- // Can only be done once, if dataset is not null
- // This will not be performed
- SequenceI[] seqs = new SequenceI[getHeight()];
- SequenceI currentSeq;
- for (int i = 0; i < getHeight(); i++)
- {
- currentSeq = getSequenceAt(i);
- if (currentSeq.getDatasetSequence() != null)
- {
- seqs[i] = currentSeq.getDatasetSequence();
- }
- else
- {
- seqs[i] = currentSeq.createDatasetSequence();
- }
- }
-
- dataset = new Alignment(seqs);
+ createDatasetAlignment();
}
else if (dataset == null && data != null)
{
}
/**
+ * Creates a new dataset for this alignment. Can only be done once - if
+ * dataset is not null this will not be performed.
+ */
+ public void createDatasetAlignment()
+ {
+ if (dataset != null)
+ {
+ return;
+ }
+ SequenceI[] seqs = new SequenceI[getHeight()];
+ SequenceI currentSeq;
+ for (int i = 0; i < getHeight(); i++)
+ {
+ currentSeq = getSequenceAt(i);
+ if (currentSeq.getDatasetSequence() != null)
+ {
+ seqs[i] = currentSeq.getDatasetSequence();
+ }
+ else
+ {
+ seqs[i] = currentSeq.createDatasetSequence();
+ }
+ }
+
+ dataset = new Alignment(seqs);
+ // move mappings to the dataset alignment
+ dataset.codonFrameList = this.codonFrameList;
+ this.codonFrameList = null;
+ }
+
+ /**
* reference count for number of alignments referencing this one.
*/
int alignmentRefs = 0;
return alignmentProperties;
}
- /*
- * (non-Javadoc)
- *
- * @see
- * jalview.datamodel.AlignmentI#addCodonFrame(jalview.datamodel.AlignedCodonFrame
- * )
+ /**
+ * Adds the given mapping to the stored set. Note this may be held on the
+ * dataset alignment.
*/
@Override
public void addCodonFrame(AlignedCodonFrame codons)
{
- if (codons != null)
+ List<AlignedCodonFrame> acfs = getCodonFrames();
+ if (codons != null && acfs != null && !acfs.contains(codons))
{
- codonFrameList.add(codons);
+ acfs.add(codons);
}
}
return null;
}
List<AlignedCodonFrame> cframes = new ArrayList<AlignedCodonFrame>();
- for (AlignedCodonFrame acf : codonFrameList)
+ for (AlignedCodonFrame acf : getCodonFrames())
{
if (acf.involvesSequence(seq))
{
}
/**
- * Sets the codon frame mappings (replacing any existing mappings).
+ * Sets the codon frame mappings (replacing any existing mappings). Note the
+ * mappings are set on the dataset alignment instead if there is one.
*
* @see jalview.datamodel.AlignmentI#setCodonFrames()
*/
@Override
- public void setCodonFrames(Set<AlignedCodonFrame> acfs)
+ public void setCodonFrames(List<AlignedCodonFrame> acfs)
{
- this.codonFrameList = acfs;
+ if (dataset != null)
+ {
+ dataset.setCodonFrames(acfs);
+ }
+ else
+ {
+ this.codonFrameList = acfs;
+ }
}
/**
* Returns the set of codon frame mappings. Any changes to the returned set
- * will affect the alignment.
+ * will affect the alignment. The mappings are held on (and read from) the
+ * dataset alignment if there is one.
*
* @see jalview.datamodel.AlignmentI#getCodonFrames()
*/
@Override
- public Set<AlignedCodonFrame> getCodonFrames()
+ public List<AlignedCodonFrame> getCodonFrames()
{
- return codonFrameList;
+ return dataset != null ? dataset.getCodonFrames() : codonFrameList;
}
- /*
- * (non-Javadoc)
- *
- * @seejalview.datamodel.AlignmentI#removeCodonFrame(jalview.datamodel.
- * AlignedCodonFrame)
+ /**
+ * Removes the given mapping from the stored set. Note that the mappings are
+ * held on the dataset alignment if there is one.
*/
@Override
public boolean removeCodonFrame(AlignedCodonFrame codons)
{
- if (codons == null || codonFrameList == null)
+ List<AlignedCodonFrame> acfs = getCodonFrames();
+ if (codons == null || acfs == null)
{
return false;
}
- return codonFrameList.remove(codons);
+ return acfs.remove(codons);
}
@Override
addAnnotation(alan[a]);
}
- this.codonFrameList.addAll(toappend.getCodonFrames());
+ getCodonFrames().addAll(toappend.getCodonFrames());
List<SequenceGroup> sg = toappend.getGroups();
if (sg != null)
*
* @return the representative sequence for this group
*/
+ @Override
public SequenceI getSeqrep()
{
return seqrep;
* @param seqrep
* the seqrep to set (null means no sequence representative)
*/
+ @Override
public void setSeqrep(SequenceI seqrep)
{
this.seqrep = seqrep;
*
* @return true if group has a sequence representative
*/
+ @Override
public boolean hasSeqrep()
{
return seqrep != null;
}
return hasValidSeq;
}
+
+ /**
+ * Update any mappings to 'virtual' sequences to compatible real ones, if
+ * present in the added sequences. Returns a count of mappings updated.
+ *
+ * @param seqs
+ * @return
+ */
+ @Override
+ public int realiseMappings(List<SequenceI> seqs)
+ {
+ int count = 0;
+ for (SequenceI seq : seqs)
+ {
+ for (AlignedCodonFrame mapping : getCodonFrames())
+ {
+ count += mapping.realiseWith(seq);
+ }
+ }
+ return count;
+ }
+
+ /**
+ * Returns the first AlignedCodonFrame that has a mapping between the given
+ * dataset sequences
+ *
+ * @param mapFrom
+ * @param mapTo
+ * @return
+ */
+ @Override
+ public AlignedCodonFrame getMapping(SequenceI mapFrom, SequenceI mapTo)
+ {
+ for (AlignedCodonFrame acf : getCodonFrames())
+ {
+ if (acf.getAaForDnaSeq(mapFrom) == mapTo)
+ {
+ return acf;
+ }
+ }
+ return null;
+ }
}
*
* @return
*/
- Set<AlignedCodonFrame> getCodonFrames();
+ List<AlignedCodonFrame> getCodonFrames();
/**
- * Set the codon frame mappings (replacing any existing set).
+ * Set the codon frame mappings (replacing any existing list).
*/
- void setCodonFrames(Set<AlignedCodonFrame> acfs);
+ void setCodonFrames(List<AlignedCodonFrame> acfs);
/**
* get codon frames involving sequenceI
* @return
*/
public boolean hasValidSequence();
+
+ /**
+ * Update any mappings to 'virtual' sequences to compatible real ones, if
+ * present in the added sequences. Returns a count of mappings updated.
+ *
+ * @param seqs
+ * @return
+ */
+ int realiseMappings(List<SequenceI> seqs);
+
+ /**
+ * Returns the first AlignedCodonFrame that has a mapping between the given
+ * dataset sequences
+ *
+ * @param mapFrom
+ * @param mapTo
+ * @return
+ */
+ AlignedCodonFrame getMapping(SequenceI mapFrom, SequenceI mapTo);
}
public static final String GENEDB = "GeneDB".toUpperCase();
/**
- * List of databases whose sequences might have coding regions annotated
- */
- public static final String[] DNACODINGDBS = { EMBL, EMBLCDS, GENEDB };
-
- public static final String[] CODINGDBS = { EMBLCDS, GENEDB };
-
- public static final String[] PROTEINDBS = { UNIPROT, PDB, UNIPROTKB,
- EMBLCDSProduct };
-
- public static final String[] PROTEINSEQ = { UNIPROT, UNIPROTKB,
- EMBLCDSProduct };
-
- public static final String[] PROTEINSTR = { PDB };
-
- public static final String[] DOMAINDBS = { PFAM, RFAM };
-
- /**
- * set of unique DBRefSource property constants. These could be used to
- * reconstruct the above groupings
- */
- public static final Object SEQDB = "SQ";
-
- /**
- * database of nucleic acid sequences
- */
- public static final Object DNASEQDB = "NASQ";
-
- /**
- * database of amino acid sequences
- */
- public static final Object PROTSEQDB = "PROTSQ";
-
- /**
- * database of cDNA sequences
- */
- public static final Object CODINGSEQDB = "CODING";
-
- /**
- * database of na sequences with exon annotation
+ * Ensembl
*/
- public static final Object DNACODINGSEQDB = "XONCODING";
+ public static final String ENSEMBL = "ENSEMBL";
/**
- * DB returns several sequences associated with a protein/nucleotide domain
+ * List of databases whose sequences might have coding regions annotated
*/
- public static final Object DOMAINDB = "DOMAIN";
+ public static final String[] DNACODINGDBS = { EMBL, EMBLCDS, GENEDB,
+ ENSEMBL };
- /**
- * DB query can take multiple accession codes concatenated by a separator.
- * Value of property indicates maximum number of accession codes to send at a
- * time.
- */
- public static final Object MULTIACC = "MULTIACC";
+ public static final String[] CODINGDBS = { EMBLCDS, GENEDB, ENSEMBL };
- /**
- * DB query returns an alignment for each accession provided.
- */
- public static final Object ALIGNMENTDB = "ALIGNMENTS";
+ public static final String[] PROTEINDBS = { UNIPROT, PDB, UNIPROTKB,
+ EMBLCDSProduct, ENSEMBL }; // Ensembl ENSP* entries are protein
}
int[] alignedCodon = getAlignedCodon(codon);
String peptide = getPeptide();
+ int peptideCol = toPosition - 1 - Mapping.this.to.getStart();
return new AlignedCodon(alignedCodon[0], alignedCodon[1],
- alignedCodon[2], peptide);
+ alignedCodon[2], peptide, peptideCol);
}
/**
* sequence.
*
* @return
+ * @throws NoSuchElementException
+ * if the 'toRange' is exhausted (nothing to map to)
*/
private String getPeptide()
{
*
* @see java.lang.Object#finalize()
*/
+ @Override
protected void finalize() throws Throwable
{
map = null;
super.finalize();
}
+ /**
+ * Returns an iterator which can serve up the aligned codon column positions
+ * and their corresponding peptide products
+ *
+ * @param seq
+ * an aligned (i.e. possibly gapped) sequence
+ * @param gapChar
+ * @return
+ */
public Iterator<AlignedCodon> getCodonIterator(SequenceI seq, char gapChar)
{
return new AlignedCodonIterator(seq, gapChar);
}
+ /**
+ * Readable representation for debugging only, not guaranteed not to change
+ */
+ @Override
+ public String toString()
+ {
+ return String.format("%s %s", this.map.toString(), this.to == null ? ""
+ : this.to.getName());
+ }
+
}
--- /dev/null
+package jalview.datamodel;
+
+/**
+ * An enumeration of the kinds of mapping (from nucleotide or peptide, to
+ * nucleotide or peptide), and the corresponding word lengths
+ */
+public enum MappingType
+{
+ NucleotideToPeptide(3, 1)
+ {
+ @Override
+ public MappingType getInverse()
+ {
+ return PeptideToNucleotide;
+ }
+ },
+ PeptideToNucleotide(1, 3)
+ {
+ @Override
+ public MappingType getInverse()
+ {
+ return NucleotideToPeptide;
+ }
+ },
+ NucleotideToNucleotide(1, 1)
+ {
+ @Override
+ public MappingType getInverse()
+ {
+ return NucleotideToNucleotide;
+ }
+ },
+ PeptideToPeptide(1, 1)
+ {
+ @Override
+ public MappingType getInverse()
+ {
+ return PeptideToPeptide;
+ }
+ };
+
+ private int fromRatio;
+
+ private int toRatio;
+
+ private MappingType(int fromSize, int toSize)
+ {
+ fromRatio = fromSize;
+ toRatio = toSize;
+ }
+
+ public abstract MappingType getInverse();
+
+ public int getFromRatio()
+ {
+ return fromRatio;
+ }
+
+ public int getToRatio()
+ {
+ return toRatio;
+ }
+}
public Match(SequenceI seq, int start, int end)
{
sequence = seq;
- this.start = start;
- this.end = end;
+
+ /*
+ * always hold in forwards order, even if given in reverse order
+ * (such as from a mapping to a reverse strand); this avoids
+ * trouble for routines that highlight search results etc
+ */
+ if (start <= end)
+ {
+ this.start = start;
+ this.end = end;
+ }
+ else
+ {
+ this.start = end;
+ this.end = start;
+ }
}
public SequenceI getSequence()
}
if (seq.getAllPDBEntries() != null)
{
- Vector ids = seq.getAllPDBEntries();
- Enumeration e = ids.elements();
- while (e.hasMoreElements())
+ Vector<PDBEntry> ids = seq.getAllPDBEntries();
+ for (PDBEntry pdb : ids)
{
- this.addPDBId(new PDBEntry((PDBEntry) e.nextElement()));
+ this.addPDBId(new PDBEntry(pdb));
}
}
}
@Override
public synchronized void addSequenceFeature(SequenceFeature sf)
{
+ // TODO add to dataset sequence instead if there is one?
if (sequenceFeatures == null)
{
sequenceFeatures = new SequenceFeature[0];
}
/**
- * DOCUMENT ME!
- *
- * @param i
- * DOCUMENT ME!
+ * Returns the character of the aligned sequence at the given position (base
+ * zero), or space if the position is not within the sequence's bounds
*
- * @return DOCUMENT ME!
+ * @return
*/
@Override
public char getCharAt(int i)
{
- if (i < sequence.length)
+ if (i >= 0 && i < sequence.length)
{
return sequence[i];
}
@Override
public void addDBRef(DBRefEntry entry)
{
+ // TODO add to dataset sequence instead if there is one?
if (dbrefs == null)
{
dbrefs = new DBRefEntry[0];
@Override
public void setDatasetSequence(SequenceI seq)
{
+ // TODO check for circular reference before setting?
datasetSequence = seq;
}
*/
package jalview.datamodel;
-public class SequenceDummy extends Sequence implements SequenceI
+public class SequenceDummy extends Sequence
{
public SequenceDummy(String sequenceId)
{
{
return dummy;
}
+
+ /**
+ * Always suppress /start-end for display name as we don't know it
+ */
+ @Override
+ public String getDisplayId(boolean jvsuffix)
+ {
+ // required for correct behaviour of SequenceIdMatcher
+ return super.getDisplayId(false);
+ }
}
*/
package jalview.datamodel;
-import java.util.Hashtable;
+import java.util.HashMap;
+import java.util.Map;
import java.util.Vector;
/**
*/
public class SequenceFeature
{
+ private static final String STATUS = "status";
+
+ private static final String STRAND = "STRAND";
+
+ // private key for Phase designed not to conflict with real GFF data
+ private static final String PHASE = "!Phase";
+
+ private static final String ATTRIBUTES = "ATTRIBUTES";
+
public int begin;
public int end;
public String description;
- public Hashtable otherDetails;
+ public Map<String, Object> otherDetails;
public Vector<String> links;
}
/**
- * Constructs a duplicate feature. Note: Uses clone on the otherDetails so
- * only shallow copies are made of additional properties and method will
- * silently fail if unclonable objects are found in the hash.
+ * Constructs a duplicate feature. Note: Uses makes a shallow copy of the
+ * otherDetails map, so the new and original SequenceFeature may reference the
+ * same objects in the map.
*
* @param cpy
*/
{
try
{
- otherDetails = (Hashtable) cpy.otherDetails.clone();
+ otherDetails = (Map<String, Object>) ((HashMap<String, Object>) cpy.otherDetails)
+ .clone();
} catch (Exception e)
{
- // Uncloneable objects in the otherDetails - don't complain
+ // ignore
}
}
if (cpy.links != null && cpy.links.size() > 0)
{
this.type = type;
this.description = desc;
- setValue("status", status);
+ setValue(STATUS, status);
this.begin = begin;
this.end = end;
this.featureGroup = featureGroup;
this.featureGroup = featureGroup;
}
- public boolean equals(SequenceFeature sf)
+ /**
+ * Two features are considered equal if they have the same type, group,
+ * description, start, end, phase, strand, and (if present) 'Name', ID' and
+ * 'Parent' attributes.
+ *
+ * Note we need to check Parent to distinguish the same exon occurring in
+ * different transcripts (in Ensembl GFF). This allows assembly of transcript
+ * sequences from their component exon regions.
+ */
+ @Override
+ public boolean equals(Object o)
+ {
+ return equals(o, false);
+ }
+
+ /**
+ * Overloaded method allows the equality test to optionally ignore the
+ * 'Parent' attribute of a feature. This supports avoiding adding many
+ * superficially duplicate 'exon' or CDS features to genomic or protein
+ * sequence.
+ *
+ * @param o
+ * @param ignoreParent
+ * @return
+ */
+ public boolean equals(Object o, boolean ignoreParent)
{
+ if (o == null || !(o instanceof SequenceFeature))
+ {
+ return false;
+ }
+
+ SequenceFeature sf = (SequenceFeature) o;
if (begin != sf.begin || end != sf.end || score != sf.score)
{
return false;
}
- if (!(type + description + featureGroup).equals(sf.type
- + sf.description + sf.featureGroup))
+ if (getStrand() != sf.getStrand())
{
return false;
}
+ if (!(type + description + featureGroup + getPhase()).equals(sf.type
+ + sf.description + sf.featureGroup + sf.getPhase()))
+ {
+ return false;
+ }
+ if (!equalAttribute(getValue("ID"), sf.getValue("ID")))
+ {
+ return false;
+ }
+ if (!equalAttribute(getValue("Name"), sf.getValue("Name")))
+ {
+ return false;
+ }
+ if (!ignoreParent)
+ {
+ if (!equalAttribute(getValue("Parent"), sf.getValue("Parent")))
+ {
+ return false;
+ }
+ }
return true;
}
/**
+ * Returns true if both values are null, are both non-null and equal
+ *
+ * @param att1
+ * @param att2
+ * @return
+ */
+ protected static boolean equalAttribute(Object att1, Object att2)
+ {
+ if (att1 == null && att2 == null)
+ {
+ return true;
+ }
+ if (att1 != null)
+ {
+ return att1.equals(att2);
+ }
+ return att2.equals(att1);
+ }
+
+ /**
* DOCUMENT ME!
*
* @return DOCUMENT ME!
}
/**
- * Used for getting values which are not in the basic set. eg STRAND, FRAME
+ * Used for getting values which are not in the basic set. eg STRAND, PHASE
* for GFF file
*
* @param key
}
/**
+ * Returns a property value for the given key if known, else the specified
+ * default value
+ *
+ * @param key
+ * @param defaultValue
+ * @return
+ */
+ public Object getValue(String key, Object defaultValue)
+ {
+ Object value = getValue(key);
+ return value == null ? defaultValue : value;
+ }
+
+ /**
* Used for setting values which are not in the basic set. eg STRAND, FRAME
* for GFF file
*
{
if (otherDetails == null)
{
- otherDetails = new Hashtable();
+ otherDetails = new HashMap<String, Object>();
}
otherDetails.put(key, value);
*/
public void setStatus(String status)
{
- setValue("status", status);
+ setValue(STATUS, status);
}
public String getStatus()
{
- if (otherDetails != null)
- {
- String stat = (String) otherDetails.get("status");
- if (stat != null)
- {
- return new String(stat);
- }
- }
- return null;
+ return (String) getValue(STATUS);
+ }
+
+ public void setAttributes(String attr)
+ {
+ setValue(ATTRIBUTES, attr);
+ }
+
+ public String getAttributes()
+ {
+ return (String) getValue(ATTRIBUTES);
}
public void setPosition(int pos)
return begin;
}
+ /**
+ * Return 1 for forward strand ('+' in GFF), -1 for reverse strand ('-' in
+ * GFF), and 0 for unknown or not (validly) specified
+ *
+ * @return
+ */
public int getStrand()
{
- String str;
- if (otherDetails == null
- || (str = otherDetails.get("STRAND").toString()) == null)
- {
- return 0;
- }
- if (str.equals("-"))
- {
- return -1;
- }
- if (str.equals("+"))
+ int strand = 0;
+ if (otherDetails != null)
{
- return 1;
+ Object str = otherDetails.get(STRAND);
+ if ("-".equals(str))
+ {
+ strand = -1;
+ }
+ else if ("+".equals(str))
+ {
+ strand = 1;
+ }
}
- return 0;
+ return strand;
+ }
+
+ public void setStrand(String strand)
+ {
+ setValue(STRAND, strand);
+ }
+
+ public void setPhase(String phase)
+ {
+ setValue(PHASE, phase);
+ }
+
+ public String getPhase()
+ {
+ return (String) getValue(PHASE);
}
+ /**
+ * Readable representation, for debug only, not guaranteed not to change
+ * between versions
+ */
+ @Override
+ public String toString()
+ {
+ return String.format("%d %d %s %s", getBegin(), getEnd(), getType(),
+ getDescription());
+ }
+
+ /**
+ * Overridden to ensure that whenever two objects are equal, they have the
+ * same hashCode
+ */
+ @Override
+ public int hashCode()
+ {
+ String s = getType() + getDescription() + getFeatureGroup()
+ + getValue("ID") + getValue("Name") + getValue("Parent")
+ + getPhase();
+ return s.hashCode() + getBegin() + getEnd() + (int) getScore()
+ + getStrand();
+ }
}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.datamodel.SequenceFeature;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyI;
+
+import java.util.Arrays;
+import java.util.List;
+
+import com.stevesoft.pat.Regex;
+
+/**
+ * A client to fetch CDNA sequence from Ensembl (i.e. that part of the genomic
+ * sequence that is transcribed to RNA, but not necessarily translated to
+ * protein)
+ *
+ * @author gmcarstairs
+ *
+ */
+public class EnsemblCdna extends EnsemblSeqProxy
+{
+ private static final List<String> CROSS_REFERENCES = Arrays
+ .asList(new String[] { "Uniprot/SWISSPROT", "Uniprot/SPTREMBL" });
+
+ /*
+ * accepts ENST or ENSTG with 11 digits
+ * or ENSMUST or similar for other species
+ * or CCDSnnnnn.nn with at least 3 digits
+ */
+ private static final Regex ACCESSION_REGEX = new Regex(
+ "(ENS([A-Z]{3}|)[TG][0-9]{11}$)" + "|" + "(CCDS[0-9.]{3,}$)");
+
+ /*
+ * fetch exon features on genomic sequence (to identify the cdna regions)
+ * and cds and variation features (to retain)
+ */
+ private static final EnsemblFeatureType[] FEATURES_TO_FETCH = {
+ EnsemblFeatureType.exon, EnsemblFeatureType.cds,
+ EnsemblFeatureType.variation };
+
+ /**
+ * Default constructor (to use rest.ensembl.org)
+ */
+ public EnsemblCdna()
+ {
+ super();
+ }
+
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param d
+ */
+ public EnsemblCdna(String d)
+ {
+ super(d);
+ }
+
+ @Override
+ public String getDbName()
+ {
+ return "ENSEMBL (CDNA)";
+ }
+
+ @Override
+ protected EnsemblSeqType getSourceEnsemblType()
+ {
+ return EnsemblSeqType.CDNA;
+ }
+
+ @Override
+ public Regex getAccessionValidator()
+ {
+ return ACCESSION_REGEX;
+ }
+
+ @Override
+ protected EnsemblFeatureType[] getFeaturesToFetch()
+ {
+ return FEATURES_TO_FETCH;
+ }
+
+ /**
+ * Answers true unless the feature type is 'transcript' (or a sub-type in the
+ * Sequence Ontology).
+ */
+ @Override
+ protected boolean retainFeature(SequenceFeature sf, String accessionId)
+ {
+ if (isTranscript(sf.getType()))
+ {
+ return false;
+ }
+ return featureMayBelong(sf, accessionId);
+ }
+
+ /**
+ * Answers true if the sequence feature type is 'exon' (or a subtype of exon
+ * in the Sequence Ontology), and the Parent of the feature is the transcript
+ * we are retrieving
+ */
+ @Override
+ protected boolean identifiesSequence(SequenceFeature sf, String accId)
+ {
+ if (SequenceOntologyFactory.getInstance().isA(sf.getType(),
+ SequenceOntologyI.EXON))
+ {
+ String parentFeature = (String) sf.getValue(PARENT);
+ if (("transcript:" + accId).equals(parentFeature))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ @Override
+ protected List<String> getCrossReferenceDatabases()
+ {
+ return CROSS_REFERENCES;
+ // 30/01/16 also found Vega_transcript, OTTT, ENS_LRG_transcript, UCSC,
+ // HGNC_trans_name, RefSeq_mRNA, RefSeq_mRNA_predicted
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyI;
+
+import java.util.ArrayList;
+import java.util.List;
+
+/**
+ * A client for direct fetching of CDS sequences from Ensembl (i.e. that part of
+ * the genomic sequence that is translated to protein)
+ *
+ * TODO: not currently used as CDS sequences are computed from CDS features on
+ * transcripts - delete this class?
+ *
+ * @author gmcarstairs
+ *
+ */
+public class EnsemblCds extends EnsemblSeqProxy
+{
+ /*
+ * fetch cds features on genomic sequence (to identify the CDS regions)
+ * and exon and variation features (to retain for display)
+ */
+ private static final EnsemblFeatureType[] FEATURES_TO_FETCH = {
+ EnsemblFeatureType.cds, EnsemblFeatureType.exon,
+ EnsemblFeatureType.variation };
+
+ /**
+ * Default constructor (to use rest.ensembl.org)
+ */
+ public EnsemblCds()
+ {
+ super();
+ }
+
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param d
+ */
+ public EnsemblCds(String d)
+ {
+ super(d);
+ }
+
+ @Override
+ public String getDbName()
+ {
+ return "ENSEMBL (CDS)";
+ }
+
+ @Override
+ protected EnsemblSeqType getSourceEnsemblType()
+ {
+ return EnsemblSeqType.CDS;
+ }
+
+ @Override
+ protected EnsemblFeatureType[] getFeaturesToFetch()
+ {
+ return FEATURES_TO_FETCH;
+ }
+
+ /**
+ * Answers true unless the feature type is 'CDS' (or a sub-type of CDS in the
+ * Sequence Ontology). CDS features are only retrieved in order to identify
+ * the cds sequence range, and are redundant information on the cds sequence
+ * itself.
+ */
+ @Override
+ protected boolean retainFeature(SequenceFeature sf, String accessionId)
+ {
+ if (SequenceOntologyFactory.getInstance().isA(sf.getType(),
+ SequenceOntologyI.CDS))
+ {
+ return false;
+ }
+ return featureMayBelong(sf, accessionId);
+ }
+
+ /**
+ * Answers true if the sequence feature type is 'CDS' (or a subtype of CDS in
+ * the Sequence Ontology), and the Parent of the feature is the transcript we
+ * are retrieving
+ */
+ @Override
+ protected boolean identifiesSequence(SequenceFeature sf, String accId)
+ {
+ if (SequenceOntologyFactory.getInstance().isA(sf.getType(),
+ SequenceOntologyI.CDS))
+ {
+ String parentFeature = (String) sf.getValue(PARENT);
+ if (("transcript:" + accId).equals(parentFeature))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * Overrides this method to trivially return a range which is the whole of the
+ * nucleotide sequence. This is both faster than scanning for CDS features,
+ * and also means we don't need to keep CDS features on CDS sequence (where
+ * they are redundant information).
+ */
+ protected List<int[]> getCdsRanges(SequenceI dnaSeq)
+ {
+ int len = dnaSeq.getLength();
+ List<int[]> ranges = new ArrayList<int[]>();
+ ranges.add(new int[] { 1, len });
+ return ranges;
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.datamodel.Alignment;
+import jalview.datamodel.AlignmentI;
+import jalview.io.FeaturesFile;
+import jalview.io.FileParse;
+
+import java.io.IOException;
+import java.net.MalformedURLException;
+import java.net.URL;
+import java.util.ArrayList;
+import java.util.List;
+
+/**
+ * A client for fetching and processing Ensembl feature data in GFF format by
+ * calling the overlap REST service
+ *
+ * @author gmcarstairs
+ * @see http://rest.ensembl.org/documentation/info/overlap_id
+ */
+class EnsemblFeatures extends EnsemblRestClient
+{
+ /*
+ * The default features to retrieve from Ensembl
+ * can override in getSequenceRecords parameter
+ */
+ private EnsemblFeatureType[] featuresWanted = { EnsemblFeatureType.cds,
+ EnsemblFeatureType.exon, EnsemblFeatureType.variation };
+
+ /**
+ * Default constructor (to use rest.ensembl.org)
+ */
+ public EnsemblFeatures()
+ {
+ super();
+ }
+
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param d
+ */
+ public EnsemblFeatures(String d)
+ {
+ super(d);
+ }
+
+ @Override
+ public String getDbName()
+ {
+ return "ENSEMBL (features)";
+ }
+
+ /**
+ * Makes a query to the REST overlap endpoint for the given sequence
+ * identifier. This returns an 'alignment' consisting of one 'dummy sequence'
+ * (the genomic sequence for which overlap features are returned by the
+ * service). This sequence will have on it sequence features which are the
+ * real information of interest, such as CDS regions or sequence variations.
+ */
+ @Override
+ public AlignmentI getSequenceRecords(String query) throws IOException
+ {
+ // TODO: use a vararg String... for getSequenceRecords instead?
+ List<String> queries = new ArrayList<String>();
+ queries.add(query);
+ FileParse fp = getSequenceReader(queries);
+ FeaturesFile fr = new FeaturesFile(fp);
+ return new Alignment(fr.getSeqsAsArray());
+ }
+
+ /**
+ * Returns a URL for the REST overlap endpoint
+ *
+ * @param ids
+ * @return
+ */
+ @Override
+ protected URL getUrl(List<String> ids) throws MalformedURLException
+ {
+ StringBuffer urlstring = new StringBuffer(128);
+ urlstring.append(getDomain()).append("/overlap/id/")
+ .append(ids.get(0));
+
+ // @see https://github.com/Ensembl/ensembl-rest/wiki/Output-formats
+ urlstring.append("?content-type=text/x-gff3");
+
+ /*
+ * specify features to retrieve
+ * @see http://rest.ensembl.org/documentation/info/overlap_id
+ * could make the list a configurable entry in jalview.properties
+ */
+ for (EnsemblFeatureType feature : featuresWanted)
+ {
+ urlstring.append("&feature=").append(feature.name());
+ }
+
+ return new URL(urlstring.toString());
+ }
+
+ @Override
+ protected boolean useGetRequest()
+ {
+ return true;
+ }
+
+ /**
+ * Returns the MIME type for GFF3. For GET requests the Content-type header
+ * describes the required encoding of the response.
+ */
+ @Override
+ protected String getRequestMimeType(boolean multipleIds)
+ {
+ return "text/x-gff3";
+ }
+
+ /**
+ * Returns the MIME type for GFF3.
+ */
+ @Override
+ protected String getResponseMimeType()
+ {
+ return "text/x-gff3";
+ }
+
+ /**
+ * Overloaded method that allows a list of features to retrieve to be
+ * specified
+ *
+ * @param accId
+ * @param features
+ * @return
+ * @throws IOException
+ */
+ protected AlignmentI getSequenceRecords(String accId,
+ EnsemblFeatureType[] features) throws IOException
+ {
+ featuresWanted = features;
+ return getSequenceRecords(accId);
+ }
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.api.FeatureColourI;
+import jalview.api.FeatureSettingsI;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyI;
+import jalview.schemes.FeatureColourAdapter;
+import jalview.schemes.FeatureSettingsAdapter;
+import jalview.util.MapList;
+import jalview.util.StringUtils;
+
+import java.awt.Color;
+import java.io.UnsupportedEncodingException;
+import java.net.URLDecoder;
+import java.util.ArrayList;
+import java.util.Arrays;
+import java.util.List;
+
+import com.stevesoft.pat.Regex;
+
+/**
+ * A class that fetches genomic sequence and all transcripts for an Ensembl gene
+ *
+ * @author gmcarstairs
+ */
+public class EnsemblGene extends EnsemblSeqProxy
+{
+ private static final List<String> CROSS_REFERENCES = Arrays
+ .asList(new String[] { "CCDS" });
+
+ private static final String GENE_PREFIX = "gene:";
+
+ /*
+ * accepts anything as we will attempt lookup of gene or
+ * transcript id or gene name
+ */
+ private static final Regex ACCESSION_REGEX = new Regex(".*");
+
+ private static final EnsemblFeatureType[] FEATURES_TO_FETCH = {
+ EnsemblFeatureType.gene, EnsemblFeatureType.transcript,
+ EnsemblFeatureType.exon, EnsemblFeatureType.cds,
+ EnsemblFeatureType.variation };
+
+ /**
+ * Default constructor (to use rest.ensembl.org)
+ */
+ public EnsemblGene()
+ {
+ super();
+ }
+
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param d
+ */
+ public EnsemblGene(String d)
+ {
+ super(d);
+ }
+
+ @Override
+ public String getDbName()
+ {
+ return "ENSEMBL";
+ }
+
+ @Override
+ protected EnsemblFeatureType[] getFeaturesToFetch()
+ {
+ return FEATURES_TO_FETCH;
+ }
+
+ @Override
+ protected EnsemblSeqType getSourceEnsemblType()
+ {
+ return EnsemblSeqType.GENOMIC;
+ }
+
+ /**
+ * Returns an alignment containing the gene(s) for the given gene or
+ * transcript identifier, or external identifier (e.g. Uniprot id). If given a
+ * gene name or external identifier, returns any related gene sequences found
+ * for model organisms. If only a single gene is queried for, then its
+ * transcripts are also retrieved and added to the alignment. <br>
+ * Method:
+ * <ul>
+ * <li>resolves a transcript identifier by looking up its parent gene id</li>
+ * <li>resolves an external identifier by looking up xref-ed gene ids</li>
+ * <li>fetches the gene sequence</li>
+ * <li>fetches features on the sequence</li>
+ * <li>identifies "transcript" features whose Parent is the requested gene</li>
+ * <li>fetches the transcript sequence for each transcript</li>
+ * <li>makes a mapping from the gene to each transcript</li>
+ * <li>copies features from gene to transcript sequences</li>
+ * <li>fetches the protein sequence for each transcript, maps and saves it as
+ * a cross-reference</li>
+ * <li>aligns each transcript against the gene sequence based on the position
+ * mappings</li>
+ * </ul>
+ *
+ * @param query
+ * one or more identifiers separated by a space
+ * @return an alignment containing one or more genes, and possibly
+ * transcripts, or null
+ */
+ @Override
+ public AlignmentI getSequenceRecords(String query) throws Exception
+ {
+ // todo: tidy up handling of one or multiple accession ids
+ String[] queries = query.split(getAccessionSeparator());
+
+ /*
+ * if given a transcript id, look up its gene parent
+ */
+ if (isTranscriptIdentifier(query))
+ {
+ // we are assuming all transcripts have the same gene parent here
+ query = new EnsemblLookup(getDomain()).getParent(queries[0]);
+ if (query == null)
+ {
+ return null;
+ }
+ }
+
+ /*
+ * if given a gene or other external name, lookup and fetch
+ * the corresponding gene for all model organisms
+ */
+ if (!isGeneIdentifier(query))
+ {
+ List<String> geneIds = new EnsemblSymbol(getDomain()).getIds(query);
+ if (geneIds.isEmpty())
+ {
+ return null;
+ }
+ String theIds = StringUtils.listToDelimitedString(geneIds,
+ getAccessionSeparator());
+ return getSequenceRecords(theIds);
+ }
+
+ /*
+ * fetch the gene sequence(s) with features and xrefs
+ */
+ AlignmentI al = super.getSequenceRecords(query);
+
+ /*
+ * if we retrieved a single gene, get its transcripts as well
+ */
+ if (al.getHeight() == 1)
+ {
+ getTranscripts(al, query);
+ }
+
+ return al;
+ }
+
+ /**
+ * Attempts to get Ensembl stable identifiers for model organisms for a gene
+ * name by calling the xrefs symbol REST service to resolve the gene name.
+ *
+ * @param query
+ * @return
+ */
+ protected String getGeneIdentifiersForName(String query)
+ {
+ List<String> ids = new EnsemblSymbol(getDomain()).getIds(query);
+ if (ids != null)
+ {
+ for (String id : ids)
+ {
+ if (isGeneIdentifier(id))
+ {
+ return id;
+ }
+ }
+ }
+ return null;
+ }
+
+ /**
+ * Constructs all transcripts for the gene, as identified by "transcript"
+ * features whose Parent is the requested gene. The coding transcript
+ * sequences (i.e. with introns omitted) are added to the alignment.
+ *
+ * @param al
+ * @param accId
+ * @throws Exception
+ */
+ protected void getTranscripts(AlignmentI al, String accId)
+ throws Exception
+ {
+ SequenceI gene = al.getSequenceAt(0);
+ List<SequenceFeature> transcriptFeatures = getTranscriptFeatures(accId,
+ gene);
+
+ for (SequenceFeature transcriptFeature : transcriptFeatures)
+ {
+ makeTranscript(transcriptFeature, al, gene);
+ }
+
+ clearGeneFeatures(gene);
+ }
+
+ /**
+ * Remove unwanted features (transcript, exon, CDS) from the gene sequence
+ * after we have used them to derive transcripts and transfer features
+ *
+ * @param gene
+ */
+ protected void clearGeneFeatures(SequenceI gene)
+ {
+ SequenceFeature[] sfs = gene.getSequenceFeatures();
+ if (sfs != null)
+ {
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ List<SequenceFeature> filtered = new ArrayList<SequenceFeature>();
+ for (SequenceFeature sf : sfs)
+ {
+ String type = sf.getType();
+ if (!isTranscript(type) && !so.isA(type, SequenceOntologyI.EXON)
+ && !so.isA(type, SequenceOntologyI.CDS))
+ {
+ filtered.add(sf);
+ }
+ }
+ gene.setSequenceFeatures(filtered
+ .toArray(new SequenceFeature[filtered
+ .size()]));
+ }
+ }
+
+ /**
+ * Constructs a spliced transcript sequence by finding 'exon' features for the
+ * given id (or failing that 'CDS'). Copies features on to the new sequence.
+ * 'Aligns' the new sequence against the gene sequence by padding with gaps,
+ * and adds it to the alignment.
+ *
+ * @param transcriptFeature
+ * @param al
+ * the alignment to which to add the new sequence
+ * @param gene
+ * the parent gene sequence, with features
+ * @return
+ */
+ SequenceI makeTranscript(SequenceFeature transcriptFeature,
+ AlignmentI al, SequenceI gene)
+ {
+ String accId = getTranscriptId(transcriptFeature);
+ if (accId == null)
+ {
+ return null;
+ }
+
+ /*
+ * NB we are mapping from gene sequence (not genome), so do not
+ * need to check for reverse strand (gene and transcript sequences
+ * are in forward sense)
+ */
+
+ /*
+ * make a gene-length sequence filled with gaps
+ * we will fill in the bases for transcript regions
+ */
+ char[] seqChars = new char[gene.getLength()];
+ Arrays.fill(seqChars, al.getGapCharacter());
+
+ /*
+ * look for exon features of the transcript, failing that for CDS
+ * (for example ENSG00000124610 has 1 CDS but no exon features)
+ */
+ String parentId = "transcript:" + accId;
+ List<SequenceFeature> splices = findFeatures(gene,
+ SequenceOntologyI.EXON, parentId);
+ if (splices.isEmpty())
+ {
+ splices = findFeatures(gene, SequenceOntologyI.CDS, parentId);
+ }
+
+ int transcriptLength = 0;
+ final char[] geneChars = gene.getSequence();
+ int offset = gene.getStart(); // to convert to 0-based positions
+ List<int[]> mappedFrom = new ArrayList<int[]>();
+
+ for (SequenceFeature sf : splices)
+ {
+ int start = sf.getBegin() - offset;
+ int end = sf.getEnd() - offset;
+ int spliceLength = end - start + 1;
+ System.arraycopy(geneChars, start, seqChars, start, spliceLength);
+ transcriptLength += spliceLength;
+ mappedFrom.add(new int[] { sf.getBegin(), sf.getEnd() });
+ }
+
+ Sequence transcript = new Sequence(accId, seqChars, 1, transcriptLength);
+
+ /*
+ * Ensembl has gene name as transcript Name
+ * EnsemblGenomes doesn't, but has a url-encoded description field
+ */
+ String description = (String) transcriptFeature.getValue(NAME);
+ if (description == null)
+ {
+ description = (String) transcriptFeature.getValue(DESCRIPTION);
+ }
+ if (description != null)
+ {
+ try
+ {
+ transcript.setDescription(URLDecoder.decode(description, "UTF-8"));
+ } catch (UnsupportedEncodingException e)
+ {
+ e.printStackTrace(); // as if
+ }
+ }
+ transcript.createDatasetSequence();
+
+ al.addSequence(transcript);
+
+ /*
+ * transfer features to the new sequence; we use EnsemblCdna to do this,
+ * to filter out unwanted features types (see method retainFeature)
+ */
+ List<int[]> mapTo = new ArrayList<int[]>();
+ mapTo.add(new int[] { 1, transcriptLength });
+ MapList mapping = new MapList(mappedFrom, mapTo, 1, 1);
+ new EnsemblCdna(getDomain()).transferFeatures(
+ gene.getSequenceFeatures(), transcript.getDatasetSequence(),
+ mapping, parentId);
+
+ /*
+ * fetch and save cross-references
+ */
+ new EnsemblCdna(getDomain()).getCrossReferences(transcript);
+
+ /*
+ * and finally fetch the protein product and save as a cross-reference
+ */
+ new EnsemblCdna(getDomain()).addProteinProduct(transcript);
+
+ return transcript;
+ }
+
+ /**
+ * Returns the 'transcript_id' property of the sequence feature (or null)
+ *
+ * @param feature
+ * @return
+ */
+ protected String getTranscriptId(SequenceFeature feature)
+ {
+ return (String) feature.getValue("transcript_id");
+ }
+
+ /**
+ * Returns a list of the transcript features on the sequence whose Parent is
+ * the gene for the accession id.
+ *
+ * @param accId
+ * @param geneSequence
+ * @return
+ */
+ protected List<SequenceFeature> getTranscriptFeatures(String accId,
+ SequenceI geneSequence)
+ {
+ List<SequenceFeature> transcriptFeatures = new ArrayList<SequenceFeature>();
+
+ String parentIdentifier = GENE_PREFIX + accId;
+ SequenceFeature[] sfs = geneSequence.getSequenceFeatures();
+
+ if (sfs != null)
+ {
+ for (SequenceFeature sf : sfs)
+ {
+ if (isTranscript(sf.getType()))
+ {
+ String parent = (String) sf.getValue(PARENT);
+ if (parentIdentifier.equals(parent))
+ {
+ transcriptFeatures.add(sf);
+ }
+ }
+ }
+ }
+
+ return transcriptFeatures;
+ }
+
+ @Override
+ public String getDescription()
+ {
+ return "Fetches all transcripts and variant features for a gene or transcript";
+ }
+
+ /**
+ * Default test query is a gene id (can also enter a transcript id)
+ */
+ @Override
+ public String getTestQuery()
+ {
+ return "ENSG00000157764"; // BRAF, 5 transcripts, reverse strand
+ // ENSG00000090266 // NDUFB2, 15 transcripts, forward strand
+ // ENSG00000101812 // H2BFM histone, 3 transcripts, forward strand
+ // ENSG00000123569 // H2BFWT histone, 2 transcripts, reverse strand
+ }
+
+ /**
+ * Answers true for a feature of type 'gene' (or a sub-type of gene in the
+ * Sequence Ontology), whose ID is the accession we are retrieving
+ */
+ @Override
+ protected boolean identifiesSequence(SequenceFeature sf, String accId)
+ {
+ if (SequenceOntologyFactory.getInstance().isA(sf.getType(),
+ SequenceOntologyI.GENE))
+ {
+ String id = (String) sf.getValue(ID);
+ if ((GENE_PREFIX + accId).equals(id))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * Answers true unless feature type is 'gene', or 'transcript' with a parent
+ * which is a different gene. We need the gene features to identify the range,
+ * but it is redundant information on the gene sequence. Checking the parent
+ * allows us to drop transcript features which belong to different
+ * (overlapping) genes.
+ */
+ @Override
+ protected boolean retainFeature(SequenceFeature sf, String accessionId)
+ {
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ String type = sf.getType();
+ if (so.isA(type, SequenceOntologyI.GENE))
+ {
+ return false;
+ }
+ if (isTranscript(type))
+ {
+ String parent = (String) sf.getValue(PARENT);
+ if (!(GENE_PREFIX + accessionId).equals(parent))
+ {
+ return false;
+ }
+ }
+ return true;
+ }
+
+ /**
+ * Answers false. This allows an optimisation - a single 'gene' feature is all
+ * that is needed to identify the positions of the gene on the genomic
+ * sequence.
+ */
+ @Override
+ protected boolean isSpliceable()
+ {
+ return false;
+ }
+
+ @Override
+ protected List<String> getCrossReferenceDatabases()
+ {
+ // found these for ENSG00000157764 on 30/01/2016:
+ // return new String[] {"Vega_gene", "OTTG", "ENS_LRG_gene", "ArrayExpress",
+ // "EntrezGene", "HGNC", "MIM_GENE", "MIM_MORBID", "WikiGene"};
+ return CROSS_REFERENCES;
+ }
+
+ /**
+ * Override to do nothing as Ensembl doesn't return a protein sequence for a
+ * gene identifier
+ */
+ @Override
+ protected void addProteinProduct(SequenceI querySeq)
+ {
+ }
+
+ @Override
+ public Regex getAccessionValidator()
+ {
+ return ACCESSION_REGEX;
+ }
+
+ @Override
+ public FeatureSettingsI getFeatureColourScheme()
+ {
+ return new FeatureSettingsAdapter()
+ {
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ @Override
+ public boolean isFeatureDisplayed(String type)
+ {
+ return (so.isA(type, SequenceOntologyI.EXON) || so.isA(type,
+ SequenceOntologyI.SEQUENCE_VARIANT));
+ }
+
+ @Override
+ public FeatureColourI getFeatureColour(String type)
+ {
+ if (so.isA(type, SequenceOntologyI.EXON))
+ {
+ return new FeatureColourAdapter()
+ {
+ @Override
+ public boolean isColourByLabel()
+ {
+ return true;
+ }
+ };
+ }
+ if (so.isA(type, SequenceOntologyI.SEQUENCE_VARIANT))
+ {
+ return new FeatureColourAdapter()
+ {
+
+ @Override
+ public Color getColour()
+ {
+ return Color.RED;
+ }
+ };
+ }
+ return null;
+ }
+
+ /**
+ * order to render sequence_variant after exon after the rest
+ */
+ @Override
+ public int compare(String feature1, String feature2)
+ {
+ if (so.isA(feature1, SequenceOntologyI.SEQUENCE_VARIANT))
+ {
+ return +1;
+ }
+ if (so.isA(feature2, SequenceOntologyI.SEQUENCE_VARIANT))
+ {
+ return -1;
+ }
+ if (so.isA(feature1, SequenceOntologyI.EXON))
+ {
+ return +1;
+ }
+ if (so.isA(feature2, SequenceOntologyI.EXON))
+ {
+ return -1;
+ }
+ return 0;
+ }
+ };
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.datamodel.SequenceFeature;
+
+/**
+ * A client to fetch genomic sequence from Ensembl
+ *
+ * TODO: not currently used - delete?
+ *
+ * @author gmcarstairs
+ *
+ */
+public class EnsemblGenome extends EnsemblSeqProxy
+{
+ /*
+ * fetch transcript features on genomic sequence (to identify the transcript
+ * regions) and cds, exon and variation features (to retain)
+ */
+ private static final EnsemblFeatureType[] FEATURES_TO_FETCH = {
+ EnsemblFeatureType.transcript, EnsemblFeatureType.exon,
+ EnsemblFeatureType.cds, EnsemblFeatureType.variation };
+
+ /**
+ * Default constructor (to use rest.ensembl.org)
+ */
+ public EnsemblGenome()
+ {
+ super();
+ }
+
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param d
+ */
+ public EnsemblGenome(String d)
+ {
+ super(d);
+ }
+
+ @Override
+ public String getDbName()
+ {
+ return "ENSEMBL (Genomic)";
+ }
+
+ @Override
+ protected EnsemblSeqType getSourceEnsemblType()
+ {
+ return EnsemblSeqType.GENOMIC;
+ }
+
+ @Override
+ protected EnsemblFeatureType[] getFeaturesToFetch()
+ {
+ return FEATURES_TO_FETCH;
+ }
+
+ /**
+ * Answers true unless the feature type is 'transcript' (or a sub-type of
+ * transcript in the Sequence Ontology), or has a parent other than the given
+ * accession id. Transcript features are only retrieved in order to identify
+ * the transcript sequence range, and are redundant information on the
+ * transcript sequence itself.
+ */
+ @Override
+ protected boolean retainFeature(SequenceFeature sf, String accessionId)
+ {
+ if (isTranscript(sf.getType()))
+ {
+ return false;
+ }
+ return featureMayBelong(sf, accessionId);
+ }
+
+ /**
+ * Answers true if the sequence feature type is 'transcript' (or a subtype of
+ * transcript in the Sequence Ontology), and the ID of the feature is the
+ * transcript we are retrieving
+ */
+ @Override
+ protected boolean identifiesSequence(SequenceFeature sf, String accId)
+ {
+ if (isTranscript(sf.getType()))
+ {
+ String id = (String) sf.getValue(ID);
+ if (("transcript:" + accId).equals(id))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+
+/**
+ * A class to behave much like EnsemblGene but referencing the ensemblgenomes
+ * domain and data
+ *
+ * @author gmcarstairs
+ *
+ */
+public class EnsemblGenomes extends EnsemblGene
+{
+ /**
+ * Constructor sets domain to rest.ensemblgenomes.org instead of the 'usual'
+ * rest.ensembl.org
+ */
+ public EnsemblGenomes()
+ {
+ super(ENSEMBL_GENOMES_REST);
+ }
+
+ @Override
+ public boolean isGeneIdentifier(String query)
+ {
+ return true;
+ }
+
+ @Override
+ public String getDbName()
+ {
+ return "EnsemblGenomes";
+ }
+
+ @Override
+ public String getTestQuery()
+ {
+ return "DDB_G0283883";
+ }
+
+ @Override
+ public String getDbSource()
+ {
+ return "EnsemblGenomes";
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.datamodel.AlignmentI;
+
+import java.io.BufferedReader;
+import java.io.IOException;
+import java.net.MalformedURLException;
+import java.net.URL;
+import java.util.Arrays;
+import java.util.List;
+
+import org.json.simple.JSONObject;
+import org.json.simple.parser.JSONParser;
+import org.json.simple.parser.ParseException;
+
+/**
+ * A client for the Ensembl lookup REST endpoint; used to find the Parent gene
+ * identifier given a transcript identifier.
+ *
+ * @author gmcarstairs
+ *
+ */
+public class EnsemblLookup extends EnsemblRestClient
+{
+
+ /**
+ * Default constructor (to use rest.ensembl.org)
+ */
+ public EnsemblLookup()
+ {
+ super();
+ }
+
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param
+ */
+ public EnsemblLookup(String d)
+ {
+ super(d);
+ }
+
+ @Override
+ public String getDbName()
+ {
+ return "ENSEMBL";
+ }
+
+ @Override
+ public AlignmentI getSequenceRecords(String queries) throws Exception
+ {
+ return null;
+ }
+
+ @Override
+ protected URL getUrl(List<String> ids) throws MalformedURLException
+ {
+ String identifier = ids.get(0);
+ return getUrl(identifier);
+ }
+
+ /**
+ * @param identifier
+ * @return
+ */
+ protected URL getUrl(String identifier)
+ {
+ String url = getDomain() + "/lookup/id/" + identifier
+ + "?content-type=application/json";
+ try
+ {
+ return new URL(url);
+ } catch (MalformedURLException e)
+ {
+ return null;
+ }
+ }
+
+ @Override
+ protected boolean useGetRequest()
+ {
+ return true;
+ }
+
+ @Override
+ protected String getRequestMimeType(boolean multipleIds)
+ {
+ return "application/json";
+ }
+
+ @Override
+ protected String getResponseMimeType()
+ {
+ return "application/json";
+ }
+
+ /**
+ * Calls the Ensembl lookup REST endpoint and retrieves the 'Parent' for the
+ * given identifier, or null if not found
+ *
+ * @param identifier
+ * @return
+ */
+ public String getParent(String identifier)
+ {
+ List<String> ids = Arrays.asList(new String[] { identifier });
+
+ BufferedReader br = null;
+ try
+ {
+ URL url = getUrl(identifier);
+ if (url != null)
+ {
+ br = getHttpResponse(url, ids);
+ }
+ return (parseResponse(br));
+ } catch (IOException e)
+ {
+ // ignore
+ return null;
+ } finally
+ {
+ if (br != null)
+ {
+ try
+ {
+ br.close();
+ } catch (IOException e)
+ {
+ // ignore
+ }
+ }
+ }
+ }
+
+ /**
+ * Parses "Parent" from the JSON response and returns the value, or null if
+ * not found
+ *
+ * @param br
+ * @return
+ * @throws IOException
+ */
+ protected String parseResponse(BufferedReader br) throws IOException
+ {
+ String parent = null;
+ JSONParser jp = new JSONParser();
+ try
+ {
+ JSONObject val = (JSONObject) jp.parse(br);
+ parent = val.get("Parent").toString();
+ } catch (ParseException e)
+ {
+ // ignore
+ }
+ return parent;
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.SequenceFeature;
+
+import java.util.Arrays;
+import java.util.List;
+
+import com.stevesoft.pat.Regex;
+
+/**
+ * A client to fetch protein translated sequence for an Ensembl identifier
+ *
+ * @author gmcarstairs
+ *
+ */
+public class EnsemblProtein extends EnsemblSeqProxy
+{
+ /*
+ * accepts ENSP with 11 digits
+ * or ENSMUSP or similar for other species
+ * or CCDSnnnnn.nn with at least 3 digits
+ */
+ private static final Regex ACCESSION_REGEX = new Regex(
+ "(ENS([A-Z]{3}|)P[0-9]{11}$)" + "|" + "(CCDS[0-9.]{3,}$)");
+
+ private static final List<String> CROSSREFS = Arrays.asList(new String[] {
+ "PDB", "Uniprot/SPTREMBL", "Uniprot/SWISSPROT" });
+
+ /**
+ * Default constructor (to use rest.ensembl.org)
+ */
+ public EnsemblProtein()
+ {
+ super();
+ }
+
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param d
+ */
+ public EnsemblProtein(String d)
+ {
+ super(d);
+ }
+
+ @Override
+ public String getDbName()
+ {
+ return "ENSEMBL (Protein)";
+ }
+
+ @Override
+ protected EnsemblSeqType getSourceEnsemblType()
+ {
+ return EnsemblSeqType.PROTEIN;
+ }
+
+ /**
+ * Returns false, as this fetcher does not retrieve DNA sequences.
+ */
+ @Override
+ public boolean isDnaCoding()
+ {
+ return false;
+ }
+
+ /**
+ * Test query is to the protein translation of transcript ENST00000288602
+ */
+ @Override
+ public String getTestQuery()
+ {
+ return "ENSP00000288602";
+ }
+
+ /**
+ * Overrides base class method to do nothing - genomic features are not
+ * applicable to the protein product sequence
+ */
+ @Override
+ protected void addFeaturesAndProduct(String accId, AlignmentI alignment)
+ {
+ }
+
+ @Override
+ protected EnsemblFeatureType[] getFeaturesToFetch()
+ {
+ // not applicable - can't fetch genomic features for a protein sequence
+ return null;
+ }
+
+ @Override
+ protected boolean identifiesSequence(SequenceFeature sf, String accId)
+ {
+ // not applicable - protein sequence is not a 'subset' of genomic sequence
+ return false;
+ }
+
+ @Override
+ protected List<String> getCrossReferenceDatabases()
+ {
+ return CROSSREFS;
+ }
+
+ @Override
+ public Regex getAccessionValidator()
+ {
+ return ACCESSION_REGEX;
+ }
+
+ /**
+ * Returns an accession id for a query, including conversion of ENST* to
+ * ENSP*. This supports querying for the protein sequence for a transcript
+ * (ENST identifier) and returning the ENSP identifier.
+ */
+ @Override
+ public String getAccessionIdFromQuery(String query)
+ {
+ String accId = super.getAccessionIdFromQuery(query);
+
+ /*
+ * ensure last character before (11) digits is P
+ * ENST00000288602 -> ENSP00000288602
+ * ENSMUST00000288602 -> ENSMUSP00000288602
+ */
+ if (accId != null && accId.length() >= 12)
+ {
+ char[] chars = accId.toCharArray();
+ chars[chars.length - 12] = 'P';
+ accId = new String(chars);
+ }
+ return accId;
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.io.FileParse;
+
+import java.io.BufferedReader;
+import java.io.DataOutputStream;
+import java.io.IOException;
+import java.io.InputStream;
+import java.io.InputStreamReader;
+import java.net.HttpURLConnection;
+import java.net.MalformedURLException;
+import java.net.URL;
+import java.util.List;
+
+import javax.ws.rs.HttpMethod;
+
+import com.stevesoft.pat.Regex;
+
+/**
+ * Base class for Ensembl REST service clients
+ *
+ * @author gmcarstairs
+ */
+abstract class EnsemblRestClient extends EnsemblSequenceFetcher
+{
+ private final static String ENSEMBL_REST = "http://rest.ensembl.org";
+
+ protected final static String ENSEMBL_GENOMES_REST = "http://rest.ensemblgenomes.org";
+
+ // @see https://github.com/Ensembl/ensembl-rest/wiki/Output-formats
+ private static final String PING_URL = "http://rest.ensembl.org/info/ping.json";
+
+ private final static long RETEST_INTERVAL = 10000L; // 10 seconds
+
+ private static final Regex TRANSCRIPT_REGEX = new Regex(
+ "(ENS)([A-Z]{3}|)T[0-9]{11}$");
+
+ private static final Regex GENE_REGEX = new Regex(
+ "(ENS)([A-Z]{3}|)G[0-9]{11}$");
+
+ private String domain = ENSEMBL_REST;
+
+ private static boolean ensemblRestAvailable = false;
+
+ private static long lastCheck = -1;
+
+ /*
+ * absolute time to wait till if we overloaded the REST service
+ */
+ private static long retryAfter;
+
+ protected volatile boolean inProgress = false;
+
+ /**
+ * Default constructor to use rest.ensembl.org
+ */
+ public EnsemblRestClient()
+ {
+ this(ENSEMBL_REST);
+ }
+
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param d
+ */
+ public EnsemblRestClient(String d)
+ {
+ domain = d;
+ }
+
+ String getDomain()
+ {
+ return domain;
+ }
+
+ void setDomain(String d)
+ {
+ domain = d;
+ }
+
+ public boolean isTranscriptIdentifier(String query)
+ {
+ return query == null ? false : TRANSCRIPT_REGEX.search(query);
+ }
+
+ public boolean isGeneIdentifier(String query)
+ {
+ return query == null ? false : GENE_REGEX.search(query);
+ }
+
+ @Override
+ public boolean queryInProgress()
+ {
+ return inProgress;
+ }
+
+ @Override
+ public StringBuffer getRawRecords()
+ {
+ return null;
+ }
+
+ /**
+ * Returns the URL for the client http request
+ *
+ * @param ids
+ * @return
+ * @throws MalformedURLException
+ */
+ protected abstract URL getUrl(List<String> ids)
+ throws MalformedURLException;
+
+ /**
+ * Returns true if client uses GET method, false if it uses POST
+ *
+ * @return
+ */
+ protected abstract boolean useGetRequest();
+
+ /**
+ * Return the desired value for the Content-Type request header
+ *
+ * @param multipleIds
+ *
+ * @return
+ * @see https://github.com/Ensembl/ensembl-rest/wiki/HTTP-Headers
+ */
+ protected abstract String getRequestMimeType(boolean multipleIds);
+
+ /**
+ * Return the desired value for the Accept request header
+ *
+ * @return
+ * @see https://github.com/Ensembl/ensembl-rest/wiki/HTTP-Headers
+ */
+ protected abstract String getResponseMimeType();
+
+ /**
+ * Tries to connect to Ensembl's REST 'ping' endpoint, and returns true if
+ * successful, else false
+ *
+ * @return
+ */
+ private boolean checkEnsembl()
+ {
+ try
+ {
+ // note this format works for both ensembl and ensemblgenomes
+ // info/ping.json works for ensembl only (March 2016)
+ URL ping = new URL(getDomain()
+ + "/info/ping?content-type=application/json");
+ HttpURLConnection conn = (HttpURLConnection) ping.openConnection();
+ int rc = conn.getResponseCode();
+ conn.disconnect();
+ if (rc >= 200 && rc < 300)
+ {
+ return true;
+ }
+ } catch (Throwable t)
+ {
+ System.err.println("Error connecting to " + PING_URL + ": "
+ + t.getMessage());
+ }
+ return false;
+ }
+
+ /**
+ * returns a reader to a Fasta response from the Ensembl sequence endpoint
+ *
+ * @param ids
+ * @return
+ * @throws IOException
+ */
+ protected FileParse getSequenceReader(List<String> ids)
+ throws IOException
+ {
+ URL url = getUrl(ids);
+
+ BufferedReader reader = getHttpResponse(url, ids);
+ FileParse fp = new FileParse(reader, url.toString(), "HTTP_POST");
+ return fp;
+ }
+
+ /**
+ * Writes the HTTP request and gets the response as a reader.
+ *
+ * @param url
+ * @param ids
+ * written as Json POST body if more than one
+ * @return
+ * @throws IOException
+ * if response code was not 200, or other I/O error
+ */
+ protected BufferedReader getHttpResponse(URL url, List<String> ids)
+ throws IOException
+ {
+ // long now = System.currentTimeMillis();
+ HttpURLConnection connection = (HttpURLConnection) url.openConnection();
+
+ /*
+ * POST method allows multiple queries in one request; it is supported for
+ * sequence queries, but not for overlap
+ */
+ boolean multipleIds = ids.size() > 1;// useGetRequest();
+ connection.setRequestMethod(multipleIds ? HttpMethod.POST
+ : HttpMethod.GET);
+ connection.setRequestProperty("Content-Type",
+ getRequestMimeType(multipleIds));
+ connection.setRequestProperty("Accept", getResponseMimeType());
+
+ connection.setUseCaches(false);
+ connection.setDoInput(true);
+ connection.setDoOutput(multipleIds);
+
+ if (multipleIds)
+ {
+ writePostBody(connection, ids);
+ }
+
+ InputStream response = connection.getInputStream();
+ int responseCode = connection.getResponseCode();
+
+ if (responseCode != 200)
+ {
+ /*
+ * note: a GET request for an invalid id returns an error code e.g. 415
+ * but POST request returns 200 and an empty Fasta response
+ */
+ throw new IOException(
+ "Response code was not 200. Detected response was "
+ + responseCode);
+ }
+ // System.out.println(getClass().getName() + " took "
+ // + (System.currentTimeMillis() - now) + "ms to fetch");
+
+ checkRateLimits(connection);
+
+ BufferedReader reader = null;
+ reader = new BufferedReader(new InputStreamReader(response, "UTF-8"));
+ return reader;
+ }
+
+ /**
+ * Inspect response headers for any sign of server overload and respect any
+ * 'retry-after' directive
+ *
+ * @see https://github.com/Ensembl/ensembl-rest/wiki/Rate-Limits
+ * @param connection
+ */
+ void checkRateLimits(HttpURLConnection connection)
+ {
+ // number of requests allowed per time interval:
+ String limit = connection.getHeaderField("X-RateLimit-Limit");
+ // length of quota time interval in seconds:
+ // String period = connection.getHeaderField("X-RateLimit-Period");
+ // seconds remaining until usage quota is reset:
+ String reset = connection.getHeaderField("X-RateLimit-Reset");
+ // number of requests remaining from quota for current period:
+ String remaining = connection.getHeaderField("X-RateLimit-Remaining");
+ // number of seconds to wait before retrying (if remaining == 0)
+ String retryDelay = connection.getHeaderField("Retry-After");
+
+ // to test:
+ // retryDelay = "5";
+
+ if (retryDelay != null)
+ {
+ System.err.println("Ensembl REST service rate limit exceeded, wait "
+ + retryDelay + " seconds before retrying");
+ try
+ {
+ retryAfter = System.currentTimeMillis()
+ + (1000 * Integer.valueOf(retryDelay));
+ } catch (NumberFormatException e)
+ {
+ System.err.println("Unexpected value for Retry-After: "
+ + retryDelay);
+ }
+ }
+ else
+ {
+ retryAfter = 0;
+ // debug:
+ // System.out.println(String.format(
+ // "%s Ensembl requests remaining of %s (reset in %ss)",
+ // remaining, limit, reset));
+ }
+ }
+ /**
+ * Rechecks if Ensembl is responding, unless the last check was successful and
+ * the retest interval has not yet elapsed. Returns true if Ensembl is up,
+ * else false.
+ *
+ * @return
+ */
+ protected boolean isEnsemblAvailable()
+ {
+ long now = System.currentTimeMillis();
+
+ /*
+ * check if we are waiting for 'Retry-After' to expire
+ */
+ if (retryAfter > now)
+ {
+ System.err.println("Still " + (1 + (retryAfter - now) / 1000)
+ + " secs to wait before retrying Ensembl");
+ return false;
+ }
+ else
+ {
+ retryAfter = 0;
+ }
+
+ boolean retest = now - lastCheck > RETEST_INTERVAL;
+ if (ensemblRestAvailable && !retest)
+ {
+ return true;
+ }
+ ensemblRestAvailable = checkEnsembl();
+ lastCheck = now;
+ return ensemblRestAvailable;
+ }
+
+ /**
+ * Constructs, writes and flushes the POST body of the request, containing the
+ * query ids in JSON format
+ *
+ * @param connection
+ * @param ids
+ * @throws IOException
+ */
+ protected void writePostBody(HttpURLConnection connection,
+ List<String> ids) throws IOException
+ {
+ boolean first;
+ StringBuilder postBody = new StringBuilder(64);
+ postBody.append("{\"ids\":[");
+ first = true;
+ for (String id : ids)
+ {
+ if (!first)
+ {
+ postBody.append(",");
+ }
+ first = false;
+ postBody.append("\"");
+ postBody.append(id.trim());
+ postBody.append("\"");
+ }
+ postBody.append("]}");
+ byte[] thepostbody = postBody.toString().getBytes();
+ connection.setRequestProperty("Content-Length",
+ Integer.toString(thepostbody.length));
+ DataOutputStream wr = new DataOutputStream(connection.getOutputStream());
+ wr.write(thepostbody);
+ wr.flush();
+ wr.close();
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.analysis.AlignmentUtils;
+import jalview.datamodel.Alignment;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.DBRefEntry;
+import jalview.datamodel.DBRefSource;
+import jalview.datamodel.Mapping;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.exceptions.JalviewException;
+import jalview.io.FastaFile;
+import jalview.io.FileParse;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyI;
+import jalview.util.DBRefUtils;
+import jalview.util.MapList;
+
+import java.io.IOException;
+import java.net.MalformedURLException;
+import java.net.URL;
+import java.util.ArrayList;
+import java.util.Arrays;
+import java.util.Collections;
+import java.util.Comparator;
+import java.util.List;
+
+/**
+ * Base class for Ensembl sequence fetchers
+ *
+ * @see http://rest.ensembl.org/documentation/info/sequence_id
+ * @author gmcarstairs
+ */
+public abstract class EnsemblSeqProxy extends EnsemblRestClient
+{
+ private static final List<String> CROSS_REFERENCES = Arrays
+ .asList(new String[] { "CCDS", "Uniprot/SWISSPROT",
+ "Uniprot/SPTREMBL" });
+
+ protected static final String CONSEQUENCE_TYPE = "consequence_type";
+
+ protected static final String PARENT = "Parent";
+
+ protected static final String ID = "ID";
+
+ protected static final String NAME = "Name";
+
+ protected static final String DESCRIPTION = "description";
+
+ /*
+ * enum for 'type' parameter to the /sequence REST service
+ */
+ public enum EnsemblSeqType
+ {
+ /**
+ * type=genomic to fetch full dna including introns
+ */
+ GENOMIC("genomic"),
+
+ /**
+ * type=cdna to fetch dna including UTRs
+ */
+ CDNA("cdna"),
+
+ /**
+ * type=cds to fetch coding dna excluding UTRs
+ */
+ CDS("cds"),
+
+ /**
+ * type=protein to fetch peptide product sequence
+ */
+ PROTEIN("protein");
+
+ /*
+ * the value of the 'type' parameter to fetch this version of
+ * an Ensembl sequence
+ */
+ private String type;
+
+ EnsemblSeqType(String t)
+ {
+ type = t;
+ }
+
+ public String getType()
+ {
+ return type;
+ }
+
+ }
+
+ /**
+ * A comparator to sort ranges into ascending start position order
+ */
+ private class RangeSorter implements Comparator<int[]>
+ {
+ boolean forwards;
+
+ RangeSorter(boolean forward)
+ {
+ forwards = forward;
+ }
+
+ @Override
+ public int compare(int[] o1, int[] o2)
+ {
+ return (forwards ? 1 : -1) * Integer.compare(o1[0], o2[0]);
+ }
+
+ }
+
+ /**
+ * Default constructor (to use rest.ensembl.org)
+ */
+ public EnsemblSeqProxy()
+ {
+ super();
+ }
+
+ /**
+ * Constructor given the target domain to fetch data from
+ */
+ public EnsemblSeqProxy(String d)
+ {
+ super(d);
+ }
+
+ /**
+ * Makes the sequence queries to Ensembl's REST service and returns an
+ * alignment consisting of the returned sequences.
+ */
+ @Override
+ public AlignmentI getSequenceRecords(String query) throws Exception
+ {
+ // TODO use a String... query vararg instead?
+
+ // danger: accession separator used as a regex here, a string elsewhere
+ // in this case it is ok (it is just a space), but (e.g.) '\' would not be
+ List<String> allIds = Arrays.asList(query
+ .split(getAccessionSeparator()));
+ AlignmentI alignment = null;
+ inProgress = true;
+
+ /*
+ * execute queries, if necessary in batches of the
+ * maximum allowed number of ids
+ */
+ int maxQueryCount = getMaximumQueryCount();
+ for (int v = 0, vSize = allIds.size(); v < vSize; v += maxQueryCount)
+ {
+ int p = Math.min(vSize, v + maxQueryCount);
+ List<String> ids = allIds.subList(v, p);
+ try
+ {
+ alignment = fetchSequences(ids, alignment);
+ } catch (Throwable r)
+ {
+ inProgress = false;
+ String msg = "Aborting ID retrieval after " + v
+ + " chunks. Unexpected problem (" + r.getLocalizedMessage()
+ + ")";
+ System.err.println(msg);
+ break;
+ }
+ }
+
+ if (alignment == null)
+ {
+ return null;
+ }
+
+ /*
+ * fetch and transfer genomic sequence features,
+ * fetch protein product and add as cross-reference
+ */
+ for (String accId : allIds)
+ {
+ addFeaturesAndProduct(accId, alignment);
+ }
+
+ for (SequenceI seq : alignment.getSequences())
+ {
+ getCrossReferences(seq);
+ }
+
+ return alignment;
+ }
+
+ /**
+ * Fetches Ensembl features using the /overlap REST endpoint, and adds them to
+ * the sequence in the alignment. Also fetches the protein product, maps it
+ * from the CDS features of the sequence, and saves it as a cross-reference of
+ * the dna sequence.
+ *
+ * @param accId
+ * @param alignment
+ */
+ protected void addFeaturesAndProduct(String accId, AlignmentI alignment)
+ {
+ if (alignment == null)
+ {
+ return;
+ }
+
+ try
+ {
+ /*
+ * get 'dummy' genomic sequence with exon, cds and variation features
+ */
+ SequenceI genomicSequence = null;
+ EnsemblFeatures gffFetcher = new EnsemblFeatures(getDomain());
+ EnsemblFeatureType[] features = getFeaturesToFetch();
+ AlignmentI geneFeatures = gffFetcher.getSequenceRecords(accId,
+ features);
+ if (geneFeatures.getHeight() > 0)
+ {
+ genomicSequence = geneFeatures.getSequenceAt(0);
+ }
+ if (genomicSequence != null)
+ {
+ /*
+ * transfer features to the query sequence
+ */
+ SequenceI querySeq = alignment.findName(accId);
+ if (transferFeatures(accId, genomicSequence, querySeq))
+ {
+
+ /*
+ * fetch and map protein product, and add it as a cross-reference
+ * of the retrieved sequence
+ */
+ addProteinProduct(querySeq);
+ }
+ }
+ } catch (IOException e)
+ {
+ System.err.println("Error transferring Ensembl features: "
+ + e.getMessage());
+ }
+ }
+
+ /**
+ * Returns those sequence feature types to fetch from Ensembl. We may want
+ * features either because they are of interest to the user, or as means to
+ * identify the locations of the sequence on the genomic sequence (CDS
+ * features identify CDS, exon features identify cDNA etc).
+ *
+ * @return
+ */
+ protected abstract EnsemblFeatureType[] getFeaturesToFetch();
+
+ /**
+ * Fetches and maps the protein product, and adds it as a cross-reference of
+ * the retrieved sequence
+ */
+ protected void addProteinProduct(SequenceI querySeq)
+ {
+ String accId = querySeq.getName();
+ try
+ {
+ AlignmentI protein = new EnsemblProtein(getDomain())
+ .getSequenceRecords(accId);
+ if (protein == null || protein.getHeight() == 0)
+ {
+ System.out.println("No protein product found for " + accId);
+ return;
+ }
+ SequenceI proteinSeq = protein.getSequenceAt(0);
+
+ /*
+ * need dataset sequences (to be the subject of mappings)
+ */
+ proteinSeq.createDatasetSequence();
+ querySeq.createDatasetSequence();
+
+ MapList mapList = AlignmentUtils.mapCdsToProtein(querySeq, proteinSeq);
+ if (mapList != null)
+ {
+ // clunky: ensure Uniprot xref if we have one is on mapped sequence
+ SequenceI ds = proteinSeq.getDatasetSequence();
+ ds.setSourceDBRef(proteinSeq.getSourceDBRef());
+ Mapping map = new Mapping(ds, mapList);
+ DBRefEntry dbr = new DBRefEntry(getDbSource(), getDbVersion(),
+ accId, map);
+ querySeq.getDatasetSequence().addDBRef(dbr);
+
+ /*
+ * copy exon features to protein, compute peptide variants from dna
+ * variants and add as features on the protein sequence ta-da
+ */
+ AlignmentUtils.computeProteinFeatures(querySeq, proteinSeq, mapList);
+ }
+ } catch (Exception e)
+ {
+ System.err
+ .println(String.format("Error retrieving protein for %s: %s",
+ accId, e.getMessage()));
+ }
+ }
+
+ /**
+ * Get database xrefs from Ensembl, and attach them to the sequence
+ *
+ * @param seq
+ */
+ protected void getCrossReferences(SequenceI seq)
+ {
+ while (seq.getDatasetSequence() != null)
+ {
+ seq = seq.getDatasetSequence();
+ }
+
+ EnsemblXref xrefFetcher = new EnsemblXref(getDomain());
+ List<DBRefEntry> xrefs = xrefFetcher.getCrossReferences(seq.getName(),
+ getCrossReferenceDatabases());
+ for (DBRefEntry xref : xrefs)
+ {
+ seq.addDBRef(xref);
+ /*
+ * Save any Uniprot xref to be the reference for SIFTS mapping
+ */
+ if (DBRefSource.UNIPROT.equals(xref.getSource()))
+ {
+ seq.setSourceDBRef(xref);
+ }
+ }
+ }
+
+ /**
+ * Returns a list of database names to be used when fetching cross-references.
+ * Specifically, the names are used to filter data returned by the Ensembl
+ * xrefs REST service on the value in field 'dbname'.
+ *
+ * @return
+ */
+ protected List<String> getCrossReferenceDatabases()
+ {
+ return CROSS_REFERENCES;
+ }
+
+ /**
+ * Fetches sequences for the list of accession ids and adds them to the
+ * alignment. Returns the extended (or created) alignment.
+ *
+ * @param ids
+ * @param alignment
+ * @return
+ * @throws JalviewException
+ * @throws IOException
+ */
+ protected AlignmentI fetchSequences(List<String> ids, AlignmentI alignment)
+ throws JalviewException, IOException
+ {
+ if (!isEnsemblAvailable())
+ {
+ inProgress = false;
+ throw new JalviewException("ENSEMBL Rest API not available.");
+ }
+ FileParse fp = getSequenceReader(ids);
+ FastaFile fr = new FastaFile(fp);
+ if (fr.hasWarningMessage())
+ {
+ System.out.println(String.format(
+ "Warning when retrieving %d ids %s\n%s", ids.size(),
+ ids.toString(), fr.getWarningMessage()));
+ }
+ else if (fr.getSeqs().size() != ids.size())
+ {
+ System.out.println(String.format(
+ "Only retrieved %d sequences for %d query strings", fr
+ .getSeqs().size(), ids.size()));
+ }
+
+ if (fr.getSeqs().size() == 1 && fr.getSeqs().get(0).getLength() == 0)
+ {
+ /*
+ * POST request has returned an empty FASTA file e.g. for invalid id
+ */
+ throw new IOException("No data returned for " + ids);
+ }
+
+ if (fr.getSeqs().size() > 0)
+ {
+ AlignmentI seqal = new Alignment(
+ fr.getSeqsAsArray());
+ for (SequenceI sq:seqal.getSequences())
+ {
+ if (sq.getDescription() == null)
+ {
+ sq.setDescription(getDbName());
+ }
+ String name = sq.getName();
+ if (ids.contains(name)
+ || ids.contains(name.replace("ENSP", "ENST")))
+ {
+ DBRefUtils.parseToDbRef(sq, DBRefSource.ENSEMBL, "0", name);
+ }
+ }
+ if (alignment == null)
+ {
+ alignment = seqal;
+ }
+ else
+ {
+ alignment.append(seqal);
+ }
+ }
+ return alignment;
+ }
+
+ /**
+ * Returns the URL for the REST call
+ *
+ * @return
+ * @throws MalformedURLException
+ */
+ @Override
+ protected URL getUrl(List<String> ids) throws MalformedURLException
+ {
+ /*
+ * a single id is included in the URL path
+ * multiple ids go in the POST body instead
+ */
+ StringBuffer urlstring = new StringBuffer(128);
+ urlstring.append(getDomain() + "/sequence/id");
+ if (ids.size() == 1)
+ {
+ urlstring.append("/").append(ids.get(0));
+ }
+ // @see https://github.com/Ensembl/ensembl-rest/wiki/Output-formats
+ urlstring.append("?type=").append(getSourceEnsemblType().getType());
+ urlstring.append(("&Accept=text/x-fasta"));
+
+ URL url = new URL(urlstring.toString());
+ return url;
+ }
+
+ /**
+ * A sequence/id POST request currently allows up to 50 queries
+ *
+ * @see http://rest.ensembl.org/documentation/info/sequence_id_post
+ */
+ @Override
+ public int getMaximumQueryCount()
+ {
+ return 50;
+ }
+
+ @Override
+ protected boolean useGetRequest()
+ {
+ return false;
+ }
+
+ @Override
+ protected String getRequestMimeType(boolean multipleIds)
+ {
+ return multipleIds ? "application/json" : "text/x-fasta";
+ }
+
+ @Override
+ protected String getResponseMimeType()
+ {
+ return "text/x-fasta";
+ }
+
+ /**
+ *
+ * @return the configured sequence return type for this source
+ */
+ protected abstract EnsemblSeqType getSourceEnsemblType();
+
+ /**
+ * Returns a list of [start, end] genomic ranges corresponding to the sequence
+ * being retrieved.
+ *
+ * The correspondence between the frames of reference is made by locating
+ * those features on the genomic sequence which identify the retrieved
+ * sequence. Specifically
+ * <ul>
+ * <li>genomic sequence is identified by "transcript" features with
+ * ID=transcript:transcriptId</li>
+ * <li>cdna sequence is identified by "exon" features with
+ * Parent=transcript:transcriptId</li>
+ * <li>cds sequence is identified by "CDS" features with
+ * Parent=transcript:transcriptId</li>
+ * </ul>
+ *
+ * The returned ranges are sorted to run forwards (for positive strand) or
+ * backwards (for negative strand). Aborts and returns null if both positive
+ * and negative strand are found (this should not normally happen).
+ *
+ * @param sourceSequence
+ * @param accId
+ * @param start
+ * the start position of the sequence we are mapping to
+ * @return
+ */
+ protected MapList getGenomicRangesFromFeatures(SequenceI sourceSequence,
+ String accId, int start)
+ {
+ SequenceFeature[] sfs = sourceSequence.getSequenceFeatures();
+ if (sfs == null)
+ {
+ return null;
+ }
+
+ /*
+ * generously initial size for number of cds regions
+ * (worst case titin Q8WZ42 has c. 313 exons)
+ */
+ List<int[]> regions = new ArrayList<int[]>(100);
+ int mappedLength = 0;
+ int direction = 1; // forward
+ boolean directionSet = false;
+
+ for (SequenceFeature sf : sfs)
+ {
+ /*
+ * accept the target feature type or a specialisation of it
+ * (e.g. coding_exon for exon)
+ */
+ if (identifiesSequence(sf, accId))
+ {
+ int strand = sf.getStrand();
+ strand = strand == 0 ? 1 : strand; // treat unknown as forward
+
+ if (directionSet && strand != direction)
+ {
+ // abort - mix of forward and backward
+ System.err.println("Error: forward and backward strand for "
+ + accId);
+ return null;
+ }
+ direction = strand;
+ directionSet = true;
+
+ /*
+ * add to CDS ranges, semi-sorted forwards/backwards
+ */
+ if (strand < 0)
+ {
+ regions.add(0, new int[] { sf.getEnd(), sf.getBegin() });
+ }
+ else
+ {
+ regions.add(new int[] { sf.getBegin(), sf.getEnd() });
+ }
+ mappedLength += Math.abs(sf.getEnd() - sf.getBegin() + 1);
+
+ if (!isSpliceable())
+ {
+ /*
+ * 'gene' sequence is contiguous so we can stop as soon as its
+ * identifying feature has been found
+ */
+ break;
+ }
+ }
+ }
+
+ if (regions.isEmpty())
+ {
+ System.out.println("Failed to identify target sequence for " + accId
+ + " from genomic features");
+ return null;
+ }
+
+ /*
+ * a final sort is needed since Ensembl returns CDS sorted within source
+ * (havana / ensembl_havana)
+ */
+ Collections.sort(regions, new RangeSorter(direction == 1));
+
+ List<int[]> to = Arrays.asList(new int[] { start,
+ start + mappedLength - 1 });
+
+ return new MapList(regions, to, 1, 1);
+ }
+
+ /**
+ * Answers true if the sequence being retrieved may occupy discontiguous
+ * regions on the genomic sequence.
+ */
+ protected boolean isSpliceable()
+ {
+ return true;
+ }
+
+ /**
+ * Returns true if the sequence feature marks positions of the genomic
+ * sequence feature which are within the sequence being retrieved. For
+ * example, an 'exon' feature whose parent is the target transcript marks the
+ * cdna positions of the transcript.
+ *
+ * @param sf
+ * @param accId
+ * @return
+ */
+ protected abstract boolean identifiesSequence(SequenceFeature sf,
+ String accId);
+
+ /**
+ * Transfers the sequence feature to the target sequence, locating its start
+ * and end range based on the mapping. Features which do not overlap the
+ * target sequence are ignored.
+ *
+ * @param sf
+ * @param targetSequence
+ * @param mapping
+ * mapping from the sequence feature's coordinates to the target
+ * sequence
+ */
+ protected void transferFeature(SequenceFeature sf,
+ SequenceI targetSequence, MapList mapping)
+ {
+ int start = sf.getBegin();
+ int end = sf.getEnd();
+ int[] mappedRange = mapping.locateInTo(start, end);
+
+ if (mappedRange != null)
+ {
+ SequenceFeature copy = new SequenceFeature(sf);
+ copy.setBegin(Math.min(mappedRange[0], mappedRange[1]));
+ copy.setEnd(Math.max(mappedRange[0], mappedRange[1]));
+ targetSequence.addSequenceFeature(copy);
+
+ /*
+ * for sequence_variant, make an additional feature with consequence
+ */
+ // if (SequenceOntologyFactory.getInstance().isA(sf.getType(),
+ // SequenceOntologyI.SEQUENCE_VARIANT))
+ // {
+ // String consequence = (String) sf.getValue(CONSEQUENCE_TYPE);
+ // if (consequence != null)
+ // {
+ // SequenceFeature sf2 = new SequenceFeature("consequence",
+ // consequence, copy.getBegin(), copy.getEnd(), 0f,
+ // null);
+ // targetSequence.addSequenceFeature(sf2);
+ // }
+ // }
+ }
+ }
+
+ /**
+ * Transfers features from sourceSequence to targetSequence
+ *
+ * @param accessionId
+ * @param sourceSequence
+ * @param targetSequence
+ * @return true if any features were transferred, else false
+ */
+ protected boolean transferFeatures(String accessionId,
+ SequenceI sourceSequence, SequenceI targetSequence)
+ {
+ if (sourceSequence == null || targetSequence == null)
+ {
+ return false;
+ }
+
+ // long start = System.currentTimeMillis();
+ SequenceFeature[] sfs = sourceSequence.getSequenceFeatures();
+ MapList mapping = getGenomicRangesFromFeatures(sourceSequence, accessionId,
+ targetSequence.getStart());
+ if (mapping == null)
+ {
+ return false;
+ }
+
+ boolean result = transferFeatures(sfs, targetSequence, mapping,
+ accessionId);
+ // System.out.println("transferFeatures (" + (sfs.length) + " --> "
+ // + targetSequence.getSequenceFeatures().length + ") to "
+ // + targetSequence.getName()
+ // + " took " + (System.currentTimeMillis() - start) + "ms");
+ return result;
+ }
+
+ /**
+ * Transfer features to the target sequence. The start/end positions are
+ * converted using the mapping. Features which do not overlap are ignored.
+ * Features whose parent is not the specified identifier are also ignored.
+ *
+ * @param features
+ * @param targetSequence
+ * @param mapping
+ * @param parentId
+ * @return
+ */
+ protected boolean transferFeatures(SequenceFeature[] features,
+ SequenceI targetSequence, MapList mapping, String parentId)
+ {
+ final boolean forwardStrand = mapping.isFromForwardStrand();
+
+ /*
+ * sort features by start position (descending if reverse strand)
+ * before transferring (in forwards order) to the target sequence
+ */
+ Arrays.sort(features, new Comparator<SequenceFeature>()
+ {
+ @Override
+ public int compare(SequenceFeature o1, SequenceFeature o2)
+ {
+ int c = Integer.compare(o1.getBegin(), o2.getBegin());
+ return forwardStrand ? c : -c;
+ }
+ });
+
+ boolean transferred = false;
+ for (SequenceFeature sf : features)
+ {
+ if (retainFeature(sf, parentId))
+ {
+ transferFeature(sf, targetSequence, mapping);
+ transferred = true;
+ }
+ }
+ return transferred;
+ }
+
+ /**
+ * Answers true if the feature type is one we want to keep for the sequence.
+ * Some features are only retrieved in order to identify the sequence range,
+ * and may then be discarded as redundant information (e.g. "CDS" feature for
+ * a CDS sequence).
+ */
+ @SuppressWarnings("unused")
+ protected boolean retainFeature(SequenceFeature sf, String accessionId)
+ {
+ return true; // override as required
+ }
+
+ /**
+ * Answers true if the feature has a Parent which refers to the given
+ * accession id, or if the feature has no parent. Answers false if the
+ * feature's Parent is for a different accession id.
+ *
+ * @param sf
+ * @param identifier
+ * @return
+ */
+ protected boolean featureMayBelong(SequenceFeature sf, String identifier)
+ {
+ String parent = (String) sf.getValue(PARENT);
+ // using contains to allow for prefix "gene:", "transcript:" etc
+ if (parent != null && !parent.contains(identifier))
+ {
+ // this genomic feature belongs to a different transcript
+ return false;
+ }
+ return true;
+ }
+
+ @Override
+ public String getDescription()
+ {
+ return "Ensembl " + getSourceEnsemblType().getType()
+ + " sequence with variant features";
+ }
+
+ /**
+ * Returns a (possibly empty) list of features on the sequence which have the
+ * specified sequence ontology type (or a sub-type of it), and the given
+ * identifier as parent
+ *
+ * @param sequence
+ * @param type
+ * @param parentId
+ * @return
+ */
+ protected List<SequenceFeature> findFeatures(SequenceI sequence,
+ String type, String parentId)
+ {
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+
+ SequenceFeature[] sfs = sequence.getSequenceFeatures();
+ if (sfs != null) {
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ for (SequenceFeature sf :sfs) {
+ if (so.isA(sf.getType(), type))
+ {
+ String parent = (String) sf.getValue(PARENT);
+ if (parent.equals(parentId))
+ {
+ result.add(sf);
+ }
+ }
+ }
+ }
+ return result;
+ }
+
+ /**
+ * Answers true if the feature type is either 'NMD_transcript_variant' or
+ * 'transcript' or one of its sub-types in the Sequence Ontology. This is
+ * needed because NMD_transcript_variant behaves like 'transcript' in Ensembl
+ * although strictly speaking it is not (it is a sub-type of
+ * sequence_variant).
+ *
+ * @param featureType
+ * @return
+ */
+ public static boolean isTranscript(String featureType)
+ {
+ return SequenceOntologyI.NMD_TRANSCRIPT_VARIANT.equals(featureType)
+ || SequenceOntologyFactory.getInstance().isA(featureType,
+ SequenceOntologyI.TRANSCRIPT);
+ }
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.datamodel.DBRefSource;
+import jalview.ws.seqfetcher.DbSourceProxyImpl;
+
+import com.stevesoft.pat.Regex;
+
+/**
+ * A base class for Ensembl sequence fetchers
+ *
+ * @author gmcarstairs
+ */
+abstract class EnsemblSequenceFetcher extends DbSourceProxyImpl
+{
+ /*
+ * accepts ENSG/T/E/P with 11 digits
+ * or ENSMUSP or similar for other species
+ * or CCDSnnnnn.nn with at least 3 digits
+ */
+ private static final Regex ACCESSION_REGEX = new Regex(
+ "(ENS([A-Z]{3}|)[GTEP]{1}[0-9]{11}$)" + "|" + "(CCDS[0-9.]{3,}$)");
+
+ /*
+ * possible values for the 'feature' parameter of the /overlap REST service
+ * @see http://rest.ensembl.org/documentation/info/overlap_id
+ */
+ protected enum EnsemblFeatureType
+ {
+ gene, transcript, cds, exon, repeat, simple, misc, variation,
+ somatic_variation, structural_variation, somatic_structural_variation,
+ constrained, regulatory
+ }
+
+ @Override
+ public String getDbSource()
+ {
+ // NB ensure Uniprot xrefs are canonicalised from "Ensembl" to "ENSEMBL"
+ return DBRefSource.ENSEMBL; // "ENSEMBL"
+ }
+
+ @Override
+ public String getDbVersion()
+ {
+ return "0";
+ }
+
+ @Override
+ public String getAccessionSeparator()
+ {
+ return " ";
+ }
+
+ /**
+ * Ensembl accession are ENST + 11 digits for human transcript, ENSG for human
+ * gene. Other species insert 3 letters e.g. ENSMUST..., ENSMUSG...
+ *
+ * @see http://www.ensembl.org/Help/View?id=151
+ */
+ @Override
+ public Regex getAccessionValidator()
+ {
+ return ACCESSION_REGEX;
+ }
+
+ @Override
+ public boolean isValidReference(String accession)
+ {
+ return getAccessionValidator().search(accession);
+ }
+
+ @Override
+ public int getTier()
+ {
+ return 0;
+ }
+
+ /**
+ * Default test query is a transcript
+ */
+ @Override
+ public String getTestQuery()
+ {
+ // has CDS on reverse strand:
+ return "ENST00000288602";
+ // ENST00000461457 // forward strand
+ }
+
+ @Override
+ public boolean isDnaCoding()
+ {
+ return true;
+ }
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import java.io.BufferedReader;
+import java.io.IOException;
+import java.net.MalformedURLException;
+import java.net.URL;
+import java.util.ArrayList;
+import java.util.Iterator;
+import java.util.List;
+
+import org.json.simple.JSONArray;
+import org.json.simple.JSONObject;
+import org.json.simple.parser.JSONParser;
+import org.json.simple.parser.ParseException;
+
+/**
+ * A client for the Ensembl xrefs/symbol REST service;
+ *
+ * @see http://rest.ensembl.org/documentation/info/xref_external
+ * @author gmcarstairs
+ *
+ */
+public class EnsemblSymbol extends EnsemblXref
+{
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param d
+ */
+ public EnsemblSymbol(String d)
+ {
+ super(d);
+ }
+
+ /**
+ * Returns the first "id" value in gene identifier format from the JSON
+ * response, or null if none found
+ *
+ * @param br
+ * @return
+ * @throws IOException
+ */
+ protected String parseResponse(BufferedReader br)
+ throws IOException
+ {
+ JSONParser jp = new JSONParser();
+ String result = null;
+ try
+ {
+ JSONArray responses = (JSONArray) jp.parse(br);
+ Iterator rvals = responses.iterator();
+ while (rvals.hasNext())
+ {
+ JSONObject val = (JSONObject) rvals.next();
+ String id = val.get("id").toString();
+ if (id != null && isGeneIdentifier(id))
+ {
+ result = id;
+ break;
+ }
+ }
+ } catch (ParseException e)
+ {
+ // ignore
+ }
+ return result;
+ }
+
+ protected URL getUrl(String id, Species species)
+ {
+ String url = getDomain() + "/xrefs/symbol/" + species.toString() + "/"
+ + id
+ + "?content-type=application/json";
+ try
+ {
+ return new URL(url);
+ } catch (MalformedURLException e)
+ {
+ return null;
+ }
+ }
+
+ /**
+ * Calls the Ensembl xrefs REST 'symbol' endpoint and retrieves any gene ids
+ * for the given identifier, for any known model organisms
+ *
+ * @param identifier
+ * @return
+ */
+ public List<String> getIds(String identifier)
+ {
+ List<String> result = new ArrayList<String>();
+ List<String> ids = new ArrayList<String>();
+ ids.add(identifier);
+
+ String[] queries = identifier.split(getAccessionSeparator());
+ BufferedReader br = null;
+ try
+ {
+ for (String query : queries)
+ {
+ for (Species taxon : Species.values())
+ {
+ if (taxon.isModelOrganism())
+ {
+ URL url = getUrl(query, taxon);
+ if (url != null)
+ {
+ br = getHttpResponse(url, ids);
+ }
+ String geneId = parseResponse(br);
+ if (geneId != null)
+ {
+ result.add(geneId);
+ }
+ }
+ }
+ }
+ } catch (IOException e)
+ {
+ // ignore
+ } finally
+ {
+ if (br != null)
+ {
+ try
+ {
+ br.close();
+ } catch (IOException e)
+ {
+ // ignore
+ }
+ }
+ }
+ return result;
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.DBRefEntry;
+import jalview.util.DBRefUtils;
+
+import java.io.BufferedReader;
+import java.io.IOException;
+import java.net.MalformedURLException;
+import java.net.URL;
+import java.util.ArrayList;
+import java.util.Iterator;
+import java.util.List;
+
+import org.json.simple.JSONArray;
+import org.json.simple.JSONObject;
+import org.json.simple.parser.JSONParser;
+import org.json.simple.parser.ParseException;
+
+/**
+ * A class to fetch cross-references from Ensembl by calling the /xrefs REST
+ * service
+ *
+ * @author gmcarstairs
+ * @see http://rest.ensembl.org/documentation/info/xref_id
+ */
+class EnsemblXref extends EnsemblRestClient
+{
+
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param d
+ */
+ public EnsemblXref(String d)
+ {
+ super(d);
+ }
+
+ @Override
+ public String getDbName()
+ {
+ return "ENSEMBL (xref)";
+ }
+
+ @Override
+ public AlignmentI getSequenceRecords(String queries) throws Exception
+ {
+ return null;
+ }
+
+ @Override
+ protected URL getUrl(List<String> ids) throws MalformedURLException
+ {
+ return getUrl(ids.get(0));
+ }
+
+ @Override
+ protected boolean useGetRequest()
+ {
+ return true;
+ }
+
+ @Override
+ protected String getRequestMimeType(boolean multipleIds)
+ {
+ return "application/json";
+ }
+
+ @Override
+ protected String getResponseMimeType()
+ {
+ return "application/json";
+ }
+
+ /**
+ * Calls the Ensembl xrefs REST endpoint and retrieves any cross-references
+ * ("primary_id") for the given identifier (Ensembl accession id) and database
+ * names. The "dbname" returned by Ensembl is canonicalised to Jalview's
+ * standard version, and a DBRefEntry constructed. If no databases are
+ * specified, all available cross-references are retrieved.
+ *
+ * @param identifier
+ * @param databases
+ * @return
+ */
+ public List<DBRefEntry> getCrossReferences(String identifier,
+ List<String> databases)
+ {
+ List<DBRefEntry> result = new ArrayList<DBRefEntry>();
+ List<String> ids = new ArrayList<String>();
+ ids.add(identifier);
+
+ BufferedReader br = null;
+ try
+ {
+ URL url = getUrl(identifier);
+ if (url != null)
+ {
+ br = getHttpResponse(url, ids);
+ }
+ return (parseResponse(br, databases));
+ } catch (IOException e)
+ {
+ // ignore
+ } finally
+ {
+ if (br != null)
+ {
+ try
+ {
+ br.close();
+ } catch (IOException e)
+ {
+ // ignore
+ }
+ }
+ }
+
+ return result;
+ }
+
+ /**
+ * Parses "primary_id" and "dbname" values from the JSON response and
+ * constructs a DBRefEntry if the dbname is in the list supplied. Returns a
+ * list of DBRefEntry created.
+ *
+ * @param br
+ * @param databases
+ * @return
+ * @throws IOException
+ */
+ protected List<DBRefEntry> parseResponse(BufferedReader br,
+ List<String> databases)
+ throws IOException
+ {
+ JSONParser jp = new JSONParser();
+ List<DBRefEntry> result = new ArrayList<DBRefEntry>();
+ try
+ {
+ JSONArray responses = (JSONArray) jp.parse(br);
+ Iterator rvals = responses.iterator();
+ while (rvals.hasNext())
+ {
+ JSONObject val = (JSONObject) rvals.next();
+ String dbName = val.get("dbname").toString();
+ if (databases != null && !databases.isEmpty()
+ && !databases.contains(dbName))
+ {
+ continue;
+ }
+ String id = val.get("primary_id").toString();
+ if (dbName != null && id != null)
+ {
+ dbName = DBRefUtils.getCanonicalName(dbName);
+ DBRefEntry dbref = new DBRefEntry(dbName, "0", id);
+ result.add(dbref);
+ }
+ }
+ } catch (ParseException e)
+ {
+ // ignore
+ }
+ return result;
+ }
+
+ /**
+ * Returns the URL for the REST endpoint to fetch all cross-references for an
+ * identifier. Note this may return protein cross-references for nucleotide.
+ * Filter the returned list as required.
+ *
+ * @param identifier
+ * @return
+ */
+ protected URL getUrl(String identifier)
+ {
+ String url = getDomain() + "/xrefs/id/" + identifier
+ + "?content-type=application/json&all_levels=1";
+ try
+ {
+ return new URL(url);
+ } catch (MalformedURLException e)
+ {
+ return null;
+ }
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+/**
+ * Selected species identifiers used by Ensembl
+ *
+ * @author gmcarstairs
+ * @see http://rest.ensembl.org/info/species?content-type=text/xml
+ */
+enum Species
+{
+ /*
+ * using any suitably readable alias as the enum name; these are all
+ * valid species parameters to Ensembl REST services where applicable
+ */
+ human(true), mouse(true), s_cerevisiae(true), cow(false), pig(false),
+ rat(true), celegans(true), sheep(false), horse(false), gorilla(false),
+ rabbit(false), gibbon(false), dog(false), orangutan(false),
+ xenopus(true), chimpanzee(false), cat(false), zebrafish(true), chicken(
+ true), dmelanogaster(true);
+
+ boolean modelOrganism;
+
+ private Species(boolean model)
+ {
+ this.modelOrganism = model;
+ }
+
+ boolean isModelOrganism()
+ {
+ return modelOrganism;
+ }
+}
--- /dev/null
+package jalview.ext.htsjdk;
+
+import htsjdk.samtools.SAMSequenceDictionary;
+import htsjdk.samtools.SAMSequenceRecord;
+import htsjdk.samtools.reference.ReferenceSequence;
+import htsjdk.samtools.reference.ReferenceSequenceFile;
+import htsjdk.samtools.reference.ReferenceSequenceFileFactory;
+import htsjdk.samtools.util.StringUtil;
+import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceI;
+
+import java.io.File;
+import java.math.BigInteger;
+import java.security.MessageDigest;
+import java.security.NoSuchAlgorithmException;
+import java.util.ArrayList;
+import java.util.HashSet;
+import java.util.List;
+import java.util.Set;
+
+/**
+ * a source of sequence data accessed via the HTSJDK
+ *
+ * @author jprocter
+ *
+ */
+public class HtsContigDb
+{
+
+ private String name;
+
+ private File dbLocation;
+
+ private htsjdk.samtools.reference.ReferenceSequenceFile refFile = null;
+
+ public HtsContigDb(String name, File descriptor) throws Exception
+ {
+ if (descriptor.isFile())
+ {
+ this.name = name;
+ dbLocation = descriptor;
+ }
+ initSource();
+ }
+
+ private void initSource() throws Exception
+ {
+ if (refFile != null)
+ {
+ return;
+ }
+
+ refFile = ReferenceSequenceFileFactory.getReferenceSequenceFile(
+ dbLocation, true);
+ if (refFile == null || refFile.getSequenceDictionary() == null)
+ {
+ // refFile = initSequenceDictionaryFor(dbLocation);
+ }
+
+ }
+
+
+ SAMSequenceDictionary rrefDict = null;
+ private ReferenceSequenceFile initSequenceDictionaryFor(File dbLocation2) throws Exception
+ {
+ rrefDict = getDictionary(dbLocation2, true);
+ if (rrefDict != null)
+ {
+ ReferenceSequenceFile rrefFile = ReferenceSequenceFileFactory.getReferenceSequenceFile(dbLocation2, true);
+ return rrefFile;
+ }
+ return null;
+ }
+ /**
+ * code below hacked out from picard ----
+ *
+ * picard/src/java/picard/sam/CreateSequenceDictionary.java
+ * https://github.com/
+ * broadinstitute/picard/commit/270580d3e28123496576f0b91b3433179bb5d876
+ */
+
+
+ /*
+ * The MIT License
+ *
+ * Copyright (c) 2009 The Broad Institute
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * the rights to use, copy, modify, merge, publish, distribute, sublicense,
+ * and/or sell copies of the Software, and to permit persons to whom the
+ * Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included in
+ * all copies or substantial portions of the Software.
+ *
+ * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
+ * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
+ * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
+ * AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
+ * LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING
+ * FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER
+ * DEALINGS IN THE SOFTWARE.
+ */
+ /**
+ *
+ * @param f
+ * @param truncate
+ * @return
+ * @throws Exception
+ */
+ SAMSequenceDictionary getDictionary(File f, boolean truncate)
+ throws Exception
+ {
+ if (md5 == null)
+ {
+ initCreateSequenceDictionary();
+ }
+ final ReferenceSequenceFile refSeqFile = ReferenceSequenceFileFactory
+ .getReferenceSequenceFile(f, truncate);
+ ReferenceSequence refSeq;
+ List<SAMSequenceRecord> ret = new ArrayList<SAMSequenceRecord>();
+ Set<String> sequenceNames = new HashSet<String>();
+ for (int numSequences = 0; (refSeq = refSeqFile.nextSequence()) != null; ++numSequences)
+ {
+ if (sequenceNames.contains(refSeq.getName()))
+ {
+ throw new Exception(
+ "Sequence name appears more than once in reference: "
+ + refSeq.getName());
+ }
+ sequenceNames.add(refSeq.getName());
+ ret.add(makeSequenceRecord(refSeq));
+ }
+ return new SAMSequenceDictionary(ret);
+ }
+
+ public boolean isValid()
+ {
+ return dbLocation != null && refFile != null;
+ }
+
+ /**
+ * Create one SAMSequenceRecord from a single fasta sequence
+ */
+ private SAMSequenceRecord makeSequenceRecord(
+ final ReferenceSequence refSeq)
+ {
+
+ final SAMSequenceRecord ret = new SAMSequenceRecord(refSeq.getName(),
+ refSeq.length());
+
+ // Compute MD5 of upcased bases
+ final byte[] bases = refSeq.getBases();
+ for (int i = 0; i < bases.length; ++i)
+ {
+ bases[i] = StringUtil.toUpperCase(bases[i]);
+ }
+
+ ret.setAttribute(SAMSequenceRecord.MD5_TAG, md5Hash(bases));
+ // if (GENOME_ASSEMBLY != null) {
+ // ret.setAttribute(SAMSequenceRecord.ASSEMBLY_TAG, GENOME_ASSEMBLY);
+ // }
+ // ret.setAttribute(SAMSequenceRecord.URI_TAG, URI);
+ // if (SPECIES != null) {
+ // ret.setAttribute(SAMSequenceRecord.SPECIES_TAG, SPECIES);
+ // }
+ return ret;
+ }
+
+ private MessageDigest md5;
+
+ public void initCreateSequenceDictionary() throws Exception
+ {
+ try
+ {
+ md5 = MessageDigest.getInstance("MD5");
+ } catch (NoSuchAlgorithmException e)
+ {
+ throw new Exception("MD5 algorithm not found", e);
+ }
+ }
+
+ private String md5Hash(final byte[] bytes)
+ {
+ md5.reset();
+ md5.update(bytes);
+ String s = new BigInteger(1, md5.digest()).toString(16);
+ if (s.length() != 32)
+ {
+ final String zeros = "00000000000000000000000000000000";
+ s = zeros.substring(0, 32 - s.length()) + s;
+ }
+ return s;
+ }
+
+ // ///// end of hts bits.
+
+ SequenceI getSequenceProxy(String id)
+ {
+ if (!isValid())
+ {
+ return null;
+ }
+
+ ReferenceSequence sseq = refFile.getSequence(id);
+ return new Sequence(sseq.getName(), new String(sseq.getBases()));
+ }
+}
*/
String[] modelFileNames = null;
- String lastMousedOverAtomSpec;
+ String lastHighlightCommand;
private List<String> lastReply;
* Construct and send a command to highlight zero, one or more atoms.
*
* <pre>
- * Done by generating a command like (to 'highlight' position 44)
- * show #0:44.C
+ * Done by generating a command like (to 'highlight' positions 44 and 46)
+ * show #0:44,46.C
* </pre>
*/
@Override
{
return;
}
- StringBuilder atomSpecs = new StringBuilder();
+ StringBuilder cmd = new StringBuilder(128);
boolean first = true;
+ boolean found = false;
for (AtomSpec atom : atoms)
{
List<ChimeraModel> cms = chimeraMaps.get(pdbfile);
if (cms != null && !cms.isEmpty())
{
- atomSpecs.append(first ? "" : ",");
+ if (first)
+ {
+ cmd.append("show #").append(cms.get(0).getModelNumber())
+ .append(":");
+ }
+ else
+ {
+ cmd.append(",");
+ }
first = false;
- atomSpecs.append(cms.get(0).getModelNumber());
- atomSpecs.append(":" + pdbResNum);
+ cmd.append(cms.get(0).getModelNumber()).append(":");
+ cmd.append(pdbResNum);
if (!chain.equals(" "))
{
- atomSpecs.append("." + chain);
+ cmd.append(".").append(chain);
}
+ found = true;
}
}
- String atomSpec = atomSpecs.toString();
+ String command = cmd.toString();
/*
* Avoid repeated commands for the same residue
*/
- if (atomSpec.equals(lastMousedOverAtomSpec))
+ if (command.equals(lastHighlightCommand))
{
return;
}
- StringBuilder command = new StringBuilder(32);
viewerCommandHistory(false);
- if (atomSpec.length() > 0)
+ if (found)
{
- command.append("show #").append(atomSpec);
viewer.sendChimeraCommand(command.toString(), false);
}
viewerCommandHistory(true);
- this.lastMousedOverAtomSpec = atomSpec;
+ this.lastHighlightCommand = command;
}
/**
{
sendChimeraCommand("focus", false);
}
+
+ /**
+ * Send a 'show' command for all atoms in the currently selected columns
+ *
+ * @param vp
+ */
+ public void highlightSelection(AlignmentViewPanel vp)
+ {
+ List<Integer> cols = vp.getAlignViewport().getColumnSelection()
+ .getSelected();
+ AlignmentI alignment = vp.getAlignment();
+ StructureSelectionManager sm = getSsm();
+ for (SequenceI seq : alignment.getSequences())
+ {
+ /*
+ * convert selected columns into sequence positions
+ */
+ int[] positions = new int[cols.size()];
+ int i = 0;
+ for (Integer col : cols)
+ {
+ positions[i++] = seq.findPosition(col);
+ }
+ sm.highlightStructure(this, seq, positions);
+ }
+ }
}
import jalview.api.AlignViewportI;
import jalview.api.AlignmentViewPanel;
import jalview.api.FeatureSettingsControllerI;
+import jalview.api.FeatureSettingsI;
import jalview.api.SplitContainerI;
import jalview.api.ViewStyleI;
import jalview.api.analysis.ScoreModelI;
import jalview.datamodel.AlignmentOrder;
import jalview.datamodel.AlignmentView;
import jalview.datamodel.ColumnSelection;
+import jalview.datamodel.DBRefSource;
import jalview.datamodel.HiddenSequences;
import jalview.datamodel.PDBEntry;
import jalview.datamodel.SeqCigar;
import jalview.structure.StructureSelectionManager;
import jalview.util.MessageManager;
import jalview.viewmodel.AlignmentViewport;
+import jalview.ws.SequenceFetcher;
import jalview.ws.jws1.Discoverer;
import jalview.ws.jws2.Jws2Discoverer;
import jalview.ws.jws2.jabaws2.Jws2Instance;
+import jalview.ws.seqfetcher.ASequenceFetcher;
import jalview.ws.seqfetcher.DbSourceProxy;
import java.awt.BorderLayout;
import java.util.Enumeration;
import java.util.Hashtable;
import java.util.List;
-import java.util.Set;
import java.util.Vector;
import javax.swing.JCheckBoxMenuItem;
public void setGUINucleotide(boolean nucleotide)
{
showTranslation.setVisible(nucleotide);
+ showReverse.setVisible(nucleotide);
+ showReverseComplement.setVisible(nucleotide);
conservationMenuItem.setEnabled(!nucleotide);
modifyConservation.setEnabled(!nucleotide);
showGroupConservation.setEnabled(!nucleotide);
rnahelicesColour.setEnabled(av.getAlignment().hasRNAStructure());
rnahelicesColour
.setSelected(av.getGlobalColourScheme() instanceof jalview.schemes.RNAHelicesColour);
- setShowProductsEnabled();
+
+ showProducts.setEnabled(canShowProducts());
+
updateEditMenuBar();
}
@Override
public void fetchSequence_actionPerformed(ActionEvent e)
{
- new SequenceFetcher(this);
+ new jalview.gui.SequenceFetcher(this);
}
@Override
return;
}
- format = new IdentifyFile().Identify(str, "Paste");
+ format = new IdentifyFile().identify(str, "Paste");
} catch (OutOfMemoryError er)
{
}
}
- /*
- * public void vamsasStore_actionPerformed(ActionEvent e) { JalviewFileChooser
- * chooser = new JalviewFileChooser(jalview.bin.Cache.
- * getProperty("LAST_DIRECTORY"));
- *
- * chooser.setFileView(new JalviewFileView()); chooser.setDialogTitle("Export
- * to Vamsas file"); chooser.setToolTipText("Export");
- *
- * int value = chooser.showSaveDialog(this);
- *
- * if (value == JalviewFileChooser.APPROVE_OPTION) {
- * jalview.io.VamsasDatastore vs = new jalview.io.VamsasDatastore(viewport);
- * //vs.store(chooser.getSelectedFile().getAbsolutePath() ); vs.storeJalview(
- * chooser.getSelectedFile().getAbsolutePath(), this); } }
- */
/**
- * prototype of an automatically enabled/disabled analysis function
+ * Searches selected sequences for xRef products and builds the Show
+ * Cross-References menu (formerly called Show Products)
*
+ * @return true if Show Cross-references menu should be enabled.
*/
- protected void setShowProductsEnabled()
+ public boolean canShowProducts()
{
SequenceI[] selection = viewport.getSequenceSelection();
- if (canShowProducts(selection, viewport.getSelectionGroup() != null,
- viewport.getAlignment().getDataset()))
- {
- showProducts.setEnabled(true);
-
- }
- else
- {
- showProducts.setEnabled(false);
- }
- }
-
- /**
- * search selection for sequence xRef products and build the show products
- * menu.
- *
- * @param selection
- * @param dataset
- * @return true if showProducts menu should be enabled.
- */
- public boolean canShowProducts(SequenceI[] selection,
- boolean isRegionSelection, Alignment dataset)
- {
+ AlignmentI dataset = viewport.getAlignment().getDataset();
boolean showp = false;
try
{
showProducts.removeAll();
final boolean dna = viewport.getAlignment().isNucleotide();
- final Alignment ds = dataset;
String[] ptypes = (selection == null || selection.length == 0) ? null
: CrossRef.findSequenceXrefTypes(dna, selection, dataset);
- // Object[] prods =
- // CrossRef.buildXProductsList(viewport.getAlignment().isNucleotide(),
- // selection, dataset, true);
- final SequenceI[] sel = selection;
+
for (int t = 0; ptypes != null && t < ptypes.length; t++)
{
showp = true;
- final boolean isRegSel = isRegionSelection;
final AlignFrame af = this;
final String source = ptypes[t];
JMenuItem xtype = new JMenuItem(ptypes[t]);
@Override
public void actionPerformed(ActionEvent e)
{
- // TODO: new thread for this call with vis-delay
- af.showProductsFor(af.viewport.getSequenceSelection(),
- isRegSel, dna, source);
+ showProductsFor(af.viewport.getSequenceSelection(), dna, source);
}
});
} catch (Exception e)
{
jalview.bin.Cache.log
- .warn("canTranslate threw an exception - please report to help@jalview.org",
+ .warn("canShowProducts threw an exception - please report to help@jalview.org",
e);
return false;
}
return showp;
}
- protected void showProductsFor(final SequenceI[] sel,
- final boolean isRegSel, final boolean dna, final String source)
+ protected void showProductsFor(final SequenceI[] sel, final boolean dna,
+ final String source)
{
Runnable foo = new Runnable()
{
new Object[] { source }), sttime);
try
{
- // update our local dataset reference
- Alignment ds = AlignFrame.this.getViewport().getAlignment()
- .getDataset();
- Alignment prods = CrossRef
- .findXrefSequences(sel, dna, source, ds);
- if (prods != null)
+ /*
+ * 'peer' sequences are any to add to this alignment, for example
+ * alternative protein products for my protein's gene
+ */
+ List<SequenceI> addedPeers = new ArrayList<SequenceI>();
+ AlignmentI alignment = AlignFrame.this.getViewport()
+ .getAlignment();
+ Alignment xrefs = CrossRef.findXrefSequences(sel, dna, source,
+ alignment, addedPeers);
+ if (xrefs != null)
{
- SequenceI[] sprods = new SequenceI[prods.getHeight()];
- for (int s = 0; s < sprods.length; s++)
+ /*
+ * figure out colour scheme if any to apply to features
+ */
+ ASequenceFetcher sftch = new SequenceFetcher();
+ List<DbSourceProxy> proxies = sftch.getSourceProxy(source);
+ FeatureSettingsI featureColourScheme = null;
+ for (DbSourceProxy proxy : proxies)
{
- sprods[s] = (prods.getSequenceAt(s)).deriveSequence();
- if (ds.getSequences() == null
- || !ds.getSequences().contains(
- sprods[s].getDatasetSequence()))
+ FeatureSettingsI preferredColours = proxy
+ .getFeatureColourScheme();
+ if (preferredColours != null)
{
- ds.addSequence(sprods[s].getDatasetSequence());
+ featureColourScheme = preferredColours;
+ break;
}
- sprods[s].updatePDBIds();
}
- Alignment al = new Alignment(sprods);
- al.setDataset(ds);
+ Alignment al = makeCrossReferencesAlignment(
+ alignment.getDataset(), xrefs);
- /*
- * Copy dna-to-protein mappings to new alignment
- */
- // TODO 1: no mappings are set up for EMBL product
- // TODO 2: if they were, should add them to protein alignment, not
- // dna
- Set<AlignedCodonFrame> cf = prods.getCodonFrames();
- for (AlignedCodonFrame acf : cf)
- {
- al.addCodonFrame(acf);
- }
- AlignFrame naf = new AlignFrame(al, DEFAULT_WIDTH,
+ AlignFrame newFrame = new AlignFrame(al, DEFAULT_WIDTH,
DEFAULT_HEIGHT);
- String newtitle = "" + ((dna) ? "Proteins" : "Nucleotides")
- + " for " + ((isRegSel) ? "selected region of " : "")
- + getTitle();
- naf.setTitle(newtitle);
+ String newtitle = String.format("%s %s %s",
+ MessageManager.getString(dna ? "label.proteins"
+ : "label.nucleotides"), MessageManager
+ .getString("label.for"), getTitle());
+ newFrame.setTitle(newtitle);
- // temporary flag until SplitFrame is released
boolean asSplitFrame = Cache.getDefault(
Preferences.ENABLE_SPLIT_FRAME, true);
if (asSplitFrame)
AlignmentI copyAlignment = null;
final SequenceI[] sequenceSelection = AlignFrame.this.viewport
.getSequenceSelection();
+ List<AlignedCodonFrame> cf = xrefs.getCodonFrames();
if (dna)
{
- copyAlignment = AlignmentUtils.makeExonAlignment(
- sequenceSelection, cf);
+ copyAlignment = AlignmentUtils.makeCdsAlignment(
+ sequenceSelection, cf, alignment);
+ if (copyAlignment.getHeight() == 0)
+ {
+ System.err.println("Failed to make CDS alignment");
+ }
al.getCodonFrames().clear();
al.getCodonFrames().addAll(cf);
- final StructureSelectionManager ssm = StructureSelectionManager
- .getStructureSelectionManager(Desktop.instance);
- ssm.registerMappings(cf);
}
else
{
copyAlignment = new Alignment(new Alignment(
sequenceSelection));
+ copyAlignment.getCodonFrames().addAll(cf);
+ }
+ copyAlignment.setGapCharacter(AlignFrame.this.viewport
+ .getGapCharacter());
+ StructureSelectionManager ssm = StructureSelectionManager
+ .getStructureSelectionManager(Desktop.instance);
+ ssm.registerMappings(cf);
+
+ /*
+ * add in any extra 'peer' sequences discovered
+ * (e.g. alternative protein products)
+ */
+ for (SequenceI peer : addedPeers)
+ {
+ copyAlignment.addSequence(peer);
+ }
+
+ if (copyAlignment.getHeight() > 0)
+ {
+ /*
+ * align protein to dna
+ */
+ // FIXME what if the dna is not aligned :-O
+ if (dna)
+ {
+ al.alignAs(copyAlignment);
+ }
+ else
+ {
+ /*
+ * align cdna to protein - currently only if
+ * fetching and aligning Ensembl transcripts!
+ */
+ if (DBRefSource.ENSEMBL.equalsIgnoreCase(source))
+ {
+ copyAlignment.alignAs(al);
+ }
+ }
+
+ AlignFrame copyThis = new AlignFrame(copyAlignment,
+ AlignFrame.DEFAULT_WIDTH, AlignFrame.DEFAULT_HEIGHT);
+ copyThis.setTitle(AlignFrame.this.getTitle());
+
+ boolean showSequenceFeatures = viewport
+ .isShowSequenceFeatures();
+ newFrame.setShowSeqFeatures(showSequenceFeatures);
+ copyThis.setShowSeqFeatures(showSequenceFeatures);
+ FeatureRenderer myFeatureStyling = alignPanel.getSeqPanel().seqCanvas
+ .getFeatureRenderer();
+
+ /*
+ * copy feature rendering settings to split frame
+ */
+ newFrame.alignPanel.getSeqPanel().seqCanvas
+ .getFeatureRenderer().transferSettings(
+ myFeatureStyling);
+ copyThis.alignPanel.getSeqPanel().seqCanvas
+ .getFeatureRenderer().transferSettings(
+ myFeatureStyling);
+
+ /*
+ * apply 'database source' feature configuration
+ * if any was found
+ */
+ // TODO is this the feature colouring for the original
+ // alignment or the fetched xrefs? either could be Ensembl
+ newFrame.getViewport().applyFeaturesStyle(
+ featureColourScheme);
+ copyThis.getViewport().applyFeaturesStyle(
+ featureColourScheme);
+
+ SplitFrame sf = new SplitFrame(dna ? copyThis : newFrame,
+ dna ? newFrame : copyThis);
+ newFrame.setVisible(true);
+ copyThis.setVisible(true);
+ String linkedTitle = MessageManager
+ .getString("label.linked_view_title");
+ Desktop.addInternalFrame(sf, linkedTitle, -1, -1);
+ sf.adjustDivider();
}
- AlignFrame copyThis = new AlignFrame(copyAlignment,
- AlignFrame.DEFAULT_WIDTH, AlignFrame.DEFAULT_HEIGHT);
- copyThis.setTitle(AlignFrame.this.getTitle());
- // SplitFrame with dna above, protein below
- SplitFrame sf = new SplitFrame(dna ? copyThis : naf,
- dna ? naf : copyThis);
- naf.setVisible(true);
- copyThis.setVisible(true);
- String linkedTitle = MessageManager
- .getString("label.linked_view_title");
- Desktop.addInternalFrame(sf, linkedTitle, -1, -1);
}
else
{
- Desktop.addInternalFrame(naf, newtitle, DEFAULT_WIDTH,
+ Desktop.addInternalFrame(newFrame, newtitle, DEFAULT_WIDTH,
DEFAULT_HEIGHT);
}
}
new Object[] { source }), sttime);
}
+ /**
+ * Makes an alignment containing the given sequences; the sequences are
+ * added to the given alignment dataset, and the dataset is set on (shared
+ * by) the new alignment
+ *
+ * @param dataset
+ * @param seqs
+ * @return
+ */
+ protected Alignment makeCrossReferencesAlignment(Alignment dataset,
+ Alignment seqs)
+ {
+ SequenceI[] sprods = new SequenceI[seqs.getHeight()];
+ for (int s = 0; s < sprods.length; s++)
+ {
+ sprods[s] = (seqs.getSequenceAt(s)).deriveSequence();
+ if (dataset.getSequences() == null
+ || !dataset.getSequences().contains(
+ sprods[s].getDatasetSequence()))
+ {
+ dataset.addSequence(sprods[s].getDatasetSequence());
+ }
+ sprods[s].updatePDBIds();
+ }
+ Alignment al = new Alignment(sprods);
+ al.setDataset(dataset);
+ return al;
+ }
+
};
Thread frunner = new Thread(foo);
frunner.start();
String type = null;
try
{
- type = new IdentifyFile().Identify(file, protocol);
+ type = new IdentifyFile().identify(file, protocol);
} catch (Exception ex)
{
type = null;
/**
* Attempt to load a "dropped" file or URL string: First by testing whether
- * it's and Annotation file, then a JNet file, and finally a features file. If
+ * it's an Annotation file, then a JNet file, and finally a features file. If
* all are false then the user may have dropped an alignment file onto this
* AlignFrame.
*
{
if (protocol == null)
{
- protocol = jalview.io.FormatAdapter.checkProtocol(file);
+ protocol = FormatAdapter.checkProtocol(file);
}
// if the file isn't identified, or not positively identified as some
// other filetype (PFAM is default unidentified alignment file type) then
// try to parse it as a features file
if (format == null)
{
- format = new IdentifyFile().Identify(file, protocol);
+ format = new IdentifyFile().identify(file, protocol);
}
if (format.equalsIgnoreCase("JnetFile"))
{
viewport.setColumnSelection(cs);
isAnnotation = true;
}
- else
+ else if (IdentifyFile.FeaturesFile.equals(format))
{
- /*
- * if (format.equalsIgnoreCase("PDB")) {
- *
- * String pdbfn = ""; // try to match up filename with sequence id
- * try { if (protocol == jalview.io.FormatAdapter.FILE) { File fl =
- * new File(file); pdbfn = fl.getName(); } else if (protocol ==
- * jalview.io.FormatAdapter.URL) { URL url = new URL(file); pdbfn =
- * url.getFile(); } } catch (Exception e) { } ; if (assocSeq ==
- * null) { SequenceIdMatcher idm = new SequenceIdMatcher(viewport
- * .getAlignment().getSequencesArray()); if (pdbfn.length() > 0) {
- * // attempt to find a match in the alignment SequenceI mtch =
- * idm.findIdMatch(pdbfn); int l = 0, c = pdbfn.indexOf("."); while
- * (mtch == null && c != -1) { while ((c = pdbfn.indexOf(".", l)) >
- * l) { l = c; } if (l > -1) { pdbfn = pdbfn.substring(0, l); } mtch
- * = idm.findIdMatch(pdbfn); } if (mtch != null) { // try and
- * associate // prompt ? PDBEntry pe = new AssociatePdbFileWithSeq()
- * .associatePdbWithSeq(file, protocol, mtch, true); if (pe != null)
- * { System.err.println("Associated file : " + file + " with " +
- * mtch.getDisplayId(true)); alignPanel.paintAlignment(true); } } //
- * TODO: maybe need to load as normal otherwise return; } }
- */
- // try to parse it as a features file
- boolean isGroupsFile = parseFeaturesFile(file, protocol);
- // if it wasn't a features file then we just treat it as a general
- // alignment file to load into the current view.
- if (!isGroupsFile)
- {
- new FileLoader().LoadFile(viewport, file, protocol, format);
- }
- else
+ if (parseFeaturesFile(file, protocol))
{
alignPanel.paintAlignment(true);
}
}
+ else
+ {
+ new FileLoader().LoadFile(viewport, file, protocol, format);
+ }
}
}
if (isAnnotation)
} catch (Exception x)
{
}
- ;
new OOMWarning(
"loading data "
+ (protocol != null ? (protocol.equals(FormatAdapter.PASTE) ? "from clipboard."
@Override
public void run()
{
- boolean isNuclueotide = alignPanel.alignFrame
- .getViewport().getAlignment()
- .isNucleotide();
+ boolean isNuclueotide = alignPanel.alignFrame.getViewport()
+ .getAlignment().isNucleotide();
new jalview.ws.DBRefFetcher(alignPanel.av
- .getSequenceSelection(),
- alignPanel.alignFrame, null,
- alignPanel.alignFrame.featureSettings,
- isNuclueotide)
+ .getSequenceSelection(), alignPanel.alignFrame, null,
+ alignPanel.alignFrame.featureSettings, isNuclueotide)
.fetchDBRefs(false);
}
}).start();
@Override
public void run()
{
- final jalview.ws.SequenceFetcher sf = SequenceFetcher
+ final jalview.ws.SequenceFetcher sf = jalview.gui.SequenceFetcher
.getSequenceFetcherSingleton(me);
javax.swing.SwingUtilities.invokeLater(new Runnable()
{
.getSequenceSelection(),
alignPanel.alignFrame, dassource,
alignPanel.alignFrame.featureSettings,
- isNuclueotide)
- .fetchDBRefs(false);
+ isNuclueotide).fetchDBRefs(false);
}
}).start();
}
.getSequenceSelection(),
alignPanel.alignFrame, dassource,
alignPanel.alignFrame.featureSettings,
- isNuclueotide)
- .fetchDBRefs(false);
+ isNuclueotide).fetchDBRefs(false);
}
}).start();
}
.getSequenceSelection(),
alignPanel.alignFrame, dassrc,
alignPanel.alignFrame.featureSettings,
- isNuclueotide)
- .fetchDBRefs(false);
+ isNuclueotide).fetchDBRefs(false);
}
}).start();
}
{
// TODO no longer a menu action - refactor as required
final AlignmentI alignment = getViewport().getAlignment();
- Set<AlignedCodonFrame> mappings = alignment.getCodonFrames();
+ List<AlignedCodonFrame> mappings = alignment.getCodonFrames();
if (mappings == null)
{
return;
sf.setComplementVisible(this, show);
}
}
+
+ /**
+ * Generate the reverse (optionally complemented) of the selected sequences,
+ * and add them to the alignment
+ */
+ @Override
+ protected void showReverse_actionPerformed(boolean complement)
+ {
+ AlignmentI al = null;
+ try
+ {
+ Dna dna = new Dna(viewport, viewport.getViewAsVisibleContigs(true));
+
+ al = dna.reverseCdna(complement);
+ viewport.addAlignment(al, "");
+ } catch (Exception ex)
+ {
+ System.err.println(ex.getMessage());
+ return;
+ }
+ }
}
class PrintThread extends Thread
import jalview.analysis.NJTree;
import jalview.api.AlignViewportI;
import jalview.api.AlignmentViewPanel;
+import jalview.api.FeatureColourI;
+import jalview.api.FeatureSettingsI;
+import jalview.api.FeaturesDisplayedI;
import jalview.api.ViewStyleI;
import jalview.bin.Cache;
import jalview.commands.CommandI;
import java.util.ArrayList;
import java.util.Hashtable;
import java.util.List;
-import java.util.Set;
+import java.util.Map;
import java.util.Vector;
import javax.swing.JInternalFrame;
AlignmentI al = getAlignment();
if (al != null)
{
- Set<AlignedCodonFrame> mappings = al.getCodonFrames();
+ List<AlignedCodonFrame> mappings = al.getCodonFrames();
if (mappings != null)
{
StructureSelectionManager ssm = StructureSelectionManager
*
* @return DOCUMENT ME!
*/
+ @Override
public char getGapCharacter()
{
return getAlignment().getGapCharacter();
*
* @return DOCUMENT ME!
*/
+ @Override
public ColumnSelection getColumnSelection()
{
return colSel;
/**
* Send the current selection to be broadcast to any selection listeners.
*/
+ @Override
public void sendSelection()
{
jalview.structure.StructureSelectionManager
return seqvectors.toArray(new SequenceI[seqvectors.size()][]);
}
+ @Override
public boolean isNormaliseSequenceLogo()
{
return normaliseSequenceLogo;
*
* @return true if alignment characters should be displayed
*/
+ @Override
public boolean isValidCharWidth()
{
return validCharWidth;
* may give the user the option to open a new frame, or split panel, with cDNA
* and protein linked.
*
- * @param al
+ * @param toAdd
* @param title
*/
- public void addAlignment(AlignmentI al, String title)
+ public void addAlignment(AlignmentI toAdd, String title)
{
// TODO: promote to AlignViewportI? applet CutAndPasteTransfer is different
// TODO: create undo object for this JAL-1101
/*
- * If any cDNA/protein mappings can be made between the alignments, offer to
- * open a linked alignment with split frame option.
+ * Ensure datasets are created for the new alignment as
+ * mappings operate on dataset sequences
+ */
+ toAdd.setDataset(null);
+
+ /*
+ * Check if any added sequence could be the object of a mapping or
+ * cross-reference; if so, make the mapping explicit
+ */
+ getAlignment().realiseMappings(toAdd.getSequences());
+
+ /*
+ * If any cDNA/protein mappings exist or can be made between the alignments,
+ * offer to open a split frame with linked alignments
*/
if (Cache.getDefault(Preferences.ENABLE_SPLIT_FRAME, true))
{
- if (al.getDataset() == null)
+ if (AlignmentUtils.isMappable(toAdd, getAlignment()))
{
- // need to create ds seqs
- for (SequenceI sq : al.getSequences())
- {
- if (sq.getDatasetSequence() == null)
- {
- sq.createDatasetSequence();
- }
- }
- }
- if (AlignmentUtils.isMappable(al, getAlignment()))
- {
- if (openLinkedAlignment(al, title))
+ if (openLinkedAlignment(toAdd, title))
{
return;
}
// TODO: JAL-407 regardless of above - identical sequences (based on ID and
// provenance) should share the same dataset sequence
- for (int i = 0; i < al.getHeight(); i++)
+ AlignmentI al = getAlignment();
+ String gap = String.valueOf(al.getGapCharacter());
+ for (int i = 0; i < toAdd.getHeight(); i++)
{
- getAlignment().addSequence(al.getSequenceAt(i));
+ SequenceI seq = toAdd.getSequenceAt(i);
+ /*
+ * experimental!
+ * - 'align' any mapped sequences as per existing
+ * e.g. cdna to genome, domain hit to protein sequence
+ * very experimental! (need a separate menu option for this)
+ * - only add mapped sequences ('select targets from a dataset')
+ */
+ if (true /*AlignmentUtils.alignSequenceAs(seq, al, gap, true, true)*/)
+ {
+ al.addSequence(seq);
+ }
}
setEndSeq(getAlignment().getHeight());
return true;
}
+ /**
+ * Applies the supplied feature settings descriptor to currently known
+ * features. This supports an 'initial configuration' of feature colouring
+ * based on a preset or user favourite. This may then be modified in the usual
+ * way using the Feature Settings dialogue.
+ *
+ * @param featureSettings
+ */
+ public void applyFeaturesStyle(FeatureSettingsI featureSettings)
+ {
+ if (featureSettings == null)
+ {
+ return;
+ }
+
+ FeatureRenderer fr = getAlignPanel().getSeqPanel().seqCanvas
+ .getFeatureRenderer();
+ Map<String, Object> featureColours = fr.getFeatureColours();
+ fr.findAllFeatures(true);
+ List<String> renderOrder = fr.getRenderOrder();
+ FeaturesDisplayedI displayed = fr.getFeaturesDisplayed();
+ displayed.clear();
+ // TODO this clears displayed.featuresRegistered - do we care?
+
+ /*
+ * set feature colour if specified by feature settings
+ * set visibility of all features
+ */
+ for (String type : renderOrder)
+ {
+ FeatureColourI preferredColour = featureSettings
+ .getFeatureColour(type);
+ if (preferredColour != null)
+ {
+ fr.setColour(type, preferredColour);
+ }
+ if (featureSettings.isFeatureDisplayed(type))
+ {
+ displayed.setVisible(type);
+ }
+ }
+
+ /*
+ * set visibility of feature groups
+ */
+ for (String group : fr.getFeatureGroups())
+ {
+ fr.setGroupVisibility(group, featureSettings.isGroupDisplayed(group));
+ }
+
+ /*
+ * order the features
+ */
+ if (featureSettings.optimiseOrder())
+ {
+ // TODO not supported (yet?)
+ }
+ else
+ {
+ fr.orderFeatures(featureSettings);
+ }
+ fr.setTransparency(featureSettings.getTransparency());
+ }
+
}
package jalview.gui;
import jalview.datamodel.AlignmentAnnotation;
+import jalview.datamodel.SequenceI;
import jalview.io.AnnotationFile;
import jalview.io.FeaturesFile;
import jalview.io.JalviewFileChooser;
import java.awt.FlowLayout;
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
+import java.util.Map;
import javax.swing.BorderFactory;
import javax.swing.ButtonGroup;
.getString("label.no_features_on_alignment");
if (features)
{
+ FeaturesFile formatter = new FeaturesFile();
+ SequenceI[] sequences = ap.av.getAlignment().getSequencesArray();
+ Map<String, Object> featureColours = ap.getFeatureRenderer()
+ .getDisplayedFeatureCols();
+ boolean includeNonPositional = ap.av.isShowNPFeats();
if (GFFFormat.isSelected())
{
- text = new FeaturesFile().printGFFFormat(ap.av.getAlignment()
- .getDataset().getSequencesArray(), ap.getFeatureRenderer()
- .getDisplayedFeatureCols(), true, ap.av.isShowNPFeats());// ap.av.featuresDisplayed//);
+ text = formatter.printGffFormat(sequences, featureColours, true,
+ includeNonPositional);
}
else
{
- text = new FeaturesFile().printJalviewFormat(ap.av.getAlignment()
- .getDataset().getSequencesArray(), ap.getFeatureRenderer()
- .getDisplayedFeatureCols(), true, ap.av.isShowNPFeats()); // ap.av.featuresDisplayed);
+ text = formatter.printJalviewFormat(sequences, featureColours,
+ true, includeNonPositional);
}
}
else
toFile.setText(MessageManager.getString("label.to_file"));
toFile.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
toFile_actionPerformed(e);
toTextbox.setText(MessageManager.getString("label.to_textbox"));
toTextbox.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
toTextbox_actionPerformed(e);
close.setText(MessageManager.getString("action.close"));
close.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
close_actionPerformed(e);
});
viewMenu.add(seqColourBy);
viewMenu.add(fitToWindow);
+ viewMenu.add(highlightSelection);
final ItemListener handler;
JMenu alpanels = new ViewSelectionMenu(
this.addInternalFrameListener(new InternalFrameAdapter()
{
+ @Override
public void internalFrameClosing(InternalFrameEvent internalFrameEvent)
{
closeViewer(false);
MessageManager.getString("label.all"));
menuItem.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent evt)
{
allChainsSelected = true;
menuItem = new JCheckBoxMenuItem(chainName, true);
menuItem.addItemListener(new ItemListener()
{
+ @Override
public void itemStateChanged(ItemEvent evt)
{
if (!allChainsSelected)
* @param closeChimera
* if true, close any linked Chimera process; if false, prompt first
*/
+ @Override
public void closeViewer(boolean closeChimera)
{
if (jmb != null && jmb.isChimeraRunning())
* Open any newly added PDB structures in Chimera, having first fetched data
* from PDB (if not already saved).
*/
+ @Override
public void run()
{
_started = true;
{
new Thread(new Runnable()
{
+ @Override
public void run()
{
alignStructs_withAllAlignPanels();
}
}
+ @Override
public void setJalviewColourScheme(ColourSchemeI ucs)
{
jmb.setJalviewColourScheme(ucs);
}
@Override
+ protected void highlightSelection_actionPerformed()
+ {
+ jmb.highlightSelection(getAlignmentPanel());
+ }
+
+ @Override
public ViewerType getViewerType()
{
return ViewerType.CHIMERA;
import jalview.api.AlignmentViewPanel;
import jalview.api.ComplexAlignFile;
import jalview.api.FeaturesDisplayedI;
+import jalview.api.FeaturesSourceI;
import jalview.bin.Jalview;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.ColumnSelection;
{
SwingUtilities.invokeLater(new Runnable()
{
+ @Override
public void run()
{
textarea.requestFocus();
textarea.append(text);
}
+ @Override
public void save_actionPerformed(ActionEvent e)
{
JalviewFileChooser chooser = new JalviewFileChooser(
* @param e
* DOCUMENT ME!
*/
+ @Override
public void copyItem_actionPerformed(ActionEvent e)
{
textarea.getSelectedText();
* @param e
* DOCUMENT ME!
*/
+ @Override
public void pasteMenu_actionPerformed(ActionEvent e)
{
Clipboard c = Toolkit.getDefaultToolkit().getSystemClipboard();
* @param e
* DOCUMENT ME!
*/
+ @Override
public void ok_actionPerformed(ActionEvent e)
{
String text = getText();
return;
}
- String format = new IdentifyFile().Identify(text, "Paste");
+ String format = new IdentifyFile().identify(text, "Paste");
if (format == null || format.equalsIgnoreCase("EMPTY DATA FILE"))
{
System.err.println(MessageManager
{
String title = MessageManager.formatMessage(
"label.input_cut_paste_params", new String[] { format });
- if (viewport != null)
+ /*
+ * if the view panel was closed its alignment is nulled
+ * and this is an orphaned cut and paste window
+ */
+ if (viewport != null && viewport.getAlignment() != null)
{
((AlignViewport) viewport).addAlignment(al, title);
}
{
af = new AlignFrame(al, AlignFrame.DEFAULT_WIDTH,
AlignFrame.DEFAULT_HEIGHT);
+ if (source instanceof FeaturesSourceI)
+ {
+ af.getViewport().setShowSequenceFeatures(true);
+ }
}
af.currentFileFormat = format;
* @param e
* DOCUMENT ME!
*/
+ @Override
public void cancel_actionPerformed(ActionEvent e)
{
try
}
}
+ @Override
public void textarea_mousePressed(MouseEvent e)
{
if (SwingUtilities.isRightMouseButton(e))
MessageManager.getString("action.copy"));
item.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
copyItem_actionPerformed(e);
item = new JMenuItem(MessageManager.getString("action.paste"));
item.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
pasteMenu_actionPerformed(e);
String file = (String) contents
.getTransferData(DataFlavor.stringFlavor);
- String format = new IdentifyFile().Identify(file,
+ String format = new IdentifyFile().identify(file,
FormatAdapter.PASTE);
new FileLoader().LoadFile(file, FormatAdapter.PASTE, format);
}
else
{
- format = new IdentifyFile().Identify(file, protocol);
+ format = new IdentifyFile().identify(file, protocol);
}
new FileLoader().LoadFile(file, protocol, format);
}
else
{
- format = new IdentifyFile().Identify(choice, FormatAdapter.FILE);
+ format = new IdentifyFile().identify(choice, FormatAdapter.FILE);
}
if (viewport != null)
}
else
{
- String format = new IdentifyFile().Identify(url, FormatAdapter.URL);
+ String format = new IdentifyFile().identify(url, FormatAdapter.URL);
if (format.equals("URL NOT FOUND"))
{
import java.awt.event.ItemListener;
import java.awt.event.MouseAdapter;
import java.awt.event.MouseEvent;
+import java.util.Arrays;
+import java.util.Comparator;
import javax.swing.JColorChooser;
import javax.swing.JComboBox;
{
FeatureColourChooser fcc = null;
+ @Override
public void mousePressed(MouseEvent evt)
{
if (fcol instanceof Color)
fcc.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
fcol = fcc.getLastColour();
overlaps.addItemListener(new ItemListener()
{
+ @Override
public void itemStateChanged(ItemEvent e)
{
int index = overlaps.getSelectedIndex();
// colour.setForeground(colour.getBackground());
}
}
+
+ /**
+ * Orders features in render precedence (last in order is last to render, so
+ * displayed on top of other features)
+ *
+ * @param order
+ */
+ public void orderFeatures(Comparator<String> order)
+ {
+ Arrays.sort(renderOrder, order);
+ }
}
import java.io.InputStreamReader;
import java.io.OutputStreamWriter;
import java.io.PrintWriter;
+import java.util.Arrays;
import java.util.Hashtable;
import java.util.Iterator;
import java.util.List;
table.addMouseListener(new MouseAdapter()
{
+ @Override
public void mousePressed(MouseEvent evt)
{
selectedRow = table.rowAtPoint(evt.getPoint());
table.addMouseMotionListener(new MouseMotionAdapter()
{
+ @Override
public void mouseDragged(MouseEvent evt)
{
int newRow = table.rowAtPoint(evt.getPoint());
if (newRow != selectedRow && selectedRow != -1 && newRow != -1)
{
- Object[] temp = new Object[3];
- temp[0] = table.getValueAt(selectedRow, 0);
- temp[1] = table.getValueAt(selectedRow, 1);
- temp[2] = table.getValueAt(selectedRow, 2);
-
- table.setValueAt(table.getValueAt(newRow, 0), selectedRow, 0);
- table.setValueAt(table.getValueAt(newRow, 1), selectedRow, 1);
- table.setValueAt(table.getValueAt(newRow, 2), selectedRow, 2);
-
- table.setValueAt(temp[0], newRow, 0);
- table.setValueAt(temp[1], newRow, 1);
- table.setValueAt(temp[2], newRow, 2);
-
+ Object[][] data = ((FeatureTableModel) table.getModel())
+ .getData();
+ Object[] temp = data[selectedRow];
+ data[selectedRow] = data[newRow];
+ data[newRow] = temp;
+ updateFeatureRenderer(data);
+ table.repaint();
selectedRow = newRow;
}
}
final FeatureSettings fs = this;
fr.addPropertyChangeListener(change = new PropertyChangeListener()
{
+ @Override
public void propertyChange(PropertyChangeEvent evt)
{
if (!fs.resettingTable && !fs.handlingUpdate)
frame.addInternalFrameListener(new javax.swing.event.InternalFrameAdapter()
{
+ @Override
public void internalFrameClosed(
javax.swing.event.InternalFrameEvent evt)
{
scr.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
- me.af.avc.sortAlignmentByFeatureScore(new String[] { type });
+ me.af.avc.sortAlignmentByFeatureScore(Arrays
+ .asList(new String[] { type }));
}
});
dens.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
- me.af.avc.sortAlignmentByFeatureDensity(new String[] { type });
+ me.af.avc.sortAlignmentByFeatureDensity(Arrays
+ .asList(new String[] { type }));
}
});
{
JColorChooser colorChooser;
+ @Override
public void actionPerformed(ActionEvent e)
{
if (e.getSource() == mxcol)
check.setFont(new Font("Serif", Font.BOLD, 12));
check.addItemListener(new ItemListener()
{
+ @Override
public void itemStateChanged(ItemEvent evt)
{
fr.setGroupVisibility(check.getText(), check.isSelected());
updateFeatureRenderer(data, true);
}
+ /**
+ * Update the priority order of features; only repaint if this changed the
+ * order of visible features
+ *
+ * @param data
+ * @param visibleNew
+ */
private void updateFeatureRenderer(Object[][] data, boolean visibleNew)
{
- fr.setFeaturePriority(data, visibleNew);
- af.alignPanel.paintAlignment(true);
+ if (fr.setFeaturePriority(data, visibleNew))
+ {
+ af.alignPanel.paintAlignment(true);
+ }
}
int selectedRow = -1;
invert.setText(MessageManager.getString("label.invert_selection"));
invert.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
invertSelection();
optimizeOrder.setText(MessageManager.getString("label.optimise_order"));
optimizeOrder.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
orderByAvWidth();
.setText(MessageManager.getString("label.seq_sort_by_score"));
sortByScore.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
af.avc.sortAlignmentByFeatureScore(null);
.getString("label.sequence_sort_by_density"));
sortByDens.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
af.avc.sortAlignmentByFeatureDensity(null);
help.setText(MessageManager.getString("action.help"));
help.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
try
help.setText(MessageManager.getString("action.help"));
help.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
try
cancel.setText(MessageManager.getString("action.cancel"));
cancel.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
fr.setTransparency(originalTransparency);
ok.setText(MessageManager.getString("action.ok"));
ok.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
close();
loadColours.setText(MessageManager.getString("label.load_colours"));
loadColours.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
load();
saveColours.setText(MessageManager.getString("label.save_colours"));
saveColours.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
save();
});
transparency.addChangeListener(new ChangeListener()
{
+ @Override
public void stateChanged(ChangeEvent evt)
{
fr.setTransparency((100 - transparency.getValue()) / 100f);
fetchDAS.setText(MessageManager.getString("label.fetch_das_features"));
fetchDAS.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
fetchDAS_actionPerformed(e);
saveDAS.setText(MessageManager.getString("action.save_as_default"));
saveDAS.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
saveDAS_actionPerformed(e);
cancelDAS.setText(MessageManager.getString("action.cancel_fetch"));
cancelDAS.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent e)
{
cancelDAS_actionPerformed(e);
Runnable fetcher = new Runnable()
{
+ @Override
public void run()
{
doDasFeatureFetch(dassources, true, false);
this.data = data;
}
+ @Override
public int getColumnCount()
{
return columnNames.length;
return data[row];
}
+ @Override
public int getRowCount()
{
return data.length;
}
+ @Override
public String getColumnName(int col)
{
return columnNames[col];
}
+ @Override
public Object getValueAt(int row, int col)
{
return data[row][col];
}
+ @Override
public Class getColumnClass(int c)
{
return getValueAt(0, c).getClass();
}
+ @Override
public boolean isCellEditable(int row, int col)
{
return col == 0 ? false : true;
}
+ @Override
public void setValueAt(Object value, int row, int col)
{
data[row][col] = value;
setVerticalTextPosition(SwingConstants.CENTER);
}
+ @Override
public Component getTableCellRendererComponent(JTable table,
Object color, boolean isSelected, boolean hasFocus, int row,
int column)
}
}
+ @Override
public int getIconWidth()
{
return width;
}
+ @Override
public int getIconHeight()
{
return height;
}
+ @Override
public void paintIcon(Component c, Graphics g, int x, int y)
{
/**
* Handles events from the editor button and from the dialog's OK button.
*/
+ @Override
public void actionPerformed(ActionEvent e)
{
}
// Implement the one CellEditor method that AbstractCellEditor doesn't.
+ @Override
public Object getCellEditorValue()
{
if (currentColor == null)
}
// Implement the one method defined by TableCellEditor.
+ @Override
public Component getTableCellEditorComponent(JTable table, Object value,
boolean isSelected, int row, int column)
{
seqAnnotReport.createSequenceAnnotationReport(tip, sequence,
av.isShowDBRefs(), av.isShowNPFeats(),
sp.seqCanvas.fr.getMinMax());
- setToolTipText("<html>" + sequence.getDisplayId(true) + " "
- + tip.toString() + "</html>");
+ setToolTipText(JvSwingUtils.wrapTooltip(true,
+ sequence.getDisplayId(true) + " " + tip.toString()));
}
}
import javax.swing.JPanel;
import javax.swing.JScrollPane;
import javax.swing.JTree;
+import javax.swing.ToolTipManager;
import javax.swing.event.TreeSelectionEvent;
import javax.swing.event.TreeSelectionListener;
import javax.swing.tree.DefaultMutableTreeNode;
public DbTreeRenderer(JDatabaseTree me)
{
us = me;
+ ToolTipManager.sharedInstance().registerComponent(dbviews);
}
private Component returnLabel(String txt)
value = vl.getUserObject();
if (value instanceof DbSourceProxy)
{
- val = (((DbSourceProxy) value).getDbName());
+ val = ((DbSourceProxy) value).getDbName();
+ if (((DbSourceProxy) value).getDescription() != null)
+ { // getName()
+ this.setToolTipText(((DbSourceProxy) value).getDescription());
+ }
}
else
{
if (value instanceof String)
{
- val = ((String) value);
+ val = (String) value;
}
}
}
if (value == null)
{
- val = ("");
+ val = "";
}
return super.getTreeCellRendererComponent(tree, val, selected,
expanded, leaf, row, hasFocus);
*/
Map<String, SequenceI> seqRefIds = null;
- Vector frefedSequence = null;
+ Vector<Object[]> frefedSequence = null;
boolean raiseGUI = true; // whether errors are raised in dialog boxes or not
int r = 0, rSize = frefedSequence.size();
while (r < rSize)
{
- Object[] ref = (Object[]) frefedSequence.elementAt(r);
+ Object[] ref = frefedSequence.elementAt(r);
if (ref != null)
{
String sref = (String) ref[0];
if (sf[index].otherDetails != null)
{
String key;
- Enumeration keys = sf[index].otherDetails.keys();
- while (keys.hasMoreElements())
+ Iterator<String> keys = sf[index].otherDetails.keySet()
+ .iterator();
+ while (keys.hasNext())
{
- key = keys.nextElement().toString();
+ key = keys.next();
OtherData keyValue = new OtherData();
keyValue.setKey(key);
keyValue.setValue(sf[index].otherDetails.get(key).toString());
// SAVE MAPPINGS
if (jal.getCodonFrames() != null)
{
- Set<AlignedCodonFrame> jac = jal.getCodonFrames();
+ List<AlignedCodonFrame> jac = jal.getCodonFrames();
for (AlignedCodonFrame acf : jac)
{
AlcodonFrame alc = new AlcodonFrame();
{
SwingUtilities.invokeAndWait(new Runnable()
{
+ @Override
public void run()
{
setLoadingFinishedForNewStructureViewers();
}
if (frefedSequence == null)
{
- frefedSequence = new Vector();
+ frefedSequence = new Vector<Object[]>();
}
AlignFrame af = null, _af = null;
{
mapping = addMapping(maps[m].getMapping());
}
- if (dnaseq != null)
+ if (dnaseq != null && mapping.getTo() != null)
{
cf.addMap(dnaseq, mapping.getTo(), mapping.getMap());
}
*/
package jalview.gui;
+import jalview.api.FeatureSettingsI;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.DBRefEntry;
-import jalview.datamodel.DBRefSource;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
-import jalview.io.FormatAdapter;
-import jalview.io.IdentifyFile;
import jalview.util.DBRefUtils;
import jalview.util.MessageManager;
import jalview.ws.dbsources.das.api.DasSourceRegistryI;
import javax.swing.SwingConstants;
import javax.swing.tree.DefaultMutableTreeNode;
-import com.stevesoft.pat.Regex;
-
public class SequenceFetcher extends JPanel implements Runnable
{
JLabel dbeg = new JLabel();
resetDialog();
return;
}
+ // TODO: Refactor to GUI independent code and write tests.
// indicate if successive sources should be merged into one alignment.
boolean addToLast = false;
ArrayList<String> aresultq = new ArrayList<String>(), presultTitle = new ArrayList<String>();
.split(";"));
Iterator<String> en = Arrays.asList(new String[0]).iterator();
int nqueries = qries.length;
+
+ FeatureSettingsI preferredFeatureColours = null;
while (proxies.hasNext() && (en.hasNext() || nextfetch.size() > 0))
{
if (!en.hasNext() && nextfetch.size() > 0)
Integer.valueOf(nqueries).toString(),
proxy.getDbName() }), Thread.currentThread()
.hashCode());
- isAliSource = proxy.isA(DBRefSource.ALIGNMENTDB);
+ isAliSource = proxy.isAlignmentSource();
if (proxy.getAccessionSeparator() == null)
{
while (en.hasNext())
DBRefEntry dbr = new DBRefEntry(), found[] = null;
dbr.setSource(proxy.getDbSource());
dbr.setVersion(null);
- if (proxy.getAccessionValidator() != null)
- {
- Regex vgr = proxy.getAccessionValidator();
- vgr.search(q);
- if (vgr.numSubs() > 0)
- {
- dbr.setAccessionId(vgr.stringMatched(1));
- }
- else
- {
- dbr.setAccessionId(vgr.stringMatched());
- }
- }
- else
- {
- dbr.setAccessionId(q);
- }
+ String accId = proxy.getAccessionIdFromQuery(q);
+ dbr.setAccessionId(accId);
boolean rfound = false;
for (int r = 0; r < rs.length; r++)
{
- if (rs[r] != null
- && (found = DBRefUtils.searchRefs(
- rs[r].getDBRefs(), dbr)) != null
- && found.length > 0)
+ if (rs[r] != null)
{
- rfound = true;
- rs[r] = null;
- continue;
+ found = DBRefUtils.searchRefs(rs[r].getDBRefs(), accId);
+ if (found != null && found.length > 0)
+ {
+ rfound = true;
+ rs[r] = null;
+ }
}
}
if (!rfound)
// Stack results ready for opening in alignment windows
if (aresult != null && aresult.size() > 0)
{
+ FeatureSettingsI proxyColourScheme = proxy.getFeatureColourScheme();
+ if (proxyColourScheme != null)
+ {
+ preferredFeatureColours = proxyColourScheme;
+ }
+
AlignmentI ar = null;
if (isAliSource)
{
// process results
while (presult.size() > 0)
{
- parseResult(presult.remove(0), presultTitle.remove(0), null);
+ parseResult(presult.remove(0), presultTitle.remove(0), null,
+ preferredFeatureColours);
}
// only remove visual delay after we finished parsing.
guiWindow.setProgressBar(null, Thread.currentThread().hashCode());
resetDialog();
}
- AlignmentI parseResult(String result, String title)
- {
- String format = new IdentifyFile().Identify(result, "Paste");
- AlignmentI sequences = null;
- if (FormatAdapter.isValidFormat(format))
- {
- sequences = null;
- try
- {
- sequences = new FormatAdapter().readFile(result.toString(),
- "Paste", format);
- } catch (Exception ex)
- {
- }
-
- if (sequences != null)
- {
- return parseResult(sequences, title, format);
- }
- }
- else
- {
- showErrorMessage("Error retrieving " + textArea.getText() + " from "
- + database.getSelectedItem());
- }
-
- return null;
- }
-
/**
*
* @return a standard title for any results retrieved using the currently
}
AlignmentI parseResult(AlignmentI al, String title,
- String currentFileFormat)
+ String currentFileFormat, FeatureSettingsI preferredFeatureColours)
{
if (al != null && al.getHeight() > 0)
}
}
+
+ if (preferredFeatureColours != null)
+ {
+ af.viewport.applyFeaturesStyle(preferredFeatureColours);
+ }
Desktop.addInternalFrame(af, title, AlignFrame.DEFAULT_WIDTH,
AlignFrame.DEFAULT_HEIGHT);
import java.awt.event.KeyListener;
import java.beans.PropertyVetoException;
import java.util.Map.Entry;
-import java.util.Set;
import javax.swing.AbstractAction;
import javax.swing.InputMap;
import javax.swing.JComponent;
import javax.swing.JMenuItem;
import javax.swing.KeyStroke;
-import javax.swing.UIDefaults;
-import javax.swing.UIManager;
import javax.swing.event.InternalFrameAdapter;
import javax.swing.event.InternalFrameEvent;
*/
public class SplitFrame extends GSplitFrame implements SplitContainerI
{
+ private static final int WINDOWS_INSETS_WIDTH = 28; // tbc
+
+ private static final int MAC_INSETS_WIDTH = 28;
+
+ private static final int WINDOWS_INSETS_HEIGHT = 50; // tbc
+
+ private static final int MAC_INSETS_HEIGHT = 50;
+ private static final int DESKTOP_DECORATORS_HEIGHT = 65;
private static final long serialVersionUID = 1L;
public SplitFrame(GAlignFrame top, GAlignFrame bottom)
* estimate width and height of SplitFrame; this.getInsets() doesn't seem to
* give the full additional size (a few pixels short)
*/
- UIDefaults defaults = UIManager.getDefaults();
- Set<Object> keySet = defaults.keySet();
- for (Object key : keySet)
- {
- System.out.println(key.toString() + " = "
- + UIManager.get(key).toString());
- }
- int widthFudge = Platform.isAMac() ? 28 : 28; // Windows tbc
- int heightFudge = Platform.isAMac() ? 50 : 50; // tbc
+ int widthFudge = Platform.isAMac() ? MAC_INSETS_WIDTH
+ : WINDOWS_INSETS_WIDTH;
+ int heightFudge = Platform.isAMac() ? MAC_INSETS_HEIGHT
+ : WINDOWS_INSETS_HEIGHT;
int width = ((AlignFrame) getTopFrame()).getWidth() + widthFudge;
int height = ((AlignFrame) getTopFrame()).getHeight()
+ ((AlignFrame) getBottomFrame()).getHeight() + DIVIDER_SIZE
{
// allow about 65 pixels for Desktop decorators on Windows
- int newHeight = Math.min(height, Desktop.instance.getHeight() - 65);
+ int newHeight = Math.min(height, Desktop.instance.getHeight()
+ - DESKTOP_DECORATORS_HEIGHT);
if (newHeight != height)
{
int oldDividerLocation = getDividerLocation();
}
/**
+ * Adjust the divider for a sensible split of the real estate (for example,
+ * when many transcripts are shown with a single protein). This should only be
+ * called after the split pane has been laid out (made visible) so it has a
+ * height.
+ */
+ protected void adjustDivider()
+ {
+ final AlignViewport topViewport = ((AlignFrame) getTopFrame()).viewport;
+ final AlignViewport bottomViewport = ((AlignFrame) getBottomFrame()).viewport;
+ final AlignmentI topAlignment = topViewport.getAlignment();
+ final AlignmentI bottomAlignment = bottomViewport.getAlignment();
+ boolean topAnnotations = topViewport.isShowAnnotation();
+ boolean bottomAnnotations = bottomViewport.isShowAnnotation();
+ int topCount = topAlignment.getHeight();
+ int bottomCount = bottomAlignment.getHeight();
+ int topCharHeight = topViewport.getViewStyle().getCharHeight();
+ int bottomCharHeight = bottomViewport.getViewStyle().getCharHeight();
+
+ /*
+ * estimate ratio of (topFrameContent / bottomFrameContent)
+ */
+ int insets = Platform.isAMac() ? MAC_INSETS_HEIGHT
+ : WINDOWS_INSETS_HEIGHT;
+ // allow 3 'rows' for scale, scrollbar, status bar
+ int topHeight = insets + (3 + topCount) * topCharHeight
+ + (topAnnotations ? topViewport.calcPanelHeight() : 0);
+ int bottomHeight = insets + (3 + bottomCount) * bottomCharHeight
+ + (bottomAnnotations ? bottomViewport.calcPanelHeight() : 0);
+ double ratio = ((double) topHeight) / (topHeight + bottomHeight);
+
+ setRelativeDividerLocation(ratio);
+ }
+
+ /**
* Add a listener to tidy up when the frame is closed.
*/
protected void addCloseFrameListener()
int maxLength = 0;
/**
- * Sequences to be added to form a new alignment.
+ * Sequences to be added to form a new alignment. TODO: remove vector in this
+ * class
*/
protected Vector<SequenceI> seqs;
if (space > -1)
{
seq = new Sequence(id.substring(0, space), "");
- seq.setDescription(id.substring(space + 1));
+ String desc = id.substring(space + 1);
+ seq.setDescription(desc);
+
+ /*
+ * it is tempting to parse Ensembl style gene description e.g.
+ * chromosome:GRCh38:7:140696688:140721955:1 and set the
+ * start position of the sequence, but this causes much confusion
+ * for reverse strand feature locations
+ */
}
else
{
public static final String[] READABLE_FORMATS = new String[] { "BLC",
"CLUSTAL", "FASTA", "MSF", "PileUp", "PIR", "PFAM", "STH", "PDB",
"JnetFile", "RNAML", PhylipFile.FILE_DESC, JSONFile.FILE_DESC,
- IdentifyFile.GFF3File, "HTML" };
+ IdentifyFile.FeaturesFile, "HTML" };
/**
* List of readable format file extensions by application in order
*/
public static final String[] READABLE_FNAMES = new String[] { "Fasta",
"Clustal", "PFAM", "MSF", "PIR", "BLC", "AMSA", "Stockholm", "RNAML",
- PhylipFile.FILE_DESC, JSONFile.FILE_DESC, IdentifyFile.GFF3File,
+ PhylipFile.FILE_DESC, JSONFile.FILE_DESC, IdentifyFile.FeaturesFile,
"Jalview", HtmlFile.FILE_DESC };
/**
{
alignFile = new RnamlFile(inFile, type);
}
- else if (format.equals(IdentifyFile.GFF3File))
+ else if (format.equals(IdentifyFile.FeaturesFile))
{
- alignFile = new Gff3File(inFile, type);
+ alignFile = new FeaturesFile(true, inFile, type);
}
return buildAlignmentFrom(alignFile);
} catch (Exception e)
{
alignFile = new PhylipFile(source);
}
- else if (format.equals(IdentifyFile.GFF3File))
+ else if (format.equals(IdentifyFile.FeaturesFile))
{
- alignFile = new Gff3File(inFile, type);
+ // enforce 'parseImmediately' here:
+ alignFile = new FeaturesFile(true, inFile, type);
}
else if (format.equals(JSONFile.FILE_DESC))
{
long memf = -r.totalMemory() + r.freeMemory();
long t1 = -System.currentTimeMillis();
AlignmentI al = afa.readFile(args[i], FILE,
- new IdentifyFile().Identify(args[i], FILE));
+ new IdentifyFile().identify(args[i], FILE));
t1 += System.currentTimeMillis();
System.gc();
memf += r.totalMemory() - r.freeMemory();
{
try
{
- String idformat = new jalview.io.IdentifyFile().Identify(file,
+ String idformat = new jalview.io.IdentifyFile().identify(file,
protocol);
if (idformat == null)
{
*/
package jalview.io;
+import jalview.analysis.AlignmentUtils;
import jalview.analysis.SequenceIdMatcher;
+import jalview.api.AlignViewportI;
+import jalview.api.FeaturesSourceI;
import jalview.datamodel.AlignedCodonFrame;
+import jalview.datamodel.Alignment;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.SequenceDummy;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.io.gff.GffHelperBase;
+import jalview.io.gff.GffHelperFactory;
+import jalview.io.gff.GffHelperI;
import jalview.schemes.AnnotationColourGradient;
import jalview.schemes.GraduatedColor;
import jalview.schemes.UserColourScheme;
import jalview.util.Format;
import jalview.util.MapList;
+import jalview.util.ParseHtmlBodyAndLinks;
+import jalview.util.StringUtils;
+import java.awt.Color;
import java.io.IOException;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.HashMap;
-import java.util.Hashtable;
import java.util.Iterator;
import java.util.List;
import java.util.Map;
+import java.util.Map.Entry;
import java.util.StringTokenizer;
-import java.util.Vector;
/**
- * Parse and create Jalview Features files Detects GFF format features files and
- * parses. Does not implement standard print() - call specific printFeatures or
- * printGFF. Uses AlignmentI.findSequence(String id) to find the sequence object
- * for the features annotation - this normally works on an exact match.
+ * Parses and writes features files, which may be in Jalview, GFF2 or GFF3
+ * format. These are tab-delimited formats but with differences in the use of
+ * columns.
+ *
+ * A Jalview feature file may define feature colours and then declare that the
+ * remainder of the file is in GFF format with the line 'GFF'.
+ *
+ * GFF3 files may include alignment mappings for features, which Jalview will
+ * attempt to model, and may include sequence data following a ##FASTA line.
+ *
*
* @author AMW
- * @version $Revision$
+ * @author jbprocter
+ * @author gmcarstairs
*/
-public class FeaturesFile extends AlignFile
+public class FeaturesFile extends AlignFile implements FeaturesSourceI
{
- /**
- * work around for GFF interpretation bug where source string becomes
- * description rather than a group
- */
- private boolean doGffSource = true;
+ private static final String ID_NOT_SPECIFIED = "ID_NOT_SPECIFIED";
+
+ private static final String NOTE = "Note";
- private int gffversion;
+ protected static final String TAB = "\t";
+
+ protected static final String GFF_VERSION = "##gff-version";
+
+ private AlignmentI lastmatchedAl = null;
+
+ private SequenceIdMatcher matcher = null;
+
+ protected AlignmentI dataset;
+
+ protected int gffVersion;
/**
* Creates a new FeaturesFile object.
}
/**
+ * Constructor which does not parse the file immediately
+ *
* @param inFile
* @param type
* @throws IOException
*/
public FeaturesFile(String inFile, String type) throws IOException
{
- super(inFile, type);
+ super(false, inFile, type);
}
/**
}
/**
- * @param parseImmediately
- * @param source
- * @throws IOException
- */
- public FeaturesFile(boolean parseImmediately, FileParse source)
- throws IOException
- {
- super(parseImmediately, source);
- }
-
- /**
+ * Constructor that optionally parses the file immediately
+ *
* @param parseImmediately
* @param inFile
* @param type
* - process html strings into plain text
* @return true if features were added
*/
- public boolean parse(AlignmentI align, Map colours, boolean removeHTML)
- {
- return parse(align, colours, null, removeHTML, false);
- }
-
- /**
- * Parse GFF or sequence features file optionally using case-independent
- * matching, discarding URLs
- *
- * @param align
- * - alignment/dataset containing sequences that are to be annotated
- * @param colours
- * - hashtable to store feature colour definitions
- * @param removeHTML
- * - process html strings into plain text
- * @param relaxedIdmatching
- * - when true, ID matches to compound sequence IDs are allowed
- * @return true if features were added
- */
- public boolean parse(AlignmentI align, Map colours, boolean removeHTML,
- boolean relaxedIdMatching)
+ public boolean parse(AlignmentI align, Map<String, Object> colours,
+ boolean removeHTML)
{
- return parse(align, colours, null, removeHTML, relaxedIdMatching);
+ return parse(align, colours, removeHTML, false);
}
/**
- * Parse GFF or sequence features file optionally using case-independent
- * matching
- *
- * @param align
- * - alignment/dataset containing sequences that are to be annotated
- * @param colours
- * - hashtable to store feature colour definitions
- * @param featureLink
- * - hashtable to store associated URLs
- * @param removeHTML
- * - process html strings into plain text
- * @return true if features were added
+ * Extends the default addProperties by also adding peptide-to-cDNA mappings
+ * (if any) derived while parsing a GFF file
*/
- public boolean parse(AlignmentI align, Map colours, Map featureLink,
- boolean removeHTML)
- {
- return parse(align, colours, featureLink, removeHTML, false);
- }
-
- @Override
- public void addAnnotations(AlignmentI al)
- {
- // TODO Auto-generated method stub
- super.addAnnotations(al);
- }
-
@Override
public void addProperties(AlignmentI al)
{
- // TODO Auto-generated method stub
super.addProperties(al);
- }
-
- @Override
- public void addSeqGroups(AlignmentI al)
- {
- // TODO Auto-generated method stub
- super.addSeqGroups(al);
+ if (dataset != null && dataset.getCodonFrames() != null)
+ {
+ AlignmentI ds = (al.getDataset() == null) ? al : al.getDataset();
+ for (AlignedCodonFrame codons : dataset.getCodonFrames())
+ {
+ ds.addCodonFrame(codons);
+ }
+ }
}
/**
- * Parse GFF or sequence features file
+ * Parse GFF or Jalview format sequence features file
*
* @param align
* - alignment/dataset containing sequences that are to be annotated
* @param colours
* - hashtable to store feature colour definitions
- * @param featureLink
- * - hashtable to store associated URLs
* @param removeHTML
* - process html strings into plain text
* @param relaxedIdmatching
* - when true, ID matches to compound sequence IDs are allowed
* @return true if features were added
*/
- public boolean parse(AlignmentI align, Map colours, Map featureLink,
+ public boolean parse(AlignmentI align, Map<String, Object> colours,
boolean removeHTML, boolean relaxedIdmatching)
{
+ Map<String, String> gffProps = new HashMap<String, String>();
+ /*
+ * keep track of any sequences we try to create from the data
+ */
+ List<SequenceI> newseqs = new ArrayList<SequenceI>();
String line = null;
try
{
- SequenceI seq = null;
- /**
- * keep track of any sequences we try to create from the data if it is a
- * GFF3 file
- */
- ArrayList<SequenceI> newseqs = new ArrayList<SequenceI>();
- String type, desc, token = null;
-
- int index, start, end;
- float score;
- StringTokenizer st;
- SequenceFeature sf;
- String featureGroup = null, groupLink = null;
- Map typeLink = new Hashtable();
- /**
- * when true, assume GFF style features rather than Jalview style.
- */
- boolean GFFFile = true;
- Map<String, String> gffProps = new HashMap<String, String>();
+ String[] gffColumns;
+ String featureGroup = null;
+
while ((line = nextLine()) != null)
{
// skip comments/process pragmas
- if (line.startsWith("#"))
+ if (line.length() == 0 || line.startsWith("#"))
{
- if (line.startsWith("##"))
+ if (line.toLowerCase().startsWith("##"))
{
- // possibly GFF2/3 version and metadata header
processGffPragma(line, gffProps, align, newseqs);
- line = "";
}
continue;
}
- st = new StringTokenizer(line, "\t");
- if (st.countTokens() == 1)
+ gffColumns = line.split("\\t"); // tab as regex
+ if (gffColumns.length == 1)
{
if (line.trim().equalsIgnoreCase("GFF"))
{
- // Start parsing file as if it might be GFF again.
- GFFFile = true;
+ /*
+ * Jalview features file with appended GFF
+ * assume GFF2 (though it may declare ##gff-version 3)
+ */
+ gffVersion = 2;
continue;
}
}
- if (st.countTokens() > 1 && st.countTokens() < 4)
+
+ if (gffColumns.length > 1 && gffColumns.length < 4)
{
- GFFFile = false;
- type = st.nextToken();
- if (type.equalsIgnoreCase("startgroup"))
+ /*
+ * if 2 or 3 tokens, we anticipate either 'startgroup', 'endgroup' or
+ * a feature type colour specification
+ */
+ String ft = gffColumns[0];
+ if (ft.equalsIgnoreCase("startgroup"))
{
- featureGroup = st.nextToken();
- if (st.hasMoreElements())
- {
- groupLink = st.nextToken();
- featureLink.put(featureGroup, groupLink);
- }
+ featureGroup = gffColumns[1];
}
- else if (type.equalsIgnoreCase("endgroup"))
+ else if (ft.equalsIgnoreCase("endgroup"))
{
// We should check whether this is the current group,
// but at present theres no way of showing more than 1 group
- st.nextToken();
featureGroup = null;
- groupLink = null;
}
else
{
- Object colour = null;
- String colscheme = st.nextToken();
- if (colscheme.indexOf("|") > -1
- || colscheme.trim().equalsIgnoreCase("label"))
- {
- // Parse '|' separated graduated colourscheme fields:
- // [label|][mincolour|maxcolour|[absolute|]minvalue|maxvalue|thresholdtype|thresholdvalue]
- // can either provide 'label' only, first is optional, next two
- // colors are required (but may be
- // left blank), next is optional, nxt two min/max are required.
- // first is either 'label'
- // first/second and third are both hexadecimal or word equivalent
- // colour.
- // next two are values parsed as floats.
- // fifth is either 'above','below', or 'none'.
- // sixth is a float value and only required when fifth is either
- // 'above' or 'below'.
- StringTokenizer gcol = new StringTokenizer(colscheme, "|",
- true);
- // set defaults
- int threshtype = AnnotationColourGradient.NO_THRESHOLD;
- float min = Float.MIN_VALUE, max = Float.MAX_VALUE, threshval = Float.NaN;
- boolean labelCol = false;
- // Parse spec line
- String mincol = gcol.nextToken();
- if (mincol == "|")
- {
- System.err
- .println("Expected either 'label' or a colour specification in the line: "
- + line);
- continue;
- }
- String maxcol = null;
- if (mincol.toLowerCase().indexOf("label") == 0)
- {
- labelCol = true;
- mincol = (gcol.hasMoreTokens() ? gcol.nextToken() : null); // skip
- // '|'
- mincol = (gcol.hasMoreTokens() ? gcol.nextToken() : null);
- }
- String abso = null, minval, maxval;
- if (mincol != null)
- {
- // at least four more tokens
- if (mincol.equals("|"))
- {
- mincol = "";
- }
- else
- {
- gcol.nextToken(); // skip next '|'
- }
- // continue parsing rest of line
- maxcol = gcol.nextToken();
- if (maxcol.equals("|"))
- {
- maxcol = "";
- }
- else
- {
- gcol.nextToken(); // skip next '|'
- }
- abso = gcol.nextToken();
- gcol.nextToken(); // skip next '|'
- if (abso.toLowerCase().indexOf("abso") != 0)
- {
- minval = abso;
- abso = null;
- }
- else
- {
- minval = gcol.nextToken();
- gcol.nextToken(); // skip next '|'
- }
- maxval = gcol.nextToken();
- if (gcol.hasMoreTokens())
- {
- gcol.nextToken(); // skip next '|'
- }
- try
- {
- if (minval.length() > 0)
- {
- min = new Float(minval).floatValue();
- }
- } catch (Exception e)
- {
- System.err
- .println("Couldn't parse the minimum value for graduated colour for type ("
- + colscheme
- + ") - did you misspell 'auto' for the optional automatic colour switch ?");
- e.printStackTrace();
- }
- try
- {
- if (maxval.length() > 0)
- {
- max = new Float(maxval).floatValue();
- }
- } catch (Exception e)
- {
- System.err
- .println("Couldn't parse the maximum value for graduated colour for type ("
- + colscheme + ")");
- e.printStackTrace();
- }
- }
- else
- {
- // add in some dummy min/max colours for the label-only
- // colourscheme.
- mincol = "FFFFFF";
- maxcol = "000000";
- }
- try
- {
- colour = new jalview.schemes.GraduatedColor(
- new UserColourScheme(mincol).findColour('A'),
- new UserColourScheme(maxcol).findColour('A'), min,
- max);
- } catch (Exception e)
- {
- System.err
- .println("Couldn't parse the graduated colour scheme ("
- + colscheme + ")");
- e.printStackTrace();
- }
- if (colour != null)
- {
- ((jalview.schemes.GraduatedColor) colour)
- .setColourByLabel(labelCol);
- ((jalview.schemes.GraduatedColor) colour)
- .setAutoScaled(abso == null);
- // add in any additional parameters
- String ttype = null, tval = null;
- if (gcol.hasMoreTokens())
- {
- // threshold type and possibly a threshold value
- ttype = gcol.nextToken();
- if (ttype.toLowerCase().startsWith("below"))
- {
- ((jalview.schemes.GraduatedColor) colour)
- .setThreshType(AnnotationColourGradient.BELOW_THRESHOLD);
- }
- else if (ttype.toLowerCase().startsWith("above"))
- {
- ((jalview.schemes.GraduatedColor) colour)
- .setThreshType(AnnotationColourGradient.ABOVE_THRESHOLD);
- }
- else
- {
- ((jalview.schemes.GraduatedColor) colour)
- .setThreshType(AnnotationColourGradient.NO_THRESHOLD);
- if (!ttype.toLowerCase().startsWith("no"))
- {
- System.err
- .println("Ignoring unrecognised threshold type : "
- + ttype);
- }
- }
- }
- if (((GraduatedColor) colour).getThreshType() != AnnotationColourGradient.NO_THRESHOLD)
- {
- try
- {
- gcol.nextToken();
- tval = gcol.nextToken();
- ((jalview.schemes.GraduatedColor) colour)
- .setThresh(new Float(tval).floatValue());
- } catch (Exception e)
- {
- System.err
- .println("Couldn't parse threshold value as a float: ("
- + tval + ")");
- e.printStackTrace();
- }
- }
- // parse the thresh-is-min token ?
- if (gcol.hasMoreTokens())
- {
- System.err
- .println("Ignoring additional tokens in parameters in graduated colour specification\n");
- while (gcol.hasMoreTokens())
- {
- System.err.println("|" + gcol.nextToken());
- }
- System.err.println("\n");
- }
- }
- }
- else
- {
- UserColourScheme ucs = new UserColourScheme(colscheme);
- colour = ucs.findColour('A');
- }
- if (colour != null)
- {
- colours.put(type, colour);
- }
- if (st.hasMoreElements())
- {
- String link = st.nextToken();
- typeLink.put(type, link);
- if (featureLink == null)
- {
- featureLink = new Hashtable();
- }
- featureLink.put(type, link);
- }
+ parseFeatureColour(line, ft, gffColumns, colours);
}
continue;
}
- String seqId = "";
- while (st.hasMoreElements())
- {
-
- if (GFFFile)
- {
- // Still possible this is an old Jalview file,
- // which does not have type colours at the beginning
- seqId = token = st.nextToken();
- seq = findName(align, seqId, relaxedIdmatching, newseqs);
- if (seq != null)
- {
- desc = st.nextToken();
- String group = null;
- if (doGffSource && desc.indexOf(' ') == -1)
- {
- // could also be a source term rather than description line
- group = new String(desc);
- }
- type = st.nextToken();
- try
- {
- String stt = st.nextToken();
- if (stt.length() == 0 || stt.equals("-"))
- {
- start = 0;
- }
- else
- {
- start = Integer.parseInt(stt);
- }
- } catch (NumberFormatException ex)
- {
- start = 0;
- }
- try
- {
- String stt = st.nextToken();
- if (stt.length() == 0 || stt.equals("-"))
- {
- end = 0;
- }
- else
- {
- end = Integer.parseInt(stt);
- }
- } catch (NumberFormatException ex)
- {
- end = 0;
- }
- // TODO: decide if non positional feature assertion for input data
- // where end==0 is generally valid
- if (end == 0)
- {
- // treat as non-positional feature, regardless.
- start = 0;
- }
- try
- {
- score = new Float(st.nextToken()).floatValue();
- } catch (NumberFormatException ex)
- {
- score = 0;
- }
-
- sf = new SequenceFeature(type, desc, start, end, score, group);
-
- try
- {
- sf.setValue("STRAND", st.nextToken());
- sf.setValue("FRAME", st.nextToken());
- } catch (Exception ex)
- {
- }
-
- if (st.hasMoreTokens())
- {
- StringBuffer attributes = new StringBuffer();
- boolean sep = false;
- while (st.hasMoreTokens())
- {
- attributes.append((sep ? "\t" : "") + st.nextElement());
- sep = true;
- }
- // TODO validate and split GFF2 attributes field ? parse out
- // ([A-Za-z][A-Za-z0-9_]*) <value> ; and add as
- // sf.setValue(attrib, val);
- sf.setValue("ATTRIBUTES", attributes.toString());
- }
-
- if (processOrAddSeqFeature(align, newseqs, seq, sf, GFFFile,
- relaxedIdmatching))
- {
- // check whether we should add the sequence feature to any other
- // sequences in the alignment with the same or similar
- while ((seq = align.findName(seq, seqId, true)) != null)
- {
- seq.addSequenceFeature(new SequenceFeature(sf));
- }
- }
- break;
- }
- }
-
- if (GFFFile && seq == null)
- {
- desc = token;
- }
- else
- {
- desc = st.nextToken();
- }
- if (!st.hasMoreTokens())
- {
- System.err
- .println("DEBUG: Run out of tokens when trying to identify the destination for the feature.. giving up.");
- // in all probability, this isn't a file we understand, so bail
- // quietly.
- return false;
- }
-
- token = st.nextToken();
-
- if (!token.equals("ID_NOT_SPECIFIED"))
- {
- seq = findName(align, seqId = token, relaxedIdmatching, null);
- st.nextToken();
- }
- else
- {
- seqId = null;
- try
- {
- index = Integer.parseInt(st.nextToken());
- seq = align.getSequenceAt(index);
- } catch (NumberFormatException ex)
- {
- seq = null;
- }
- }
-
- if (seq == null)
- {
- System.out.println("Sequence not found: " + line);
- break;
- }
-
- start = Integer.parseInt(st.nextToken());
- end = Integer.parseInt(st.nextToken());
-
- type = st.nextToken();
-
- if (!colours.containsKey(type))
- {
- // Probably the old style groups file
- UserColourScheme ucs = new UserColourScheme(type);
- colours.put(type, ucs.findColour('A'));
- }
- sf = new SequenceFeature(type, desc, "", start, end, featureGroup);
- if (st.hasMoreTokens())
- {
- try
- {
- score = new Float(st.nextToken()).floatValue();
- // update colourgradient bounds if allowed to
- } catch (NumberFormatException ex)
- {
- score = 0;
- }
- sf.setScore(score);
- }
- if (groupLink != null && removeHTML)
- {
- sf.addLink(groupLink);
- sf.description += "%LINK%";
- }
- if (typeLink.containsKey(type) && removeHTML)
- {
- sf.addLink(typeLink.get(type).toString());
- sf.description += "%LINK%";
- }
-
- parseDescriptionHTML(sf, removeHTML);
-
- seq.addSequenceFeature(sf);
- while (seqId != null
- && (seq = align.findName(seq, seqId, false)) != null)
- {
- seq.addSequenceFeature(new SequenceFeature(sf));
- }
- // If we got here, its not a GFFFile
- GFFFile = false;
+ /*
+ * if not a comment, GFF pragma, startgroup, endgroup or feature
+ * colour specification, that just leaves a feature details line
+ * in either Jalview or GFF format
+ */
+ if (gffVersion == 0)
+ {
+ parseJalviewFeature(line, gffColumns, align, colours, removeHTML,
+ relaxedIdmatching, featureGroup);
+ }
+ else
+ {
+ parseGff(gffColumns, align, relaxedIdmatching, newseqs);
}
}
resetMatcher();
return false;
}
+ /*
+ * experimental - add any dummy sequences with features to the alignment
+ * - we need them for Ensembl feature extraction - though maybe not otherwise
+ */
+ for (SequenceI newseq : newseqs)
+ {
+ if (newseq.getSequenceFeatures() != null)
+ {
+ align.addSequence(newseq);
+ }
+ }
return true;
}
- private enum GffPragmas
- {
- gff_version, sequence_region, feature_ontology, attribute_ontology, source_ontology, species_build, fasta, hash
- };
-
- private static Map<String, GffPragmas> GFFPRAGMA;
- static
+ /**
+ * Try to parse a Jalview format feature specification and add it as a
+ * sequence feature to any matching sequences in the alignment. Returns true
+ * if successful (a feature was added), or false if not.
+ *
+ * @param line
+ * @param gffColumns
+ * @param alignment
+ * @param featureColours
+ * @param removeHTML
+ * @param relaxedIdmatching
+ * @param featureGroup
+ */
+ protected boolean parseJalviewFeature(String line, String[] gffColumns,
+ AlignmentI alignment, Map<String, Object> featureColours,
+ boolean removeHTML, boolean relaxedIdMatching, String featureGroup)
{
- GFFPRAGMA = new HashMap<String, GffPragmas>();
- GFFPRAGMA.put("sequence-region", GffPragmas.sequence_region);
- GFFPRAGMA.put("feature-ontology", GffPragmas.feature_ontology);
- GFFPRAGMA.put("#", GffPragmas.hash);
- GFFPRAGMA.put("fasta", GffPragmas.fasta);
- GFFPRAGMA.put("species-build", GffPragmas.species_build);
- GFFPRAGMA.put("source-ontology", GffPragmas.source_ontology);
- GFFPRAGMA.put("attribute-ontology", GffPragmas.attribute_ontology);
- }
+ /*
+ * tokens: description seqid seqIndex start end type [score]
+ */
+ if (gffColumns.length < 6)
+ {
+ System.err.println("Ignoring feature line '" + line
+ + "' with too few columns (" + gffColumns.length + ")");
+ return false;
+ }
+ String desc = gffColumns[0];
+ String seqId = gffColumns[1];
+ SequenceI seq = findSequence(seqId, alignment, null, relaxedIdMatching);
- private void processGffPragma(String line, Map<String, String> gffProps,
- AlignmentI align, ArrayList<SequenceI> newseqs)
- throws IOException
- {
- // line starts with ##
- int spacepos = line.indexOf(' ');
- String pragma = spacepos == -1 ? line.substring(2).trim() : line
- .substring(2, spacepos);
- GffPragmas gffpragma = GFFPRAGMA.get(pragma.toLowerCase());
- if (gffpragma == null)
+ if (!ID_NOT_SPECIFIED.equals(seqId))
{
- return;
+ seq = findSequence(seqId, alignment, null, relaxedIdMatching);
}
- switch (gffpragma)
+ else
{
- case gff_version:
+ seqId = null;
+ seq = null;
+ String seqIndex = gffColumns[2];
try
{
- gffversion = Integer.parseInt(line.substring(spacepos + 1));
- } finally
+ int idx = Integer.parseInt(seqIndex);
+ seq = alignment.getSequenceAt(idx);
+ } catch (NumberFormatException ex)
{
-
+ System.err.println("Invalid sequence index: " + seqIndex);
}
- break;
- case feature_ontology:
- // resolve against specific feature ontology
- break;
- case attribute_ontology:
- // resolve against specific attribute ontology
- break;
- case source_ontology:
- // resolve against specific source ontology
- break;
- case species_build:
- // resolve against specific NCBI taxon version
- break;
- case hash:
- // close off any open feature hierarchies
- break;
- case fasta:
- // process the rest of the file as a fasta file and replace any dummy
- // sequence IDs
- process_as_fasta(align, newseqs);
- break;
- default:
- // we do nothing ?
- System.err.println("Ignoring unknown pragma:\n" + line);
}
- }
- private void process_as_fasta(AlignmentI align, List<SequenceI> newseqs)
- throws IOException
- {
- try
+ if (seq == null)
{
- mark();
- } catch (IOException q)
+ System.out.println("Sequence not found: " + line);
+ return false;
+ }
+
+ int startPos = Integer.parseInt(gffColumns[3]);
+ int endPos = Integer.parseInt(gffColumns[4]);
+
+ String ft = gffColumns[5];
+
+ if (!featureColours.containsKey(ft))
{
+ /*
+ * Perhaps an old style groups file with no colours -
+ * synthesize a colour from the feature type
+ */
+ UserColourScheme ucs = new UserColourScheme(ft);
+ featureColours.put(ft, ucs.findColour('A'));
}
- FastaFile parser = new FastaFile(this);
- List<SequenceI> includedseqs = parser.getSeqs();
- SequenceIdMatcher smatcher = new SequenceIdMatcher(newseqs);
- // iterate over includedseqs, and replacing matching ones with newseqs
- // sequences. Generic iterator not used here because we modify includedseqs
- // as we go
- for (int p = 0, pSize = includedseqs.size(); p < pSize; p++)
+ SequenceFeature sf = new SequenceFeature(ft, desc, "", startPos,
+ endPos, featureGroup);
+ if (gffColumns.length > 6)
{
- // search for any dummy seqs that this sequence can be used to update
- SequenceI dummyseq = smatcher.findIdMatch(includedseqs.get(p));
- if (dummyseq != null)
+ float score = Float.NaN;
+ try
{
- // dummyseq was created so it could be annotated and referred to in
- // alignments/codon mappings
-
- SequenceI mseq = includedseqs.get(p);
- // mseq is the 'template' imported from the FASTA file which we'll use
- // to coomplete dummyseq
- if (dummyseq instanceof SequenceDummy)
- {
- // probably have the pattern wrong
- // idea is that a flyweight proxy for a sequence ID can be created for
- // 1. stable reference creation
- // 2. addition of annotation
- // 3. future replacement by a real sequence
- // current pattern is to create SequenceDummy objects - a convenience
- // constructor for a Sequence.
- // problem is that when promoted to a real sequence, all references
- // need
- // to be updated somehow.
- ((SequenceDummy) dummyseq).become(mseq);
- includedseqs.set(p, dummyseq); // template is no longer needed
- }
+ score = new Float(gffColumns[6]).floatValue();
+ // update colourgradient bounds if allowed to
+ } catch (NumberFormatException ex)
+ {
+ // leave as NaN
}
+ sf.setScore(score);
}
- // finally add sequences to the dataset
- for (SequenceI seq : includedseqs)
+
+ parseDescriptionHTML(sf, removeHTML);
+
+ seq.addSequenceFeature(sf);
+
+ while (seqId != null
+ && (seq = alignment.findName(seq, seqId, false)) != null)
{
- align.addSequence(seq);
+ seq.addSequenceFeature(new SequenceFeature(sf));
}
+ return true;
}
/**
- * take a sequence feature and examine its attributes to decide how it should
- * be added to a sequence
+ * Process a feature type colour specification
*
- * @param seq
- * - the destination sequence constructed or discovered in the
- * current context
- * @param sf
- * - the base feature with ATTRIBUTES property containing any
- * additional attributes
- * @param gFFFile
- * - true if we are processing a GFF annotation file
- * @return true if sf was actually added to the sequence, false if it was
- * processed in another way
+ * @param line
+ * the current input line (for error messages only)
+ * @param featureType
+ * the first token on the line
+ * @param gffColumns
+ * holds tokens on the line
+ * @param colours
+ * map to which to add derived colour specification
*/
- public boolean processOrAddSeqFeature(AlignmentI align,
- List<SequenceI> newseqs, SequenceI seq, SequenceFeature sf,
- boolean gFFFile, boolean relaxedIdMatching)
+ protected void parseFeatureColour(String line, String featureType,
+ String[] gffColumns, Map<String, Object> colours)
{
- String attr = (String) sf.getValue("ATTRIBUTES");
- boolean add = true;
- if (gFFFile && attr != null)
+ Object colour = null;
+ String colscheme = gffColumns[1];
+ if (colscheme.indexOf("|") > -1
+ || colscheme.trim().equalsIgnoreCase("label"))
{
- int nattr = 8;
-
- for (String attset : attr.split("\t"))
- {
- if (attset == null || attset.trim().length() == 0)
- {
- continue;
- }
- nattr++;
- Map<String, List<String>> set = new HashMap<String, List<String>>();
- // normally, only expect one column - 9 - in this field
- // the attributes (Gff3) or groups (gff2) field
- for (String pair : attset.trim().split(";"))
- {
- pair = pair.trim();
- if (pair.length() == 0)
- {
- continue;
- }
-
- // expect either space seperated (gff2) or '=' separated (gff3)
- // key/value pairs here
-
- int eqpos = pair.indexOf('='), sppos = pair.indexOf(' ');
- String key = null, value = null;
-
- if (sppos > -1 && (eqpos == -1 || sppos < eqpos))
- {
- key = pair.substring(0, sppos);
- value = pair.substring(sppos + 1);
- }
- else
- {
- if (eqpos > -1 && (sppos == -1 || eqpos < sppos))
- {
- key = pair.substring(0, eqpos);
- value = pair.substring(eqpos + 1);
- }
- else
- {
- key = pair;
- }
- }
- if (key != null)
- {
- List<String> vals = set.get(key);
- if (vals == null)
- {
- vals = new ArrayList<String>();
- set.put(key, vals);
- }
- if (value != null)
- {
- vals.add(value.trim());
- }
- }
- }
- try
- {
- add &= processGffKey(set, nattr, seq, sf, align, newseqs,
- relaxedIdMatching); // process decides if
- // feature is actually
- // added
- } catch (InvalidGFF3FieldException ivfe)
- {
- System.err.println(ivfe);
- }
- }
+ colour = parseGraduatedColourScheme(line, colscheme);
}
- if (add)
+ else
{
- seq.addSequenceFeature(sf);
+ UserColourScheme ucs = new UserColourScheme(colscheme);
+ colour = ucs.findColour('A');
}
- return add;
- }
-
- public class InvalidGFF3FieldException extends Exception
- {
- String field, value;
-
- public InvalidGFF3FieldException(String field,
- Map<String, List<String>> set, String message)
+ if (colour != null)
{
- super(message + " (Field was " + field + " and value was "
- + set.get(field).toString());
- this.field = field;
- this.value = set.get(field).toString();
+ colours.put(featureType, colour);
}
-
}
/**
- * take a set of keys for a feature and interpret them
+ * Parse a Jalview graduated colour descriptor
*
- * @param set
- * @param nattr
- * @param seq
- * @param sf
+ * @param line
+ * @param colourDescriptor
* @return
*/
- public boolean processGffKey(Map<String, List<String>> set, int nattr,
- SequenceI seq, SequenceFeature sf, AlignmentI align,
- List<SequenceI> newseqs, boolean relaxedIdMatching)
- throws InvalidGFF3FieldException
+ protected GraduatedColor parseGraduatedColourScheme(String line,
+ String colourDescriptor)
{
- String attr;
- // decide how to interpret according to type
- if (sf.getType().equals("similarity"))
+ // Parse '|' separated graduated colourscheme fields:
+ // [label|][mincolour|maxcolour|[absolute|]minvalue|maxvalue|thresholdtype|thresholdvalue]
+ // can either provide 'label' only, first is optional, next two
+ // colors are required (but may be
+ // left blank), next is optional, nxt two min/max are required.
+ // first is either 'label'
+ // first/second and third are both hexadecimal or word equivalent
+ // colour.
+ // next two are values parsed as floats.
+ // fifth is either 'above','below', or 'none'.
+ // sixth is a float value and only required when fifth is either
+ // 'above' or 'below'.
+ StringTokenizer gcol = new StringTokenizer(colourDescriptor, "|", true);
+ // set defaults
+ float min = Float.MIN_VALUE, max = Float.MAX_VALUE;
+ boolean labelCol = false;
+ // Parse spec line
+ String mincol = gcol.nextToken();
+ if (mincol == "|")
{
- int strand = sf.getStrand();
- // exonerate cdna/protein map
- // look for fields
- List<SequenceI> querySeq = findNames(align, newseqs,
- relaxedIdMatching, set.get(attr = "Query"));
- if (querySeq == null || querySeq.size() != 1)
- {
- throw new InvalidGFF3FieldException(attr, set,
- "Expecting exactly one sequence in Query field (got "
- + set.get(attr) + ")");
- }
- if (set.containsKey(attr = "Align"))
- {
- // process the align maps and create cdna/protein maps
- // ideally, the query sequences are in the alignment, but maybe not...
-
- AlignedCodonFrame alco = new AlignedCodonFrame();
- MapList codonmapping = constructCodonMappingFromAlign(set, attr,
- strand);
-
- // add codon mapping, and hope!
- alco.addMap(seq, querySeq.get(0), codonmapping);
- align.addCodonFrame(alco);
- // everything that's needed to be done is done
- // no features to create here !
- return false;
- }
-
+ System.err
+ .println("Expected either 'label' or a colour specification in the line: "
+ + line);
+ return null;
}
- return true;
- }
-
- private MapList constructCodonMappingFromAlign(
- Map<String, List<String>> set, String attr, int strand)
- throws InvalidGFF3FieldException
- {
- if (strand == 0)
+ String maxcol = null;
+ if (mincol.toLowerCase().indexOf("label") == 0)
{
- throw new InvalidGFF3FieldException(attr, set,
- "Invalid strand for a codon mapping (cannot be 0)");
+ labelCol = true;
+ mincol = (gcol.hasMoreTokens() ? gcol.nextToken() : null); // skip '|'
+ mincol = (gcol.hasMoreTokens() ? gcol.nextToken() : null);
}
- List<Integer> fromrange = new ArrayList<Integer>(), torange = new ArrayList<Integer>();
- int lastppos = 0, lastpframe = 0;
- for (String range : set.get(attr))
+ String abso = null, minval, maxval;
+ if (mincol != null)
{
- List<Integer> ints = new ArrayList<Integer>();
- StringTokenizer st = new StringTokenizer(range, " ");
- while (st.hasMoreTokens())
+ // at least four more tokens
+ if (mincol.equals("|"))
{
- String num = st.nextToken();
- try
- {
- ints.add(new Integer(num));
- } catch (NumberFormatException nfe)
- {
- throw new InvalidGFF3FieldException(attr, set,
- "Invalid number in field " + num);
- }
+ mincol = "";
}
- // Align positionInRef positionInQuery LengthInRef
- // contig_1146 exonerate:protein2genome:local similarity 8534 11269
- // 3652 - . alignment_id 0 ;
- // Query DDB_G0269124
- // Align 11270 143 120
- // corresponds to : 120 bases align at pos 143 in protein to 11270 on
- // dna in strand direction
- // Align 11150 187 282
- // corresponds to : 282 bases align at pos 187 in protein to 11150 on
- // dna in strand direction
- //
- // Align 10865 281 888
- // Align 9977 578 1068
- // Align 8909 935 375
- //
- if (ints.size() != 3)
+ else
{
- throw new InvalidGFF3FieldException(attr, set,
- "Invalid number of fields for this attribute ("
- + ints.size() + ")");
+ gcol.nextToken(); // skip next '|'
}
- fromrange.add(new Integer(ints.get(0).intValue()));
- fromrange.add(new Integer(ints.get(0).intValue() + strand
- * ints.get(2).intValue()));
- // how are intron/exon boundaries that do not align in codons
- // represented
- if (ints.get(1).equals(lastppos) && lastpframe > 0)
+ // continue parsing rest of line
+ maxcol = gcol.nextToken();
+ if (maxcol.equals("|"))
{
- // extend existing to map
- lastppos += ints.get(2) / 3;
- lastpframe = ints.get(2) % 3;
- torange.set(torange.size() - 1, new Integer(lastppos));
+ maxcol = "";
}
else
{
- // new to map range
- torange.add(ints.get(1));
- lastppos = ints.get(1) + ints.get(2) / 3;
- lastpframe = ints.get(2) % 3;
- torange.add(new Integer(lastppos));
+ gcol.nextToken(); // skip next '|'
+ }
+ abso = gcol.nextToken();
+ gcol.nextToken(); // skip next '|'
+ if (abso.toLowerCase().indexOf("abso") != 0)
+ {
+ minval = abso;
+ abso = null;
+ }
+ else
+ {
+ minval = gcol.nextToken();
+ gcol.nextToken(); // skip next '|'
+ }
+ maxval = gcol.nextToken();
+ if (gcol.hasMoreTokens())
+ {
+ gcol.nextToken(); // skip next '|'
+ }
+ try
+ {
+ if (minval.length() > 0)
+ {
+ min = Float.valueOf(minval);
+ }
+ } catch (Exception e)
+ {
+ System.err
+ .println("Couldn't parse the minimum value for graduated colour for type ("
+ + colourDescriptor
+ + ") - did you misspell 'auto' for the optional automatic colour switch ?");
+ e.printStackTrace();
+ }
+ try
+ {
+ if (maxval.length() > 0)
+ {
+ max = Float.valueOf(maxval);
+ }
+ } catch (Exception e)
+ {
+ System.err
+ .println("Couldn't parse the maximum value for graduated colour for type ("
+ + colourDescriptor + ")");
+ e.printStackTrace();
}
}
- // from and to ranges must end up being a series of start/end intervals
- if (fromrange.size() % 2 == 1)
- {
- throw new InvalidGFF3FieldException(attr, set,
- "Couldn't parse the DNA alignment range correctly");
- }
- if (torange.size() % 2 == 1)
+ else
{
- throw new InvalidGFF3FieldException(attr, set,
- "Couldn't parse the protein alignment range correctly");
+ // add in some dummy min/max colours for the label-only
+ // colourscheme.
+ mincol = "FFFFFF";
+ maxcol = "000000";
}
- // finally, build the map
- int[] frommap = new int[fromrange.size()], tomap = new int[torange
- .size()];
- int p = 0;
- for (Integer ip : fromrange)
+
+ GraduatedColor colour = null;
+ try
{
- frommap[p++] = ip.intValue();
- }
- p = 0;
- for (Integer ip : torange)
+ colour = new GraduatedColor(
+ new UserColourScheme(mincol).findColour('A'),
+ new UserColourScheme(maxcol).findColour('A'), min, max);
+ } catch (Exception e)
{
- tomap[p++] = ip.intValue();
+ System.err.println("Couldn't parse the graduated colour scheme ("
+ + colourDescriptor + ")");
+ e.printStackTrace();
}
-
- return new MapList(frommap, tomap, 3, 1);
- }
-
- private List<SequenceI> findNames(AlignmentI align,
- List<SequenceI> newseqs, boolean relaxedIdMatching,
- List<String> list)
- {
- List<SequenceI> found = new ArrayList<SequenceI>();
- for (String seqId : list)
+ if (colour != null)
{
- SequenceI seq = findName(align, seqId, relaxedIdMatching, newseqs);
- if (seq != null)
+ colour.setColourByLabel(labelCol);
+ colour.setAutoScaled(abso == null);
+ // add in any additional parameters
+ String ttype = null, tval = null;
+ if (gcol.hasMoreTokens())
+ {
+ // threshold type and possibly a threshold value
+ ttype = gcol.nextToken();
+ if (ttype.toLowerCase().startsWith("below"))
+ {
+ colour.setThreshType(AnnotationColourGradient.BELOW_THRESHOLD);
+ }
+ else if (ttype.toLowerCase().startsWith("above"))
+ {
+ colour.setThreshType(AnnotationColourGradient.ABOVE_THRESHOLD);
+ }
+ else
+ {
+ colour.setThreshType(AnnotationColourGradient.NO_THRESHOLD);
+ if (!ttype.toLowerCase().startsWith("no"))
+ {
+ System.err.println("Ignoring unrecognised threshold type : "
+ + ttype);
+ }
+ }
+ }
+ if (colour.getThreshType() != AnnotationColourGradient.NO_THRESHOLD)
+ {
+ try
+ {
+ gcol.nextToken();
+ tval = gcol.nextToken();
+ colour.setThresh(new Float(tval).floatValue());
+ } catch (Exception e)
+ {
+ System.err.println("Couldn't parse threshold value as a float: ("
+ + tval + ")");
+ e.printStackTrace();
+ }
+ }
+ // parse the thresh-is-min token ?
+ if (gcol.hasMoreTokens())
{
- found.add(seq);
+ System.err
+ .println("Ignoring additional tokens in parameters in graduated colour specification\n");
+ while (gcol.hasMoreTokens())
+ {
+ System.err.println("|" + gcol.nextToken());
+ }
+ System.err.println("\n");
}
}
- return found;
+ return colour;
}
- private AlignmentI lastmatchedAl = null;
-
- private SequenceIdMatcher matcher = null;
-
/**
* clear any temporary handles used to speed up ID matching
*/
- private void resetMatcher()
+ protected void resetMatcher()
{
lastmatchedAl = null;
matcher = null;
}
- private SequenceI findName(AlignmentI align, String seqId,
- boolean relaxedIdMatching, List<SequenceI> newseqs)
+ /**
+ * Returns a sequence matching the given id, as follows
+ * <ul>
+ * <li>strict matching is on exact sequence name</li>
+ * <li>relaxed matching allows matching on a token within the sequence name,
+ * or a dbxref</li>
+ * <li>first tries to find a match in the alignment sequences</li>
+ * <li>else tries to find a match in the new sequences already generated while
+ * parsing the features file</li>
+ * <li>else creates a new placeholder sequence, adds it to the new sequences
+ * list, and returns it</li>
+ * </ul>
+ *
+ * @param seqId
+ * @param align
+ * @param newseqs
+ * @param relaxedIdMatching
+ *
+ * @return
+ */
+ protected SequenceI findSequence(String seqId, AlignmentI align,
+ List<SequenceI> newseqs, boolean relaxedIdMatching)
{
+ // TODO encapsulate in SequenceIdMatcher, share the matcher
+ // with the GffHelper (removing code duplication)
SequenceI match = null;
if (relaxedIdMatching)
{
if (lastmatchedAl != align)
{
- matcher = new SequenceIdMatcher(
- (lastmatchedAl = align).getSequencesArray());
+ lastmatchedAl = align;
+ matcher = new SequenceIdMatcher(align.getSequencesArray());
if (newseqs != null)
{
matcher.addAll(newseqs);
{
return;
}
- jalview.util.ParseHtmlBodyAndLinks parsed = new jalview.util.ParseHtmlBodyAndLinks(
+ ParseHtmlBodyAndLinks parsed = new ParseHtmlBodyAndLinks(
sf.getDescription(), removeHTML, newline);
sf.description = (removeHTML) ? parsed.getNonHtmlContent()
/**
* generate a features file for seqs includes non-pos features by default.
*
- * @param seqs
+ * @param sequences
* source of sequence features
* @param visible
* hash of feature types and colours
* @return features file contents
*/
- public String printJalviewFormat(SequenceI[] seqs,
+ public String printJalviewFormat(SequenceI[] sequences,
Map<String, Object> visible)
{
- return printJalviewFormat(seqs, visible, true, true);
+ return printJalviewFormat(sequences, visible, true, true);
}
/**
* generate a features file for seqs with colours from visible (if any)
*
- * @param seqs
+ * @param sequences
* source of features
* @param visible
* hash of Colours for each feature type
* of group or type)
* @return features file contents
*/
- public String printJalviewFormat(SequenceI[] seqs, Map visible,
- boolean visOnly, boolean nonpos)
+ public String printJalviewFormat(SequenceI[] sequences,
+ Map<String, Object> visible, boolean visOnly, boolean nonpos)
{
- StringBuffer out = new StringBuffer();
- SequenceFeature[] next;
+ StringBuilder out = new StringBuilder(256);
boolean featuresGen = false;
if (visOnly && !nonpos && (visible == null || visible.size() < 1))
{
// write feature colours only if we're given them and we are generating
// viewed features
// TODO: decide if feature links should also be written here ?
- Iterator en = visible.keySet().iterator();
- String type, color;
+ Iterator<String> en = visible.keySet().iterator();
+ String featureType, color;
while (en.hasNext())
{
- type = en.next().toString();
+ featureType = en.next().toString();
- if (visible.get(type) instanceof GraduatedColor)
+ if (visible.get(featureType) instanceof GraduatedColor)
{
- GraduatedColor gc = (GraduatedColor) visible.get(type);
+ GraduatedColor gc = (GraduatedColor) visible.get(featureType);
color = (gc.isColourByLabel() ? "label|" : "")
+ Format.getHexString(gc.getMinColor()) + "|"
+ Format.getHexString(gc.getMaxColor())
color += "none";
}
}
- else if (visible.get(type) instanceof java.awt.Color)
+ else if (visible.get(featureType) instanceof Color)
{
- color = Format.getHexString((java.awt.Color) visible.get(type));
+ color = Format.getHexString((Color) visible.get(featureType));
}
else
{
// legacy support for integer objects containing colour triplet values
- color = Format.getHexString(new java.awt.Color(Integer
- .parseInt(visible.get(type).toString())));
+ color = Format.getHexString(new Color(Integer.parseInt(visible
+ .get(featureType).toString())));
}
- out.append(type);
- out.append("\t");
+ out.append(featureType);
+ out.append(TAB);
out.append(color);
out.append(newline);
}
}
// Work out which groups are both present and visible
- Vector groups = new Vector();
+ List<String> groups = new ArrayList<String>();
int groupIndex = 0;
boolean isnonpos = false;
- for (int i = 0; i < seqs.length; i++)
+ SequenceFeature[] features;
+ for (int i = 0; i < sequences.length; i++)
{
- next = seqs[i].getSequenceFeatures();
- if (next != null)
+ features = sequences[i].getSequenceFeatures();
+ if (features != null)
{
- for (int j = 0; j < next.length; j++)
+ for (int j = 0; j < features.length; j++)
{
- isnonpos = next[j].begin == 0 && next[j].end == 0;
+ isnonpos = features[j].begin == 0 && features[j].end == 0;
if ((!nonpos && isnonpos)
|| (!isnonpos && visOnly && !visible
- .containsKey(next[j].type)))
+ .containsKey(features[j].type)))
{
continue;
}
- if (next[j].featureGroup != null
- && !groups.contains(next[j].featureGroup))
+ if (features[j].featureGroup != null
+ && !groups.contains(features[j].featureGroup))
{
- groups.addElement(next[j].featureGroup);
+ groups.add(features[j].featureGroup);
}
}
}
String group = null;
do
{
-
if (groups.size() > 0 && groupIndex < groups.size())
{
- group = groups.elementAt(groupIndex).toString();
+ group = groups.get(groupIndex);
out.append(newline);
- out.append("STARTGROUP\t");
+ out.append("STARTGROUP").append(TAB);
out.append(group);
out.append(newline);
}
group = null;
}
- for (int i = 0; i < seqs.length; i++)
+ for (int i = 0; i < sequences.length; i++)
{
- next = seqs[i].getSequenceFeatures();
- if (next != null)
+ features = sequences[i].getSequenceFeatures();
+ if (features != null)
{
- for (int j = 0; j < next.length; j++)
+ for (int j = 0; j < features.length; j++)
{
- isnonpos = next[j].begin == 0 && next[j].end == 0;
+ isnonpos = features[j].begin == 0 && features[j].end == 0;
if ((!nonpos && isnonpos)
|| (!isnonpos && visOnly && !visible
- .containsKey(next[j].type)))
+ .containsKey(features[j].type)))
{
// skip if feature is nonpos and we ignore them or if we only
// output visible and it isn't non-pos and it's not visible
}
if (group != null
- && (next[j].featureGroup == null || !next[j].featureGroup
+ && (features[j].featureGroup == null || !features[j].featureGroup
.equals(group)))
{
continue;
}
- if (group == null && next[j].featureGroup != null)
+ if (group == null && features[j].featureGroup != null)
{
continue;
}
// we have features to output
featuresGen = true;
- if (next[j].description == null
- || next[j].description.equals(""))
+ if (features[j].description == null
+ || features[j].description.equals(""))
{
- out.append(next[j].type + "\t");
+ out.append(features[j].type).append(TAB);
}
else
{
- if (next[j].links != null
- && next[j].getDescription().indexOf("<html>") == -1)
+ if (features[j].links != null
+ && features[j].getDescription().indexOf("<html>") == -1)
{
out.append("<html>");
}
- out.append(next[j].description + " ");
- if (next[j].links != null)
+ out.append(features[j].description + " ");
+ if (features[j].links != null)
{
- for (int l = 0; l < next[j].links.size(); l++)
+ for (int l = 0; l < features[j].links.size(); l++)
{
- String label = next[j].links.elementAt(l).toString();
+ String label = features[j].links.elementAt(l).toString();
String href = label.substring(label.indexOf("|") + 1);
label = label.substring(0, label.indexOf("|"));
- if (next[j].description.indexOf(href) == -1)
+ if (features[j].description.indexOf(href) == -1)
{
out.append("<a href=\"" + href + "\">" + label + "</a>");
}
}
- if (next[j].getDescription().indexOf("</html>") == -1)
+ if (features[j].getDescription().indexOf("</html>") == -1)
{
out.append("</html>");
}
}
- out.append("\t");
+ out.append(TAB);
}
- out.append(seqs[i].getName());
+ out.append(sequences[i].getName());
out.append("\t-1\t");
- out.append(next[j].begin);
- out.append("\t");
- out.append(next[j].end);
- out.append("\t");
- out.append(next[j].type);
- if (!Float.isNaN(next[j].score))
+ out.append(features[j].begin);
+ out.append(TAB);
+ out.append(features[j].end);
+ out.append(TAB);
+ out.append(features[j].type);
+ if (!Float.isNaN(features[j].score))
{
- out.append("\t");
- out.append(next[j].score);
+ out.append(TAB);
+ out.append(features[j].score);
}
out.append(newline);
}
if (group != null)
{
- out.append("ENDGROUP\t");
+ out.append("ENDGROUP").append(TAB);
out.append(group);
out.append(newline);
groupIndex++;
}
/**
- * generate a gff file for sequence features includes non-pos features by
- * default.
+ * Parse method that is called when a GFF file is dragged to the desktop
+ */
+ @Override
+ public void parse()
+ {
+ AlignViewportI av = getViewport();
+ if (av != null)
+ {
+ if (av.getAlignment() != null)
+ {
+ dataset = av.getAlignment().getDataset();
+ }
+ if (dataset == null)
+ {
+ // working in the applet context ?
+ dataset = av.getAlignment();
+ }
+ }
+ else
+ {
+ dataset = new Alignment(new SequenceI[] {});
+ }
+
+ boolean parseResult = parse(dataset, null, false, true);
+ if (!parseResult)
+ {
+ // pass error up somehow
+ }
+ if (av != null)
+ {
+ // update viewport with the dataset data ?
+ }
+ else
+ {
+ setSeqs(dataset.getSequencesArray());
+ }
+ }
+
+ /**
+ * Implementation of unused abstract method
+ *
+ * @return error message
+ */
+ @Override
+ public String print()
+ {
+ return "Use printGffFormat() or printJalviewFormat()";
+ }
+
+ /**
+ * Returns features output in GFF2 format, including hidden and non-positional
+ * features
*
- * @param seqs
+ * @param sequences
+ * the sequences whose features are to be output
* @param visible
+ * a map whose keys are the type names of visible features
* @return
*/
- public String printGFFFormat(SequenceI[] seqs, Map<String, Object> visible)
+ public String printGffFormat(SequenceI[] sequences,
+ Map<String, Object> visible)
{
- return printGFFFormat(seqs, visible, true, true);
+ return printGffFormat(sequences, visible, true, true);
}
- public String printGFFFormat(SequenceI[] seqs,
- Map<String, Object> visible, boolean visOnly, boolean nonpos)
+ /**
+ * Returns features output in GFF2 format
+ *
+ * @param sequences
+ * the sequences whose features are to be output
+ * @param visible
+ * a map whose keys are the type names of visible features
+ * @param outputVisibleOnly
+ * @param includeNonPositionalFeatures
+ * @return
+ */
+ public String printGffFormat(SequenceI[] sequences,
+ Map<String, Object> visible, boolean outputVisibleOnly,
+ boolean includeNonPositionalFeatures)
{
- StringBuffer out = new StringBuffer();
- SequenceFeature[] next;
+ StringBuilder out = new StringBuilder(256);
+ out.append(String.format("%s %d\n", GFF_VERSION, gffVersion));
String source;
boolean isnonpos;
- for (int i = 0; i < seqs.length; i++)
+ for (SequenceI seq : sequences)
{
- if (seqs[i].getSequenceFeatures() != null)
+ SequenceFeature[] features = seq.getSequenceFeatures();
+ if (features != null)
{
- next = seqs[i].getSequenceFeatures();
- for (int j = 0; j < next.length; j++)
+ for (SequenceFeature sf : features)
{
- isnonpos = next[j].begin == 0 && next[j].end == 0;
- if ((!nonpos && isnonpos)
- || (!isnonpos && visOnly && !visible
- .containsKey(next[j].type)))
+ isnonpos = sf.begin == 0 && sf.end == 0;
+ if (!includeNonPositionalFeatures && isnonpos)
+ {
+ /*
+ * ignore non-positional features if not wanted
+ */
+ continue;
+ }
+ // TODO why the test !isnonpos here?
+ // what about not visible non-positional features?
+ if (!isnonpos && outputVisibleOnly
+ && !visible.containsKey(sf.type))
{
+ /*
+ * ignore not visible features if not wanted
+ */
continue;
}
- source = next[j].featureGroup;
+ source = sf.featureGroup;
if (source == null)
{
- source = next[j].getDescription();
+ source = sf.getDescription();
}
- out.append(seqs[i].getName());
- out.append("\t");
+ out.append(seq.getName());
+ out.append(TAB);
out.append(source);
- out.append("\t");
- out.append(next[j].type);
- out.append("\t");
- out.append(next[j].begin);
- out.append("\t");
- out.append(next[j].end);
- out.append("\t");
- out.append(next[j].score);
- out.append("\t");
-
- if (next[j].getValue("STRAND") != null)
- {
- out.append(next[j].getValue("STRAND"));
- out.append("\t");
- }
- else
+ out.append(TAB);
+ out.append(sf.type);
+ out.append(TAB);
+ out.append(sf.begin);
+ out.append(TAB);
+ out.append(sf.end);
+ out.append(TAB);
+ out.append(sf.score);
+ out.append(TAB);
+
+ int strand = sf.getStrand();
+ out.append(strand == 1 ? "+" : (strand == -1 ? "-" : "."));
+ out.append(TAB);
+
+ String phase = sf.getPhase();
+ out.append(phase == null ? "." : phase);
+
+ // miscellaneous key-values (GFF column 9)
+ String attributes = sf.getAttributes();
+ if (attributes != null)
{
- out.append(".\t");
+ out.append(TAB).append(attributes);
}
- if (next[j].getValue("FRAME") != null)
- {
- out.append(next[j].getValue("FRAME"));
- }
- else
- {
- out.append(".");
- }
- // TODO: verify/check GFF - should there be a /t here before attribute
- // output ?
+ out.append(newline);
+ }
+ }
+ }
- if (next[j].getValue("ATTRIBUTES") != null)
- {
- out.append(next[j].getValue("ATTRIBUTES"));
- }
+ return out.toString();
+ }
- out.append(newline);
+ /**
+ * Returns a mapping given list of one or more Align descriptors (exonerate
+ * format)
+ *
+ * @param alignedRegions
+ * a list of "Align fromStart toStart fromCount"
+ * @param mapIsFromCdna
+ * if true, 'from' is dna, else 'from' is protein
+ * @param strand
+ * either 1 (forward) or -1 (reverse)
+ * @return
+ * @throws IOException
+ */
+ protected MapList constructCodonMappingFromAlign(
+ List<String> alignedRegions, boolean mapIsFromCdna, int strand)
+ throws IOException
+ {
+ if (strand == 0)
+ {
+ throw new IOException(
+ "Invalid strand for a codon mapping (cannot be 0)");
+ }
+ int regions = alignedRegions.size();
+ // arrays to hold [start, end] for each aligned region
+ int[] fromRanges = new int[regions * 2]; // from dna
+ int[] toRanges = new int[regions * 2]; // to protein
+ int fromRangesIndex = 0;
+ int toRangesIndex = 0;
+
+ for (String range : alignedRegions)
+ {
+ /*
+ * Align mapFromStart mapToStart mapFromCount
+ * e.g. if mapIsFromCdna
+ * Align 11270 143 120
+ * means:
+ * 120 bases from pos 11270 align to pos 143 in peptide
+ * if !mapIsFromCdna this would instead be
+ * Align 143 11270 40
+ */
+ String[] tokens = range.split(" ");
+ if (tokens.length != 3)
+ {
+ throw new IOException("Wrong number of fields for Align");
+ }
+ int fromStart = 0;
+ int toStart = 0;
+ int fromCount = 0;
+ try
+ {
+ fromStart = Integer.parseInt(tokens[0]);
+ toStart = Integer.parseInt(tokens[1]);
+ fromCount = Integer.parseInt(tokens[2]);
+ } catch (NumberFormatException nfe)
+ {
+ throw new IOException("Invalid number in Align field: "
+ + nfe.getMessage());
+ }
+
+ /*
+ * Jalview always models from dna to protein, so adjust values if the
+ * GFF mapping is from protein to dna
+ */
+ if (!mapIsFromCdna)
+ {
+ fromCount *= 3;
+ int temp = fromStart;
+ fromStart = toStart;
+ toStart = temp;
+ }
+ fromRanges[fromRangesIndex++] = fromStart;
+ fromRanges[fromRangesIndex++] = fromStart + strand * (fromCount - 1);
+
+ /*
+ * If a codon has an intron gap, there will be contiguous 'toRanges';
+ * this is handled for us by the MapList constructor.
+ * (It is not clear that exonerate ever generates this case)
+ */
+ toRanges[toRangesIndex++] = toStart;
+ toRanges[toRangesIndex++] = toStart + (fromCount - 1) / 3;
+ }
+
+ return new MapList(fromRanges, toRanges, 3, 1);
+ }
+
+ /**
+ * Parse a GFF format feature. This may include creating a 'dummy' sequence to
+ * hold the feature, or for its mapped sequence, or both, to be resolved
+ * either later in the GFF file (##FASTA section), or when the user loads
+ * additional sequences.
+ *
+ * @param gffColumns
+ * @param alignment
+ * @param relaxedIdMatching
+ * @param newseqs
+ * @return
+ */
+ protected SequenceI parseGff(String[] gffColumns, AlignmentI alignment,
+ boolean relaxedIdMatching, List<SequenceI> newseqs)
+ {
+ /*
+ * GFF: seqid source type start end score strand phase [attributes]
+ */
+ if (gffColumns.length < 5)
+ {
+ System.err.println("Ignoring GFF feature line with too few columns ("
+ + gffColumns.length + ")");
+ return null;
+ }
+ /*
+ * locate referenced sequence in alignment _or_
+ * as a forward or external reference (SequenceDummy)
+ */
+ String seqId = gffColumns[0];
+ SequenceI seq = findSequence(seqId, alignment, newseqs,
+ relaxedIdMatching);
+
+ SequenceFeature sf = null;
+ GffHelperI helper = GffHelperFactory.getHelper(gffColumns);
+ if (helper != null)
+ {
+ try
+ {
+ sf = helper.processGff(seq, gffColumns, alignment, newseqs,
+ relaxedIdMatching);
+ if (sf != null)
+ {
+ seq.addSequenceFeature(sf);
+ while ((seq = alignment.findName(seq, seqId, true)) != null)
+ {
+ seq.addSequenceFeature(new SequenceFeature(sf));
+ }
}
+ } catch (IOException e)
+ {
+ System.err.println("GFF parsing failed with: " + e.getMessage());
+ return null;
}
}
- return out.toString();
+ return seq;
}
/**
- * this is only for the benefit of object polymorphism - method does nothing.
+ * Process the 'column 9' data of the GFF file. This is less formally defined,
+ * and its interpretation will vary depending on the tool that has generated
+ * it.
+ *
+ * @param attributes
+ * @param sf
*/
- public void parse()
+ protected void processGffColumnNine(String attributes, SequenceFeature sf)
{
- // IGNORED
+ sf.setAttributes(attributes);
+
+ /*
+ * Parse attributes in column 9 and add them to the sequence feature's
+ * 'otherData' table; use Note as a best proxy for description
+ */
+ char nameValueSeparator = gffVersion == 3 ? '=' : ' ';
+ // TODO check we don't break GFF2 values which include commas here
+ Map<String, List<String>> nameValues = GffHelperBase
+ .parseNameValuePairs(attributes, ";", nameValueSeparator, ",");
+ for (Entry<String, List<String>> attr : nameValues.entrySet())
+ {
+ String values = StringUtils.listToDelimitedString(attr.getValue(),
+ "; ");
+ sf.setValue(attr.getKey(), values);
+ if (NOTE.equals(attr.getKey()))
+ {
+ sf.setDescription(values);
+ }
+ }
}
/**
- * this is only for the benefit of object polymorphism - method does nothing.
+ * After encountering ##fasta in a GFF3 file, process the remainder of the
+ * file as FAST sequence data. Any placeholder sequences created during
+ * feature parsing are updated with the actual sequences.
*
- * @return error message
+ * @param align
+ * @param newseqs
+ * @throws IOException
*/
- public String print()
+ protected void processAsFasta(AlignmentI align, List<SequenceI> newseqs)
+ throws IOException
{
- return "USE printGFFFormat() or printJalviewFormat()";
+ try
+ {
+ mark();
+ } catch (IOException q)
+ {
+ }
+ FastaFile parser = new FastaFile(this);
+ List<SequenceI> includedseqs = parser.getSeqs();
+
+ SequenceIdMatcher smatcher = new SequenceIdMatcher(newseqs);
+
+ /*
+ * iterate over includedseqs, and replacing matching ones with newseqs
+ * sequences. Generic iterator not used here because we modify
+ * includedseqs as we go
+ */
+ for (int p = 0, pSize = includedseqs.size(); p < pSize; p++)
+ {
+ // search for any dummy seqs that this sequence can be used to update
+ SequenceI includedSeq = includedseqs.get(p);
+ SequenceI dummyseq = smatcher.findIdMatch(includedSeq);
+ if (dummyseq != null && dummyseq instanceof SequenceDummy)
+ {
+ // probably have the pattern wrong
+ // idea is that a flyweight proxy for a sequence ID can be created for
+ // 1. stable reference creation
+ // 2. addition of annotation
+ // 3. future replacement by a real sequence
+ // current pattern is to create SequenceDummy objects - a convenience
+ // constructor for a Sequence.
+ // problem is that when promoted to a real sequence, all references
+ // need to be updated somehow. We avoid that by keeping the same object.
+ ((SequenceDummy) dummyseq).become(includedSeq);
+ dummyseq.createDatasetSequence();
+
+ /*
+ * Update mappings so they are now to the dataset sequence
+ */
+ for (AlignedCodonFrame mapping : align.getCodonFrames())
+ {
+ mapping.updateToDataset(dummyseq);
+ }
+
+ /*
+ * replace parsed sequence with the realised forward reference
+ */
+ includedseqs.set(p, dummyseq);
+
+ /*
+ * and remove from the newseqs list
+ */
+ newseqs.remove(dummyseq);
+ }
+ }
+
+ /*
+ * finally add sequences to the dataset
+ */
+ for (SequenceI seq : includedseqs)
+ {
+ // experimental: mapping-based 'alignment' to query sequence
+ AlignmentUtils.alignSequenceAs(seq, align,
+ String.valueOf(align.getGapCharacter()), false, true);
+
+ // rename sequences if GFF handler requested this
+ // TODO a more elegant way e.g. gffHelper.postProcess(newseqs) ?
+ SequenceFeature[] sfs = seq.getSequenceFeatures();
+ if (sfs != null)
+ {
+ String newName = (String) sfs[0].getValue(GffHelperI.RENAME_TOKEN);
+ if (newName != null)
+ {
+ seq.setName(newName);
+ }
+ }
+ align.addSequence(seq);
+ }
}
+ /**
+ * Process a ## directive
+ *
+ * @param line
+ * @param gffProps
+ * @param align
+ * @param newseqs
+ * @throws IOException
+ */
+ protected void processGffPragma(String line,
+ Map<String, String> gffProps, AlignmentI align,
+ List<SequenceI> newseqs) throws IOException
+ {
+ line = line.trim();
+ if ("###".equals(line))
+ {
+ // close off any open 'forward references'
+ return;
+ }
+
+ String[] tokens = line.substring(2).split(" ");
+ String pragma = tokens[0];
+ String value = tokens.length == 1 ? null : tokens[1];
+
+ if ("gff-version".equalsIgnoreCase(pragma))
+ {
+ if (value != null)
+ {
+ try
+ {
+ // value may be e.g. "3.1.2"
+ gffVersion = Integer.parseInt(value.split("\\.")[0]);
+ } catch (NumberFormatException e)
+ {
+ // ignore
+ }
+ }
+ }
+ else if ("sequence-region".equalsIgnoreCase(pragma))
+ {
+ // could capture <seqid start end> if wanted here
+ }
+ else if ("feature-ontology".equalsIgnoreCase(pragma))
+ {
+ // should resolve against the specified feature ontology URI
+ }
+ else if ("attribute-ontology".equalsIgnoreCase(pragma))
+ {
+ // URI of attribute ontology - not currently used in GFF3
+ }
+ else if ("source-ontology".equalsIgnoreCase(pragma))
+ {
+ // URI of source ontology - not currently used in GFF3
+ }
+ else if ("species-build".equalsIgnoreCase(pragma))
+ {
+ // save URI of specific NCBI taxon version of annotations
+ gffProps.put("species-build", value);
+ }
+ else if ("fasta".equalsIgnoreCase(pragma))
+ {
+ // process the rest of the file as a fasta file and replace any dummy
+ // sequence IDs
+ processAsFasta(align, newseqs);
+ }
+ else
+ {
+ System.err.println("Ignoring unknown pragma: " + line);
+ }
+ }
}
import jalview.api.ComplexAlignFile;
import jalview.api.FeaturesDisplayedI;
+import jalview.api.FeaturesSourceI;
import jalview.bin.Jalview;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.ColumnSelection;
SwingUtilities.invokeLater(new Runnable()
{
+ @Override
public void run()
{
loader.start();
}
}
+ @Override
public void run()
{
String title = protocol.equals(AppletFormatAdapter.PASTE) ? "Copied From Clipboard"
// just in case the caller didn't identify the file for us
if (source != null)
{
- format = new IdentifyFile().Identify(source, false); // identify
+ format = new IdentifyFile().identify(source, false); // identify
// stream and
// rewind rather
// than close
}
else
{
- format = new IdentifyFile().Identify(file, protocol);
+ format = new IdentifyFile().identify(file, protocol);
}
}
.getColumnSelection();
SequenceI[] hiddenSeqs = ((ComplexAlignFile) source)
.getHiddenSequences();
- boolean showSeqFeatures = ((ComplexAlignFile) source)
- .isShowSeqFeatures();
String colourSchemeName = ((ComplexAlignFile) source)
.getGlobalColourScheme();
FeaturesDisplayedI fd = ((ComplexAlignFile) source)
.getDisplayedFeatures();
alignFrame = new AlignFrame(al, hiddenSeqs, colSel,
AlignFrame.DEFAULT_WIDTH, AlignFrame.DEFAULT_HEIGHT);
-
- alignFrame.getViewport().setShowSequenceFeatures(
- showSeqFeatures);
alignFrame.getViewport().setFeaturesDisplayed(fd);
+ alignFrame.getViewport().setShowSequenceFeatures(
+ ((ComplexAlignFile) source).isShowSeqFeatures());
ColourSchemeI cs = ColourSchemeMapper.getJalviewColourScheme(
colourSchemeName, al);
if (cs != null)
{
alignFrame = new AlignFrame(al, AlignFrame.DEFAULT_WIDTH,
AlignFrame.DEFAULT_HEIGHT);
+ if (source instanceof FeaturesSourceI)
+ {
+ alignFrame.getViewport().setShowSequenceFeatures(true);
+ }
}
// add metadata and update ui
if (!protocol.equals(AppletFormatAdapter.PASTE))
{
javax.swing.SwingUtilities.invokeLater(new Runnable()
{
+ @Override
public void run()
{
JOptionPane.showInternalMessageDialog(Desktop.desktop,
{
javax.swing.SwingUtilities.invokeLater(new Runnable()
{
+ @Override
public void run()
{
javax.swing.JOptionPane.showInternalMessageDialog(
{
javax.swing.SwingUtilities.invokeLater(new Runnable()
{
+ @Override
public void run()
{
javax.swing.JOptionPane.showInternalMessageDialog(
*
* @see java.lang.Object#finalize()
*/
+ @Override
protected void finalize() throws Throwable
{
source = null;
}
/**
+ * not for general use, creates a fileParse object for an existing reader with
+ * configurable values for the origin and the type of the source
+ */
+ public FileParse(BufferedReader source, String originString,
+ String typeString)
+ {
+ type = typeString;
+ error = false;
+ inFile = null;
+ dataName = originString;
+ dataIn = source;
+ try
+ {
+ if (dataIn.markSupported())
+ {
+ dataIn.mark(READAHEAD_LIMIT);
+ }
+ } catch (IOException q)
+ {
+
+ }
+ }
+
+ /**
* Create a datasource for input to Jalview. See AppletFormatAdapter for the
* types of sources that are handled.
*
}
/**
- * rewinds the datasource the beginning.
+ * Rewinds the datasource to the marked point if possible
+ *
+ * @param bytesRead
*
*/
- public void reset() throws IOException
+ public void reset(int bytesRead) throws IOException
{
+ if (bytesRead >= READAHEAD_LIMIT)
+ {
+ System.err.println(String.format(
+ "File reset error: read %d bytes but reset limit is %d",
+ bytesRead, READAHEAD_LIMIT));
+ }
if (dataIn != null && !error)
{
dataIn.reset();
+++ /dev/null
-/*
- * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
- * Copyright (C) $$Year-Rel$$ The Jalview Authors
- *
- * This file is part of Jalview.
- *
- * Jalview is free software: you can redistribute it and/or
- * modify it under the terms of the GNU General Public License
- * as published by the Free Software Foundation, either version 3
- * of the License, or (at your option) any later version.
- *
- * Jalview is distributed in the hope that it will be useful, but
- * WITHOUT ANY WARRANTY; without even the implied warranty
- * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
- * PURPOSE. See the GNU General Public License for more details.
- *
- * You should have received a copy of the GNU General Public License
- * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
- * The Jalview Authors are detailed in the 'AUTHORS' file.
- */
-package jalview.io;
-
-import jalview.api.AlignViewportI;
-import jalview.datamodel.AlignedCodonFrame;
-import jalview.datamodel.Alignment;
-import jalview.datamodel.AlignmentI;
-import jalview.datamodel.SequenceI;
-
-import java.io.IOException;
-import java.util.List;
-
-/**
- * A GFF3 File parsing wrapper for the tangled mess that is FeaturesFile.
- *
- * This class implements the methods relied on by FileLoader/FormatAdapter in
- * order to allow them to load alignments directly from GFF2 and GFF3 files that
- * contain sequence data and alignment information.
- *
- * Major issues:
- *
- * 1. GFF3 files commonly include mappings between DNA, RNA and Protein - so
- * this class needs a dataset AlignmentI context to create alignment codon
- * mappings.
- *
- * 2. A single GFF3 file can generate many distinct alignments. Support will be
- * needed to allow several AlignmentI instances to be generated from a single
- * file.
- *
- *
- * @author jprocter
- *
- */
-public class Gff3File extends FeaturesFile
-{
-
- /**
- *
- */
- public Gff3File()
- {
- super();
- }
-
- /**
- * @param source
- * @throws IOException
- */
- public Gff3File(FileParse source) throws IOException
- {
- super(source);
- }
-
- /**
- * @param inFile
- * @param type
- * @throws IOException
- */
- public Gff3File(String inFile, String type) throws IOException
- {
- super(inFile, type);
- }
-
- /**
- * @param parseImmediately
- * @param source
- * @throws IOException
- */
- public Gff3File(boolean parseImmediately, FileParse source)
- throws IOException
- {
- super(parseImmediately, source);
- }
-
- /**
- * @param parseImmediately
- * @param inFile
- * @param type
- * @throws IOException
- */
- public Gff3File(boolean parseImmediately, String inFile, String type)
- throws IOException
- {
- super(parseImmediately, inFile, type);
- }
-
- /*
- * (non-Javadoc)
- *
- * @see jalview.io.FeaturesFile#print()
- */
- @Override
- public String print()
- {
- // TODO GFF3 writer with sensible defaults for writing alignment data
-
- // return super.printGFFFormat(seqs, visible);
- return ("Not yet implemented.");
- }
-
- AlignmentI dataset;
-
- List<AlignmentI> alignments;
-
- @Override
- public void parse()
- {
- AlignViewportI av = getViewport();
- if (av != null)
- {
- if (av.getAlignment() != null)
- {
- dataset = av.getAlignment().getDataset();
- }
- if (dataset == null)
- {
- // working in the applet context ?
- dataset = av.getAlignment();
- }
- }
- else
- {
- dataset = new Alignment(new SequenceI[] {});
- }
-
- boolean parseResult = parse(dataset, null, null, false, true);
- if (!parseResult)
- {
- // pass error up somehow
- }
- if (av != null)
- {
- // update viewport with the dataset data ?
- }
- else
- {
- setSeqs(dataset.getSequencesArray());
- }
-
- }
-
- @Override
- public void addProperties(AlignmentI al)
- {
- super.addProperties(al);
- if (dataset.getCodonFrames() != null)
- {
- AlignmentI ds = (al.getDataset() == null) ? al : al.getDataset();
- for (AlignedCodonFrame codons : dataset.getCodonFrames())
- {
- ds.addCodonFrame(codons);
- }
- }
- }
-}
*/
public class IdentifyFile
{
- public static final String GFF3File = "GFF v2 or v3";
+ public static final String FeaturesFile = "GFF or Jalview features";
/**
* Identify a datasource's file content.
* DOCUMENT ME!
* @return ID String
*/
- public String Identify(String file, String protocol)
+ public String identify(String file, String protocol)
{
String emessage = "UNIDENTIFIED FILE PARSING ERROR";
FileParse parser = null;
parser = new FileParse(file, protocol);
if (parser.isValid())
{
- return Identify(parser);
+ return identify(parser);
}
} catch (Exception e)
{
return emessage;
}
- public String Identify(FileParse source)
+ public String identify(FileParse source)
{
- return Identify(source, true); // preserves original behaviour prior to
+ return identify(source, true); // preserves original behaviour prior to
// version 2.3
}
* @param closeSource
* @return filetype string
*/
- public String Identify(FileParse source, boolean closeSource)
+ public String identify(FileParse source, boolean closeSource)
{
String reply = "PFAM";
String data;
- int length = 0;
+ int bytesRead = 0;
+ int trimmedLength = 0;
boolean lineswereskipped = false;
boolean isBinary = false; // true if length is non-zero and non-printable
// characters are encountered
}
while ((data = source.nextLine()) != null)
{
- length += data.trim().length();
+ bytesRead += data.length();
+ trimmedLength += data.trim().length();
if (!lineswereskipped)
{
for (int i = 0; !isBinary && i < data.length(); i++)
if (data.startsWith("##GFF-VERSION"))
{
- reply = GFF3File;
+ // GFF - possibly embedded in a Jalview features file!
+ reply = FeaturesFile;
+ break;
+ }
+ if (looksLikeFeatureData(data))
+ {
+ reply = FeaturesFile;
break;
}
if (data.indexOf("# STOCKHOLM") > -1)
if ((data.indexOf("<") > -1)) // possible Markup Language data i.e HTML,
// RNAML, XML
{
+ // FIXME this is nuts - it consumes the rest of the file if no match
boolean identified = false;
do
{
reply = PhylipFile.FILE_DESC;
break;
}
-
- /*
- * // TODO comment out SimpleBLAST identification for Jalview 2.4.1 else
- * if (!lineswereskipped && data.indexOf("BLAST")<4) { reply =
- * "SimpleBLAST"; break;
- *
- * } // end comments for Jalview 2.4.1
- */
- else if (!lineswereskipped && data.charAt(0) != '*'
- && data.charAt(0) != ' '
- && data.indexOf(":") < data.indexOf(",")) // &&
- // data.indexOf(",")<data.indexOf(",",
- // data.indexOf(",")))
+ else
{
- // file looks like a concise JNet file
- reply = "JnetFile";
- break;
+ if (!lineswereskipped && looksLikeJnetData(data))
+ {
+ reply = "JnetFile";
+ break;
+ }
}
lineswereskipped = true; // this means there was some junk before any
}
else
{
- source.reset(); // so the file can be parsed from the beginning again.
+ source.reset(bytesRead); // so the file can be parsed from the mark
}
} catch (Exception ex)
{
System.err.println("File Identification failed!\n" + ex);
return source.errormessage;
}
- if (length == 0)
+ if (trimmedLength == 0)
{
System.err
.println("File Identification failed! - Empty file was read.");
return reply;
}
+ /**
+ * Returns true if the data appears to be Jnet concise annotation format
+ *
+ * @param data
+ * @return
+ */
+ protected boolean looksLikeJnetData(String data)
+ {
+ char firstChar = data.charAt(0);
+ int colonPos = data.indexOf(":");
+ int commaPos = data.indexOf(",");
+ boolean isJnet = firstChar != '*' && firstChar != ' ' && colonPos > -1
+ && commaPos > -1 && colonPos < commaPos;
+ // && data.indexOf(",")<data.indexOf(",", data.indexOf(","))) / ??
+ return isJnet;
+ }
+
+ /**
+ * Returns true if the data has at least 6 tab-delimited fields _and_
+ * fields 4 and 5 are integer (start/end)
+ * @param data
+ * @return
+ */
+ protected boolean looksLikeFeatureData(String data)
+ {
+ if (data == null)
+ {
+ return false;
+ }
+ String[] columns = data.split("\t");
+ if (columns.length < 6) {
+ return false;
+ }
+ for (int col = 3; col < 5; col++)
+ {
+ try {
+ Integer.parseInt(columns[col]);
+ } catch (NumberFormatException e) {
+ return false;
+ }
+ }
+ return true;
+ }
+
public static void main(String[] args)
{
for (int i = 0; args != null && i < args.length; i++)
{
IdentifyFile ider = new IdentifyFile();
- String type = ider.Identify(args[i], AppletFormatAdapter.FILE);
+ String type = ider.identify(args[i], AppletFormatAdapter.FILE);
System.out.println("Type of " + args[i] + " is " + type);
}
if (args == null || args.length == 0)
import java.util.IdentityHashMap;
import java.util.Iterator;
import java.util.List;
-import java.util.Set;
import java.util.Vector;
import java.util.jar.JarInputStream;
import java.util.jar.JarOutputStream;
// to the align frames.
boolean gathered = false;
String newviewid = null;
- Set<AlignedCodonFrame> mappings = av.getAlignment()
+ List<AlignedCodonFrame> mappings = av.getAlignment()
.getCodonFrames();
for (int i = 0; i < views.length; i++)
{
}
// Store any sequence mappings.
- Set<AlignedCodonFrame> cframes = av.getAlignment().getCodonFrames();
+ List<AlignedCodonFrame> cframes = av.getAlignment().getCodonFrames();
if (cframes != null)
{
for (AlignedCodonFrame acf : cframes)
--- /dev/null
+package jalview.io.gff;
+
+import jalview.datamodel.AlignedCodonFrame;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.MappingType;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.util.MapList;
+
+import java.io.IOException;
+import java.util.List;
+import java.util.Map;
+
+/**
+ * A handler to parse GFF in the format generated by the exonerate tool
+ */
+public class ExonerateHelper extends Gff2Helper
+{
+ private static final String SIMILARITY = "similarity";
+
+ private static final String GENOME2GENOME = "genome2genome";
+
+ private static final String CDNA2GENOME = "cdna2genome";
+
+ private static final String CODING2GENOME = "coding2genome";
+
+ private static final String CODING2CODING = "coding2coding";
+
+ private static final String PROTEIN2GENOME = "protein2genome";
+
+ private static final String PROTEIN2DNA = "protein2dna";
+
+ private static final String ALIGN = "Align";
+
+ private static final String QUERY = "Query";
+
+ private static final String TARGET = "Target";
+
+ /**
+ * Process one GFF feature line (as modelled by SequenceFeature)
+ *
+ * @param seq
+ * the sequence with which this feature is associated
+ * @param gffColumns
+ * the sequence feature with ATTRIBUTES property containing any
+ * additional attributes
+ * @param align
+ * the alignment we are adding GFF to
+ * @param newseqs
+ * any new sequences referenced by the GFF
+ * @param relaxedIdMatching
+ * if true, match word tokens in sequence names
+ * @return true if the sequence feature should be added to the sequence, else
+ * false (i.e. it has been processed in another way e.g. to generate a
+ * mapping)
+ */
+ @Override
+ public SequenceFeature processGff(SequenceI seq, String[] gffColumns,
+ AlignmentI align, List<SequenceI> newseqs,
+ boolean relaxedIdMatching)
+ {
+ String attr = gffColumns[ATTRIBUTES_COL];
+ Map<String, List<String>> set = parseNameValuePairs(attr);
+
+ try
+ {
+ processGffSimilarity(set, seq, gffColumns,
+ align, newseqs, relaxedIdMatching);
+ } catch (IOException ivfe)
+ {
+ System.err.println(ivfe);
+ }
+
+ /*
+ * return null to indicate we don't want to add a sequence feature for
+ * similarity (only process it to create mappings)
+ */
+ return null;
+ }
+
+ /**
+ * Processes the 'Query' (or 'Target') and 'Align' properties associated with
+ * an exonerate GFF similarity feature; these properties define the mapping of
+ * the annotated range to a related sequence.
+ *
+ * @param set
+ * parsed GFF column 9 key/value(s)
+ * @param seq
+ * the sequence the GFF feature is on
+ * @param gff
+ * the GFF column data
+ * @param align
+ * the alignment the sequence belongs to, where any new mappings
+ * should be added
+ * @param newseqs
+ * a list of new 'virtual sequences' generated while parsing GFF
+ * @param relaxedIdMatching
+ * if true allow fuzzy search for a matching target sequence
+ * @throws IOException
+ */
+ protected void processGffSimilarity(
+ Map<String, List<String>> set,
+ SequenceI seq, String[] gff, AlignmentI align,
+ List<SequenceI> newseqs, boolean relaxedIdMatching)
+ throws IOException
+ {
+ /*
+ * exonerate may be run with
+ * --showquerygff - outputs 'features on the query' e.g. (protein2genome)
+ * Target <dnaseqid> ; Align proteinStartPos dnaStartPos proteinCount
+ * --showtargetgff - outputs 'features on the target' e.g. (protein2genome)
+ * Query <proteinseqid> ; Align dnaStartPos proteinStartPos nucleotideCount
+ * where the Align spec may repeat
+ */
+ // TODO handle coding2coding and similar as well
+ boolean featureIsOnTarget = true;
+ List<String> mapTo = set.get(QUERY);
+ if (mapTo == null)
+ {
+ mapTo = set.get(TARGET);
+ featureIsOnTarget = false;
+ }
+ MappingType type = getMappingType(gff[SOURCE_COL]);
+
+ if (type == null)
+ {
+ throw new IOException("Sorry, I don't handle " + gff[SOURCE_COL]);
+ }
+
+ if (mapTo == null || mapTo.size() != 1)
+ {
+ throw new IOException(
+ "Expecting exactly one sequence in Query or Target field (got "
+ + mapTo + ")");
+ }
+
+ /*
+ * locate the mapped sequence in the alignment or 'new' (GFF file) sequences;
+ */
+ SequenceI mappedSequence = findSequence(mapTo.get(0), align, newseqs,
+ relaxedIdMatching);
+
+ /*
+ * If mapping is from protein to dna, we store it as dna to protein instead
+ */
+ SequenceI mapFromSequence = seq;
+ SequenceI mapToSequence = mappedSequence;
+ if ((type == MappingType.NucleotideToPeptide && featureIsOnTarget)
+ || (type == MappingType.PeptideToNucleotide && !featureIsOnTarget))
+ {
+ mapFromSequence = mappedSequence;
+ mapToSequence = seq;
+ }
+
+ /*
+ * Process the Align maps and create mappings.
+ * These may be cdna-genome, cdna-protein, genome-protein.
+ * The mapped sequences may or may not be in the alignment
+ * (they may be included later in the GFF file).
+ */
+
+ /*
+ * get any existing mapping for these sequences (or start one),
+ * and add this mapped range
+ */
+ AlignedCodonFrame acf = getMapping(align, mapFromSequence,
+ mapToSequence);
+
+ /*
+ * exonerate GFF has the strand of the target in column 7
+ * (differs from GFF3 which has it in the Target descriptor)
+ */
+ String strand = gff[STRAND_COL];
+ boolean forwardStrand = true;
+ if ("-".equals(strand))
+ {
+ forwardStrand = false;
+ }
+ else if (!"+".equals(strand))
+ {
+ System.err.println("Strand must be specified for alignment");
+ return;
+ }
+
+ List<String> alignedRegions = set.get(ALIGN);
+ for (String region : alignedRegions)
+ {
+ MapList mapping = buildMapping(region, type, forwardStrand,
+ featureIsOnTarget, gff);
+
+ if (mapping == null)
+ {
+ continue;
+ }
+
+ acf.addMap(mapFromSequence, mapToSequence, mapping);
+ }
+ align.addCodonFrame(acf);
+ }
+
+ /**
+ * Construct the mapping
+ *
+ * @param region
+ * @param type
+ * @param forwardStrand
+ * @param featureIsOnTarget
+ * @param gff
+ * @return
+ */
+ protected MapList buildMapping(String region, MappingType type,
+ boolean forwardStrand, boolean featureIsOnTarget, String[] gff)
+ {
+ /*
+ * process one "fromStart toStart fromCount" descriptor
+ */
+ String[] tokens = region.split(" ");
+ if (tokens.length != 3)
+ {
+ System.err.println("Malformed Align descriptor: " + region);
+ return null;
+ }
+
+ /*
+ * get start/end of from/to mappings
+ * if feature is on the target sequence we have to invert the sense
+ */
+ int alignFromStart;
+ int alignToStart;
+ int alignCount;
+ try {
+ alignFromStart = Integer.parseInt(tokens[0]);
+ alignToStart = Integer.parseInt(tokens[1]);
+ alignCount = Integer.parseInt(tokens[2]);
+ } catch (NumberFormatException nfe) {
+ System.err.println(nfe.toString());
+ return null;
+ }
+
+ int fromStart;
+ int fromEnd;
+ int toStart;
+ int toEnd;
+
+ if (featureIsOnTarget)
+ {
+ fromStart = alignToStart;
+ toStart = alignFromStart;
+ toEnd = forwardStrand ? toStart + alignCount - 1 : toStart
+ - (alignCount - 1);
+ int toLength = Math.abs(toEnd - toStart) + 1;
+ int fromLength = toLength * type.getFromRatio() / type.getToRatio();
+ fromEnd = fromStart + fromLength - 1;
+ }
+ else
+ {
+ // we use the 'Align' values here not the feature start/end
+ // not clear why they may differ but it seems they can
+ fromStart = alignFromStart;
+ fromEnd = alignFromStart + alignCount - 1;
+ int fromLength = fromEnd - fromStart + 1;
+ int toLength = fromLength * type.getToRatio() / type.getFromRatio();
+ toStart = alignToStart;
+ if (forwardStrand)
+ {
+ toEnd = toStart + toLength - 1;
+ }
+ else
+ {
+ toEnd = toStart - (toLength - 1);
+ }
+ }
+
+ MapList codonmapping = constructMappingFromAlign(fromStart, fromEnd,
+ toStart, toEnd, type);
+ return codonmapping;
+ }
+
+ /**
+ * Returns a MappingType depending on the exonerate 'model' value.
+ *
+ * @param model
+ * @return
+ */
+ protected static MappingType getMappingType(String model)
+ {
+ MappingType result = null;
+
+ if (model.contains(PROTEIN2DNA) || model.contains(PROTEIN2GENOME))
+ {
+ result = MappingType.PeptideToNucleotide;
+ }
+ else if (model.contains(CODING2CODING)
+ || model.contains(CODING2GENOME)
+ || model.contains(CDNA2GENOME)
+ || model.contains(GENOME2GENOME))
+ {
+ result = MappingType.NucleotideToNucleotide;
+ }
+ return result;
+ }
+
+ /**
+ * Tests whether the GFF data looks like it was generated by exonerate, and is
+ * a format we are willing to handle
+ *
+ * @param columns
+ * @return
+ */
+ public static boolean recognises(String[] columns)
+ {
+ if (!SIMILARITY.equalsIgnoreCase(columns[TYPE_COL]))
+ {
+ return false;
+ }
+
+ /*
+ * inspect alignment model
+ */
+ String model = columns[SOURCE_COL];
+ // e.g. exonerate:protein2genome:local
+ if (model != null)
+ {
+ String mdl = model.toLowerCase();
+ if (mdl.contains(PROTEIN2DNA) || mdl.contains(PROTEIN2GENOME)
+ || mdl.contains(CODING2CODING)
+ || mdl.contains(CODING2GENOME)
+ || mdl.contains(CDNA2GENOME)
+ || mdl.contains(GENOME2GENOME))
+ {
+ return true;
+ }
+ }
+ System.err.println("Sorry, I don't handle exonerate model " + model);
+ return false;
+ }
+
+ @Override
+ protected SequenceFeature buildSequenceFeature(String[] gff,
+ Map<String, List<String>> set)
+ {
+ SequenceFeature sf = super.buildSequenceFeature(gff, set);
+ sf.setFeatureGroup("exonerate");
+
+ return sf;
+ }
+
+}
--- /dev/null
+package jalview.io.gff;
+
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+
+import java.io.IOException;
+import java.util.List;
+import java.util.Map;
+
+public class Gff2Helper extends GffHelperBase
+{
+ /**
+ * GFF2 uses space character to delimit name/value pairs on column 9
+ *
+ * @param text
+ * @return
+ */
+ public static Map<String, List<String>> parseNameValuePairs(String text)
+ {
+ // TODO: can a value include a comma? if so it will be broken by this
+ return parseNameValuePairs(text, ";", ' ', ",");
+ }
+
+ /**
+ * Return ' ' as the name-value separator used in column 9 attributes.
+ */
+ @Override
+ protected char getNameValueSeparator()
+ {
+ return ' ';
+ }
+
+ /**
+ * Default processing if not overridden is just to construct a sequence
+ * feature
+ */
+ @Override
+ public SequenceFeature processGff(SequenceI seq, String[] gff,
+ AlignmentI align, List<SequenceI> newseqs,
+ boolean relaxedIdMatching) throws IOException
+ {
+ Map<String, List<String>> attributes = null;
+ if (gff.length > ATTRIBUTES_COL)
+ {
+ attributes = parseNameValuePairs(gff[ATTRIBUTES_COL]);
+ }
+ return buildSequenceFeature(gff, attributes);
+ }
+
+}
--- /dev/null
+package jalview.io.gff;
+
+import jalview.datamodel.AlignedCodonFrame;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.MappingType;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.ext.ensembl.EnsemblSeqProxy;
+import jalview.util.MapList;
+import jalview.util.StringUtils;
+
+import java.io.IOException;
+import java.util.List;
+import java.util.Map;
+
+/**
+ * Base class with generic / common functionality for processing GFF3 data.
+ * Override this as required for any specialisations resulting from
+ * peculiarities of GFF3 generated by particular tools.
+ */
+public class Gff3Helper extends GffHelperBase
+{
+ protected static final String TARGET = "Target";
+
+ protected static final String ID = "ID";
+
+ private static final String NAME = "Name";
+
+ /**
+ * GFF3 uses '=' to delimit name/value pairs in column 9, and comma to
+ * separate multiple values for a name
+ *
+ * @param text
+ * @return
+ */
+ public static Map<String, List<String>> parseNameValuePairs(String text)
+ {
+ return parseNameValuePairs(text, ";", '=', ",");
+ }
+
+ /**
+ * Process one GFF feature line (as modelled by SequenceFeature)
+ *
+ * @param seq
+ * the sequence with which this feature is associated
+ * @param sf
+ * the sequence feature with ATTRIBUTES property containing any
+ * additional attributes
+ * @param align
+ * the alignment we are adding GFF to
+ * @param newseqs
+ * any new sequences referenced by the GFF
+ * @param relaxedIdMatching
+ * if true, match word tokens in sequence names
+ * @return true if the sequence feature should be added to the sequence, else
+ * false (i.e. it has been processed in another way e.g. to generate a
+ * mapping)
+ * @throws IOException
+ */
+ @Override
+ public SequenceFeature processGff(SequenceI seq, String[] gff,
+ AlignmentI align, List<SequenceI> newseqs,
+ boolean relaxedIdMatching) throws IOException
+ {
+ SequenceFeature sf = null;
+
+ if (gff.length == 9)
+ {
+ String soTerm = gff[TYPE_COL];
+ String atts = gff[ATTRIBUTES_COL];
+ Map<String, List<String>> attributes = parseNameValuePairs(atts);
+
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ if (so.isA(soTerm, SequenceOntologyI.PROTEIN_MATCH))
+ {
+ sf = processProteinMatch(attributes, seq, gff, align, newseqs,
+ relaxedIdMatching);
+ }
+ else if (so.isA(soTerm, SequenceOntologyI.NUCLEOTIDE_MATCH))
+ {
+ sf = processNucleotideMatch(attributes, seq, gff, align,
+ newseqs, relaxedIdMatching);
+ }
+ else
+ {
+ sf = buildSequenceFeature(gff, attributes);
+ }
+ }
+ else
+ {
+ /*
+ * fall back on generating a sequence feature with no special processing
+ */
+ sf = buildSequenceFeature(gff, null);
+ }
+
+ return sf;
+ }
+
+ /**
+ * Processes one GFF3 nucleotide (e.g. cDNA to genome) match.
+ *
+ * @param attributes
+ * parsed GFF column 9 key/value(s)
+ * @param seq
+ * the sequence the GFF feature is on
+ * @param gffColumns
+ * the GFF column data
+ * @param align
+ * the alignment the sequence belongs to, where any new mappings
+ * should be added
+ * @param newseqs
+ * a list of new 'virtual sequences' generated while parsing GFF
+ * @param relaxedIdMatching
+ * if true allow fuzzy search for a matching target sequence
+ * @return a sequence feature, if one should be added to the sequence, else
+ * null
+ * @throws IOException
+ */
+ protected SequenceFeature processNucleotideMatch(
+ Map<String, List<String>> attributes, SequenceI seq,
+ String[] gffColumns, AlignmentI align, List<SequenceI> newseqs,
+ boolean relaxedIdMatching)
+ throws IOException
+ {
+ String strand = gffColumns[STRAND_COL];
+
+ /*
+ * (For now) we don't process mappings from reverse complement ; to do
+ * this would require (a) creating a virtual sequence placeholder for
+ * the reverse complement (b) resolving the sequence by its id from some
+ * source (GFF ##FASTA or other) (c) creating the reverse complement
+ * sequence (d) updating the mapping to be to the reverse complement
+ */
+ if ("-".equals(strand))
+ {
+ System.err
+ .println("Skipping mapping from reverse complement as not yet supported");
+ return null;
+ }
+
+ List<String> targets = attributes.get(TARGET);
+ if (targets == null)
+ {
+ System.err.println("'Target' missing in GFF");
+ return null;
+ }
+
+ /*
+ * Typically we only expect one Target per GFF line, but this can handle
+ * multiple matches, to the same or different sequences (e.g. dna variants)
+ */
+ for (String target : targets)
+ {
+ /*
+ * Process "seqid start end [strand]"
+ */
+ String[] tokens = target.split(" ");
+ if (tokens.length < 3)
+ {
+ System.err.println("Incomplete Target: " + target);
+ continue;
+ }
+
+ /*
+ * Locate the mapped sequence in the alignment, or as a
+ * (new or existing) virtual sequence in the newseqs list
+ */
+ String targetId = findTargetId(tokens[0], attributes);
+ SequenceI mappedSequence1 = findSequence(targetId, align,
+ newseqs, relaxedIdMatching);
+ SequenceI mappedSequence = mappedSequence1;
+ if (mappedSequence == null)
+ {
+ continue;
+ }
+
+ /*
+ * get any existing mapping for these sequences (or start one),
+ * and add this mapped range
+ */
+ AlignedCodonFrame acf = getMapping(align, seq, mappedSequence);
+
+ try
+ {
+ int toStart = Integer.parseInt(tokens[1]);
+ int toEnd = Integer.parseInt(tokens[2]);
+ if (tokens.length > 3 && "-".equals(tokens[3]))
+ {
+ // mapping to reverse strand - swap start/end
+ int temp = toStart;
+ toStart = toEnd;
+ toEnd = temp;
+ }
+
+ int fromStart = Integer.parseInt(gffColumns[START_COL]);
+ int fromEnd = Integer.parseInt(gffColumns[END_COL]);
+ MapList mapping = constructMappingFromAlign(fromStart, fromEnd,
+ toStart, toEnd,
+ MappingType.NucleotideToNucleotide);
+
+ if (mapping != null)
+ {
+ acf.addMap(seq, mappedSequence, mapping);
+ align.addCodonFrame(acf);
+ }
+ } catch (NumberFormatException nfe)
+ {
+ System.err.println("Invalid start or end in Target " + target);
+ }
+ }
+
+ SequenceFeature sf = buildSequenceFeature(gffColumns, attributes);
+ return sf;
+ }
+
+ /**
+ * Returns the target sequence id extracted from the GFF name/value pairs.
+ * Default (standard behaviour) is the first token for "Target". This may be
+ * overridden where tools report this in a non-standard way.
+ *
+ * @param target
+ * first token of a "Target" value from GFF column 9, typically
+ * "seqid start end"
+ * @param set
+ * a map with all parsed column 9 attributes
+ * @return
+ */
+ @SuppressWarnings("unused")
+ protected String findTargetId(String target, Map<String, List<String>> set)
+ {
+ return target;
+ }
+
+ /**
+ * Processes one GFF 'protein_match'; fields of interest are
+ * <ul>
+ * <li>feature group - the database reporting a match e.g. Pfam</li>
+ * <li>Name - the matched entry's accession id in the database</li>
+ * <li>ID - a sequence identifier for the matched region (which may be
+ * appended as FASTA in the GFF file)</li>
+ * </ul>
+ *
+ * @param set
+ * parsed GFF column 9 key/value(s)
+ * @param seq
+ * the sequence the GFF feature is on
+ * @param gffColumns
+ * the sequence feature holding GFF data
+ * @param align
+ * the alignment the sequence belongs to, where any new mappings
+ * should be added
+ * @param newseqs
+ * a list of new 'virtual sequences' generated while parsing GFF
+ * @param relaxedIdMatching
+ * if true allow fuzzy search for a matching target sequence
+ * @return the (real or virtual) sequence(s) mapped to by this match
+ * @throws IOException
+ */
+ protected SequenceFeature processProteinMatch(
+ Map<String, List<String>> set, SequenceI seq,
+ String[] gffColumns, AlignmentI align, List<SequenceI> newseqs,
+ boolean relaxedIdMatching)
+ {
+ // This is currently tailored to InterProScan GFF output:
+ // ID holds the ID of the matched sequence, Target references the
+ // query sequence; this looks wrong, as ID should just be the GFF internal
+ // ID of the GFF feature, while Target would normally reference the matched
+ // sequence.
+ // TODO refactor as needed if other protein-protein GFF varies
+
+ SequenceFeature sf = buildSequenceFeature(gffColumns, set);
+
+ /*
+ * locate the mapped sequence in the alignment, or as a
+ * (new or existing) virtual sequence in the newseqs list
+ */
+ List<String> targets = set.get(TARGET);
+ if (targets != null)
+ {
+ for (String target : targets)
+ {
+
+ SequenceI mappedSequence1 = findSequence(findTargetId(target, set), align,
+ newseqs, relaxedIdMatching);
+ SequenceI mappedSequence = mappedSequence1;
+ if (mappedSequence == null)
+ {
+ continue;
+ }
+
+ /*
+ * give the mapped sequence a copy of the sequence feature, with
+ * start/end range adjusted
+ */
+ SequenceFeature sf2 = new SequenceFeature(sf);
+ sf2.setBegin(1);
+ int sequenceFeatureLength = 1 + sf.getEnd() - sf.getBegin();
+ sf2.setEnd(sequenceFeatureLength);
+ mappedSequence.addSequenceFeature(sf2);
+
+ /*
+ * add a property to the mapped sequence so that it can eventually be
+ * renamed with its qualified accession id; renaming has to wait until
+ * all sequence reference resolution is complete
+ */
+ String accessionId = StringUtils.listToDelimitedString(
+ set.get(NAME), ",");
+ if (accessionId.length() > 0)
+ {
+ String database = sf.getType(); // TODO InterProScan only??
+ String qualifiedAccId = database + "|" + accessionId;
+ sf2.setValue(RENAME_TOKEN, qualifiedAccId);
+ }
+
+ /*
+ * get any existing mapping for these sequences (or start one),
+ * and add this mapped range
+ */
+ AlignedCodonFrame alco = getMapping(align, seq, mappedSequence);
+ int[] from = new int[] { sf.getBegin(), sf.getEnd() };
+ int[] to = new int[] { 1, sequenceFeatureLength };
+ MapList mapping = new MapList(from, to, 1, 1);
+
+ alco.addMap(seq, mappedSequence, mapping);
+ align.addCodonFrame(alco);
+ }
+ }
+
+ return sf;
+ }
+
+ /**
+ * Return '=' as the name-value separator used in column 9 attributes.
+ */
+ @Override
+ protected char getNameValueSeparator()
+ {
+ return '=';
+ }
+
+ /**
+ * Modifies the default SequenceFeature in order to set the Target sequence id
+ * as the description
+ */
+ @Override
+ protected SequenceFeature buildSequenceFeature(String[] gff,
+ Map<String, List<String>> attributes)
+ {
+ SequenceFeature sf = super.buildSequenceFeature(gff, attributes);
+ String desc = getDescription(sf, attributes);
+ if (desc != null)
+ {
+ sf.setDescription(desc);
+ }
+ return sf;
+ }
+
+ /**
+ * Apply heuristic rules to try to get the most useful feature description
+ *
+ * @param sf
+ * @param attributes
+ * @return
+ */
+ protected String getDescription(SequenceFeature sf,
+ Map<String, List<String>> attributes)
+ {
+ String desc = null;
+ String target = (String) sf.getValue(TARGET);
+ if (target != null)
+ {
+ desc = target.split(" ")[0];
+ }
+
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ String type = sf.getType();
+ if (so.isA(type, SequenceOntologyI.SEQUENCE_VARIANT))
+ {
+ /*
+ * Ensembl returns dna variants as 'alleles'
+ */
+ desc = StringUtils.listToDelimitedString(
+ attributes.get("alleles"), ",");
+ }
+
+ /*
+ * extract 'Name' for a transcript (to show gene name)
+ * or an exon (so 'colour by label' shows exon boundaries)
+ */
+ if (EnsemblSeqProxy.isTranscript(type)
+ || so.isA(type, SequenceOntology.EXON))
+ {
+ desc = StringUtils.listToDelimitedString(attributes.get("Name"), ",");
+ }
+
+ /*
+ * if the above fails, try ID
+ */
+ if (desc == null)
+ {
+ desc = (String) sf.getValue(ID);
+ }
+
+ return desc;
+ }
+}
--- /dev/null
+package jalview.io.gff;
+
+import jalview.analysis.SequenceIdMatcher;
+import jalview.datamodel.AlignedCodonFrame;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.MappingType;
+import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.util.MapList;
+import jalview.util.StringUtils;
+
+import java.util.ArrayList;
+import java.util.Arrays;
+import java.util.HashMap;
+import java.util.List;
+import java.util.Map;
+import java.util.Map.Entry;
+
+/**
+ * Base class with common functionality for flavours of GFF handler (GFF2 or
+ * GFF3)
+ */
+public abstract class GffHelperBase implements GffHelperI
+{
+ private static final String NOTE = "Note";
+
+ /*
+ * GFF columns 1-9 (zero-indexed):
+ */
+ protected static final int SEQID_COL = 0;
+
+ protected static final int SOURCE_COL = 1;
+
+ protected static final int TYPE_COL = 2;
+
+ protected static final int START_COL = 3;
+
+ protected static final int END_COL = 4;
+
+ protected static final int SCORE_COL = 5;
+
+ protected static final int STRAND_COL = 6;
+
+ protected static final int PHASE_COL = 7;
+
+ protected static final int ATTRIBUTES_COL = 8;
+
+ private AlignmentI lastmatchedAl = null;
+
+ private SequenceIdMatcher matcher = null;
+
+ /**
+ * Constructs and returns a mapping, or null if data appear invalid
+ *
+ * @param fromStart
+ * @param fromEnd
+ * @param toStart
+ * @param toEnd
+ * @param mappingType
+ * type of mapping (e.g. protein to nucleotide)
+ * @return
+ */
+ protected MapList constructMappingFromAlign(int fromStart, int fromEnd,
+ int toStart, int toEnd, MappingType mappingType)
+ {
+ int[] from = new int[] { fromStart, fromEnd };
+ int[] to = new int[] { toStart, toEnd };
+
+ /*
+ * Jalview always models from dna to protein, so switch values if the
+ * GFF mapping is from protein to dna
+ */
+ if (mappingType == MappingType.PeptideToNucleotide)
+ {
+ int[] temp = from;
+ from = to;
+ to = temp;
+ mappingType = mappingType.getInverse();
+ }
+
+ int fromRatio = mappingType.getFromRatio();
+ int toRatio = mappingType.getToRatio();
+
+ /*
+ * sanity check that mapped residue counts match
+ * TODO understand why PASA generates such cases...
+ */
+ if (!trimMapping(from, to, fromRatio, toRatio))
+ {
+ System.err.println("Ignoring mapping from " + Arrays.toString(from)
+ + " to " + Arrays.toString(to) + " as counts don't match!");
+ return null;
+ }
+
+ /*
+ * If a codon has an intron gap, there will be contiguous 'toRanges';
+ * this is handled for us by the MapList constructor.
+ * (It is not clear that exonerate ever generates this case)
+ */
+
+ return new MapList(from, to, fromRatio, toRatio);
+ }
+
+ /**
+ * Checks that the 'from' and 'to' ranges have equivalent lengths. If not,
+ * tries to trim the end of the longer so they do. Returns true if the
+ * mappings could be made equivalent, else false. Note the range array values
+ * may be modified by this method.
+ *
+ * @param from
+ * @param to
+ * @param fromRatio
+ * @param toRatio
+ * @return
+ */
+ protected static boolean trimMapping(int[] from, int[] to, int fromRatio,
+ int toRatio)
+ {
+ int fromLength = Math.abs(from[1] - from[0]) + 1;
+ int toLength = Math.abs(to[1] - to[0]) + 1;
+ int fromOverlap = fromLength * toRatio - toLength * fromRatio;
+ if (fromOverlap == 0)
+ {
+ return true;
+ }
+ if (fromOverlap > 0 && fromOverlap % toRatio == 0)
+ {
+ /*
+ * restrict from range to make them match up
+ * it's kind of arbitrary which end we truncate - here it is the end
+ */
+ System.err.print("Truncating mapping from " + Arrays.toString(from)
+ + " to ");
+ if (from[1] > from[0])
+ {
+ from[1] -= fromOverlap / toRatio;
+ }
+ else
+ {
+ from[1] += fromOverlap / toRatio;
+ }
+ System.err.println(Arrays.toString(from));
+ return true;
+ }
+ else if (fromOverlap < 0 && fromOverlap % fromRatio == 0)
+ {
+ fromOverlap = -fromOverlap; // > 0
+ /*
+ * restrict to range to make them match up
+ */
+ System.err.print("Truncating mapping to " + Arrays.toString(to)
+ + " to ");
+ if (to[1] > to[0])
+ {
+ to[1] -= fromOverlap / fromRatio;
+ }
+ else
+ {
+ to[1] += fromOverlap / fromRatio;
+ }
+ System.err.println(Arrays.toString(to));
+ return true;
+ }
+
+ /*
+ * Couldn't truncate to an exact match..
+ */
+ return false;
+ }
+
+ /**
+ * Returns a sequence matching the given id, as follows
+ * <ul>
+ * <li>strict matching is on exact sequence name</li>
+ * <li>relaxed matching allows matching on a token within the sequence name,
+ * or a dbxref</li>
+ * <li>first tries to find a match in the alignment sequences</li>
+ * <li>else tries to find a match in the new sequences already generated while
+ * parsing the features file</li>
+ * <li>else creates a new placeholder sequence, adds it to the new sequences
+ * list, and returns it</li>
+ * </ul>
+ *
+ * @param seqId
+ * @param align
+ * @param newseqs
+ * @param relaxedIdMatching
+ *
+ * @return
+ */
+ protected SequenceI findSequence(String seqId, AlignmentI align,
+ List<SequenceI> newseqs, boolean relaxedIdMatching)
+ {
+ if (seqId == null)
+ {
+ return null;
+ }
+ SequenceI match = null;
+ if (relaxedIdMatching)
+ {
+ if (lastmatchedAl != align)
+ {
+ lastmatchedAl = align;
+ matcher = new SequenceIdMatcher(align.getSequencesArray());
+ if (newseqs != null)
+ {
+ matcher.addAll(newseqs);
+ }
+ }
+ match = matcher.findIdMatch(seqId);
+ }
+ else
+ {
+ match = align.findName(seqId, true);
+ if (match == null && newseqs != null)
+ {
+ for (SequenceI m : newseqs)
+ {
+ if (seqId.equals(m.getName()))
+ {
+ return m;
+ }
+ }
+ }
+
+ }
+ if (match == null && newseqs != null)
+ {
+ match = new SequenceDummy(seqId);
+ if (relaxedIdMatching)
+ {
+ matcher.addAll(Arrays.asList(new SequenceI[] { match }));
+ }
+ // add dummy sequence to the newseqs list
+ newseqs.add(match);
+ }
+ return match;
+ }
+
+ /**
+ * Parses the input line to a map of name / value(s) pairs. For example the
+ * line <br>
+ * Notes=Fe-S;Method=manual curation, prediction; source = Pfam; Notes = Metal <br>
+ * if parsed with delimiter=";" and separators {' ', '='} <br>
+ * would return a map with { Notes={Fe=S, Metal}, Method={manual curation,
+ * prediction}, source={Pfam}} <br>
+ *
+ * This method supports parsing of either GFF2 format (which uses space ' ' as
+ * the name/value delimiter, and allows multiple occurrences of the same
+ * name), or GFF3 format (which uses '=' as the name/value delimiter, and
+ * strictly does not allow repeat occurrences of the same name - but does
+ * allow a comma-separated list of values).
+ *
+ * @param text
+ * @param namesDelimiter
+ * the major delimiter between name-value pairs
+ * @param nameValueSeparator
+ * one or more separators used between name and value
+ * @param valuesDelimiter
+ * delimits a list of more than one value
+ * @return the name-values map (which may be empty but never null)
+ */
+ public static Map<String, List<String>> parseNameValuePairs(String text,
+ String namesDelimiter, char nameValueSeparator,
+ String valuesDelimiter)
+ {
+ Map<String, List<String>> map = new HashMap<String, List<String>>();
+ if (text == null || text.trim().length() == 0)
+ {
+ return map;
+ }
+
+ for (String pair : text.trim().split(namesDelimiter))
+ {
+ pair = pair.trim();
+ if (pair.length() == 0)
+ {
+ continue;
+ }
+
+ int sepPos = pair.indexOf(nameValueSeparator);
+ if (sepPos == -1)
+ {
+ // no name=value present
+ continue;
+ }
+
+ String key = pair.substring(0, sepPos).trim();
+ String values = pair.substring(sepPos + 1).trim();
+ if (values.length() > 0)
+ {
+ List<String> vals = map.get(key);
+ if (vals == null)
+ {
+ vals = new ArrayList<String>();
+ map.put(key, vals);
+ }
+ for (String val : values.split(valuesDelimiter))
+ {
+ vals.add(val);
+ }
+ }
+ }
+ return map;
+ }
+
+ /**
+ * Constructs a SequenceFeature from the GFF column data. Subclasses may wish
+ * to call this method then adjust the SequenceFeature depending on the
+ * particular usage of different tools that generate GFF.
+ *
+ * @param gff
+ * @param attributes
+ * @return
+ */
+ protected SequenceFeature buildSequenceFeature(String[] gff,
+ Map<String, List<String>> attributes)
+ {
+ try
+ {
+ int start = Integer.parseInt(gff[START_COL]);
+ int end = Integer.parseInt(gff[END_COL]);
+
+ /*
+ * default 'score' is 0 rather than Float.NaN as the latter currently
+ * disables the 'graduated colour => colour by label' option
+ */
+ float score = 0f;
+ try
+ {
+ score = Float.parseFloat(gff[SCORE_COL]);
+ } catch (NumberFormatException nfe)
+ {
+ // e.g. '.' - leave as zero
+ }
+
+ SequenceFeature sf = new SequenceFeature(gff[TYPE_COL],
+ gff[SOURCE_COL], start, end, score, gff[SOURCE_COL]);
+
+ sf.setStrand(gff[STRAND_COL]);
+
+ sf.setPhase(gff[PHASE_COL]);
+
+ if (attributes != null)
+ {
+ /*
+ * save 'raw' column 9 to allow roundtrip output as input
+ */
+ sf.setAttributes(gff[ATTRIBUTES_COL]);
+
+ /*
+ * Add attributes in column 9 to the sequence feature's
+ * 'otherData' table; use Note as a best proxy for description
+ */
+ for (Entry<String, List<String>> attr : attributes.entrySet())
+ {
+ String values = StringUtils.listToDelimitedString(
+ attr.getValue(), ",");
+ sf.setValue(attr.getKey(), values);
+ if (NOTE.equals(attr.getKey()))
+ {
+ sf.setDescription(values);
+ }
+ }
+ }
+
+ return sf;
+ } catch (NumberFormatException nfe)
+ {
+ System.err.println("Invalid number in gff: " + nfe.getMessage());
+ return null;
+ }
+ }
+
+ /**
+ * Returns the character used to separate attributes names from values in GFF
+ * column 9. This is space for GFF2, '=' for GFF3.
+ *
+ * @return
+ */
+ protected abstract char getNameValueSeparator();
+
+ /**
+ * Returns any existing mapping held on the alignment between the given
+ * dataset sequences, or a new one if none found. This is a convenience method
+ * to facilitate processing multiple GFF lines that make up a single 'spliced'
+ * mapping, by extending the first mapping as the others are read.
+ *
+ * @param align
+ * @param fromSeq
+ * @param toSeq
+ * @return
+ */
+ protected AlignedCodonFrame getMapping(AlignmentI align, SequenceI fromSeq, SequenceI toSeq)
+ {
+ AlignedCodonFrame acf = align.getMapping(fromSeq, toSeq);
+ if (acf == null)
+ {
+ acf = new AlignedCodonFrame();
+ }
+ return acf;
+ }
+
+}
--- /dev/null
+package jalview.io.gff;
+
+
+/**
+ * A factory to serve instances of GFF helper classes
+ */
+public class GffHelperFactory
+{
+
+ /**
+ * Returns a class to process the GFF line based on inspecting its column
+ * data. This may return a general-purpose GFF2 or GFF3 helper, or a
+ * specialisation for a flavour of GFF generated by a particular tool.
+ *
+ * @param gff
+ * @return
+ */
+ public static GffHelperI getHelper(String[] gff)
+ {
+ if (gff == null || gff.length < 6)
+ {
+ return null;
+ }
+
+ GffHelperI result = null;
+ if (ExonerateHelper.recognises(gff))
+ {
+ result = new ExonerateHelper();
+ }
+ else if (InterProScanHelper.recognises(gff))
+ {
+ result = new InterProScanHelper();
+ }
+ else if (looksLikeGff3(gff))
+ {
+ result = new Gff3Helper();
+ }
+ else
+ {
+ result = new Gff2Helper();
+ }
+
+ return result;
+ }
+
+ /**
+ * Heuristic rule: if column 9 seems to have Name=Value entries, assume this
+ * is GFF3. GFF3 uses '=' as name-value separator, GFF2 uses space ' '.
+ *
+ * @param gff
+ * @return
+ */
+ protected static boolean looksLikeGff3(String[] gff)
+ {
+ if (gff.length >= 9)
+ {
+ String attributes = gff[8].trim();
+ int pos1 = attributes.indexOf(';');
+ int pos2 = attributes.indexOf('=');
+ if (pos2 != -1 && (pos1 == -1 || pos2 < pos1))
+ {
+ // there is an '=' before the first ';' (if any)
+ // not foolproof as theoretically GFF2 could be like "Name Value=123;"
+ return true;
+ }
+ }
+ return false;
+ }
+
+}
--- /dev/null
+package jalview.io.gff;
+
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+
+import java.io.IOException;
+import java.util.List;
+
+/**
+ * An interface to described common functionality of different flavours of GFF
+ *
+ * @author gmcarstairs
+ *
+ */
+public interface GffHelperI
+{
+
+ final String RENAME_TOKEN = "$RENAME_TO$";
+
+ /**
+ * Process one GFF feature line
+ *
+ * @param seq
+ * the sequence with which this feature is associated
+ * @param gffColumns
+ * the GFF column data
+ * @param align
+ * the alignment we are adding GFF to
+ * @param newseqs
+ * any new sequences referenced by the GFF
+ * @param relaxedIdMatching
+ * if true, match word tokens in sequence names
+ * @return a SequenceFeature if one should be created, else null
+ * @throws IOException
+ */
+ SequenceFeature processGff(SequenceI seq, String[] gffColumns,
+ AlignmentI align,
+ List<SequenceI> newseqs, boolean relaxedIdMatching)
+ throws IOException;
+
+ // java 8 will allow static methods in interfaces:
+ // static boolean recognises(String [] columns);
+}
--- /dev/null
+package jalview.io.gff;
+
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.util.StringUtils;
+
+import java.io.IOException;
+import java.util.List;
+import java.util.Map;
+
+/**
+ * A handler to parse GFF in the format generated by InterProScan
+ */
+public class InterProScanHelper extends Gff3Helper
+{
+ private static final String INTER_PRO_SCAN = "InterProScan";
+
+ private static final String SIGNATURE_DESC = "signature_desc";
+
+ /**
+ * Process one GFF feature line (as modelled by SequenceFeature)
+ *
+ * @param seq
+ * the sequence with which this feature is associated
+ * @param gff
+ * the gff column data
+ * @param align
+ * the alignment we are adding GFF to
+ * @param newseqs
+ * any new sequences referenced by the GFF
+ * @param relaxedIdMatching
+ * if true, match word tokens in sequence names
+ * @return a sequence feature if one should be added to the sequence, else
+ * null (i.e. it has been processed in another way e.g. to generate a
+ * mapping)
+ * @throws IOException
+ */
+ @Override
+ public SequenceFeature processGff(SequenceI seq, String[] gff,
+ AlignmentI align, List<SequenceI> newseqs,
+ boolean relaxedIdMatching) throws IOException
+ {
+ /*
+ * ignore the 'polypeptide' match of the whole sequence
+ */
+ if (".".equals(gff[SOURCE_COL]))
+ {
+ return null;
+ }
+
+ return super.processGff(seq, gff, align, newseqs, relaxedIdMatching);
+ }
+
+ /**
+ *
+ */
+ @Override
+ protected SequenceFeature buildSequenceFeature(String[] gff,
+ Map<String, List<String>> attributes)
+ {
+ SequenceFeature sf = super.buildSequenceFeature(gff, attributes);
+
+ /*
+ * signature_desc is a more informative source of description
+ */
+ List<String> desc = attributes.get(SIGNATURE_DESC);
+ String description = StringUtils.listToDelimitedString(desc, ", ");
+ if (description.length() > 0)
+ {
+ sf.setDescription(description);
+ }
+
+ /*
+ * Set sequence feature group as 'InterProScan', and type as the source
+ * database for this match (e.g. 'Pfam')
+ */
+ sf.setType(gff[SOURCE_COL]);
+ sf.setFeatureGroup(INTER_PRO_SCAN);
+
+ return sf;
+ }
+
+ /**
+ * Tests whether the GFF data looks like it was generated by InterProScan
+ *
+ * @param columns
+ * @return
+ */
+ public static boolean recognises(String[] columns)
+ {
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ String type = columns[TYPE_COL];
+ if (so.isA(type, SequenceOntologyI.PROTEIN_MATCH)
+ || (".".equals(columns[SOURCE_COL]) && so.isA(type,
+ SequenceOntologyI.POLYPEPTIDE)))
+ {
+ return true;
+ }
+ return false;
+ }
+
+ /**
+ * Overriden method, because InterProScan GFF has the target sequence id in
+ * GFF field 'ID' rather than the usual 'Target' :-O
+ */
+ @Override
+ protected String findTargetId(String target, Map<String, List<String>> set)
+ {
+ List<String> ids = set.get(ID);
+ if (ids == null || ids.size() != 1)
+ {
+ return null;
+ }
+ return ids.get(0);
+ }
+
+}
--- /dev/null
+package jalview.io.gff;
+
+import java.io.BufferedInputStream;
+import java.io.BufferedReader;
+import java.io.IOException;
+import java.io.InputStream;
+import java.io.InputStreamReader;
+import java.text.ParseException;
+import java.util.ArrayList;
+import java.util.Collections;
+import java.util.HashMap;
+import java.util.List;
+import java.util.Map;
+import java.util.NoSuchElementException;
+import java.util.zip.ZipEntry;
+import java.util.zip.ZipInputStream;
+
+import org.biojava.nbio.ontology.Ontology;
+import org.biojava.nbio.ontology.Term;
+import org.biojava.nbio.ontology.Term.Impl;
+import org.biojava.nbio.ontology.Triple;
+import org.biojava.nbio.ontology.io.OboParser;
+import org.biojava.nbio.ontology.utils.Annotation;
+
+/**
+ * A wrapper class that parses the Sequence Ontology and exposes useful access
+ * methods. This version uses the BioJava parser.
+ */
+class SequenceOntology implements SequenceOntologyI
+{
+ /*
+ * the parsed Ontology data as modelled by BioJava
+ */
+ private Ontology ontology;
+
+ /*
+ * the ontology term for the isA relationship
+ */
+ private Term isA;
+
+ /*
+ * lookup of terms by user readable name (NB not guaranteed unique)
+ */
+ private Map<String, Term> termsByDescription;
+
+ /*
+ * Map where key is a Term and value is a (possibly empty) list of
+ * all Terms to which the key has an 'isA' relationship, either
+ * directly or indirectly (A isA B isA C)
+ */
+ private Map<Term, List<Term>> termIsA;
+
+ private List<String> termsFound;
+
+ private List<String> termsNotFound;
+
+ /**
+ * Package private constructor to enforce use of singleton. Parses and caches
+ * the SO OBO data file.
+ */
+ SequenceOntology()
+ {
+ termsFound = new ArrayList<String>();
+ termsNotFound = new ArrayList<String>();
+ termsByDescription = new HashMap<String, Term>();
+ termIsA = new HashMap<Term, List<Term>>();
+
+ loadOntologyZipFile("so-xp-simple.obo");
+ }
+
+ /**
+ * Loads the given ontology file from a zip file with ".zip" appended
+ *
+ * @param ontologyFile
+ */
+ protected void loadOntologyZipFile(String ontologyFile)
+ {
+ ZipInputStream zipStream = null;
+ try
+ {
+ String zipFile = ontologyFile + ".zip";
+ System.out.println("Loading Sequence Ontology from " + zipFile);
+ InputStream inStream = this.getClass().getResourceAsStream(
+ "/" + zipFile);
+ zipStream = new ZipInputStream(new BufferedInputStream(inStream));
+ ZipEntry entry;
+ while ((entry = zipStream.getNextEntry()) != null)
+ {
+ if (entry.getName().equals(ontologyFile))
+ {
+ loadOboFile(zipStream);
+ }
+ }
+ } catch (Exception e)
+ {
+ e.printStackTrace();
+ } finally
+ {
+ closeStream(zipStream);
+ }
+ }
+
+ /**
+ * Closes the input stream, swallowing all exceptions
+ *
+ * @param is
+ */
+ protected void closeStream(InputStream is)
+ {
+ if (is != null)
+ {
+ try
+ {
+ is.close();
+ } catch (IOException e)
+ {
+ // ignore
+ }
+ }
+ }
+
+ /**
+ * Reads, parses and stores the OBO file data
+ *
+ * @param is
+ * @throws ParseException
+ * @throws IOException
+ */
+ protected void loadOboFile(InputStream is) throws ParseException,
+ IOException
+ {
+ BufferedReader oboFile = new BufferedReader(new InputStreamReader(is));
+ OboParser parser = new OboParser();
+ ontology = parser.parseOBO(oboFile, "SO", "the SO ontology");
+ isA = ontology.getTerm("is_a");
+ storeTermNames();
+ }
+
+ /**
+ * Stores a lookup table of terms by description. Note that description is not
+ * guaranteed unique. Where duplicate descriptions are found, try to discard
+ * the term that is flagged as obsolete. However we do store obsolete terms
+ * where there is no duplication of description.
+ */
+ protected void storeTermNames()
+ {
+ for (Term term : ontology.getTerms())
+ {
+ if (term instanceof Impl)
+ {
+ String description = term.getDescription();
+ if (description != null)
+ {
+ Term replaced = termsByDescription.get(description);
+ if (replaced != null)
+ {
+ boolean newTermIsObsolete = isObsolete(term);
+ boolean oldTermIsObsolete = isObsolete(replaced);
+ if (newTermIsObsolete && !oldTermIsObsolete)
+ {
+ System.err.println("Ignoring " + term.getName()
+ + " as obsolete and duplicated by "
+ + replaced.getName());
+ term = replaced;
+ }
+ else if (!newTermIsObsolete && oldTermIsObsolete)
+ {
+ System.err.println("Ignoring " + replaced.getName()
+ + " as obsolete and duplicated by " + term.getName());
+ }
+ else
+ {
+ System.err.println("Warning: " + term.getName()
+ + " has replaced " + replaced.getName()
+ + " for lookup of '" + description + "'");
+ }
+ }
+ termsByDescription.put(description, term);
+ }
+ }
+ }
+ }
+
+ /**
+ * Answers true if the term has property "is_obsolete" with value true, else
+ * false
+ *
+ * @param term
+ * @return
+ */
+ public static boolean isObsolete(Term term)
+ {
+ Annotation ann = term.getAnnotation();
+ if (ann != null)
+ {
+ try
+ {
+ if (Boolean.TRUE.equals(ann.getProperty("is_obsolete")))
+ {
+ return true;
+ }
+ } catch (NoSuchElementException e)
+ {
+ // fall through to false
+ }
+ }
+ return false;
+ }
+
+ /**
+ * Test whether the given Sequence Ontology term is nucleotide_match (either
+ * directly or via is_a relationship)
+ *
+ * @param soTerm
+ * SO name or description
+ * @return
+ */
+ public boolean isNucleotideMatch(String soTerm)
+ {
+ return isA(soTerm, NUCLEOTIDE_MATCH);
+ }
+
+ /**
+ * Test whether the given Sequence Ontology term is protein_match (either
+ * directly or via is_a relationship)
+ *
+ * @param soTerm
+ * SO name or description
+ * @return
+ */
+ public boolean isProteinMatch(String soTerm)
+ {
+ return isA(soTerm, PROTEIN_MATCH);
+ }
+
+ /**
+ * Test whether the given Sequence Ontology term is polypeptide (either
+ * directly or via is_a relationship)
+ *
+ * @param soTerm
+ * SO name or description
+ * @return
+ */
+ public boolean isPolypeptide(String soTerm)
+ {
+ return isA(soTerm, POLYPEPTIDE);
+ }
+
+ /**
+ * Returns true if the given term has a (direct or indirect) 'isA'
+ * relationship with the parent
+ *
+ * @param child
+ * @param parent
+ * @return
+ */
+ @Override
+ public boolean isA(String child, String parent)
+ {
+ if (child == null || parent == null)
+ {
+ return false;
+ }
+ /*
+ * optimise trivial checks like isA("CDS", "CDS")
+ */
+ if (child.equals(parent))
+ {
+ termFound(child);
+ return true;
+ }
+
+ Term childTerm = getTerm(child);
+ if (childTerm != null)
+ {
+ termFound(child);
+ }
+ else
+ {
+ termNotFound(child);
+ }
+ Term parentTerm = getTerm(parent);
+
+ return termIsA(childTerm, parentTerm);
+ }
+
+ /**
+ * Records a valid term queried for, for reporting purposes
+ *
+ * @param term
+ */
+ private void termFound(String term)
+ {
+ synchronized (termsFound)
+ {
+ if (!termsFound.contains(term))
+ {
+ termsFound.add(term);
+ }
+ }
+ }
+
+ /**
+ * Records an invalid term queried for, for reporting purposes
+ *
+ * @param term
+ */
+ private void termNotFound(String term)
+ {
+ synchronized (termsNotFound)
+ {
+ if (!termsNotFound.contains(term))
+ {
+ System.err.println("SO term " + term + " invalid");
+ termsNotFound.add(term);
+ }
+ }
+ }
+
+ /**
+ * Returns true if the childTerm 'isA' parentTerm (directly or indirectly).
+ *
+ * @param childTerm
+ * @param parentTerm
+ * @return
+ */
+ protected synchronized boolean termIsA(Term childTerm, Term parentTerm)
+ {
+ /*
+ * null term could arise from a misspelled SO description
+ */
+ if (childTerm == null || parentTerm == null)
+ {
+ return false;
+ }
+
+ /*
+ * recursive search endpoint:
+ */
+ if (childTerm == parentTerm)
+ {
+ return true;
+ }
+
+ /*
+ * lazy initialisation - find all of a term's parents (recursively)
+ * the first time this is called, and save them in a map.
+ */
+ if (!termIsA.containsKey(childTerm))
+ {
+ findParents(childTerm);
+ }
+
+ List<Term> parents = termIsA.get(childTerm);
+ for (Term parent : parents)
+ {
+ if (termIsA(parent, parentTerm))
+ {
+ /*
+ * add (great-)grandparents to parents list as they are discovered,
+ * for faster lookup next time
+ */
+ if (!parents.contains(parentTerm))
+ {
+ parents.add(parentTerm);
+ }
+ return true;
+ }
+ }
+
+ return false;
+ }
+
+ /**
+ * Finds all the 'isA' parents of the childTerm and stores them as a (possibly
+ * empty) list.
+ *
+ * @param childTerm
+ */
+ protected synchronized void findParents(Term childTerm)
+ {
+ List<Term> result = new ArrayList<Term>();
+ for (Triple triple : ontology.getTriples(childTerm, null, isA))
+ {
+ Term parent = triple.getObject();
+ result.add(parent);
+
+ /*
+ * and search for the parent's parents recursively
+ */
+ findParents(parent);
+ }
+ termIsA.put(childTerm, result);
+ }
+
+ /**
+ * Returns the Term for a given name (e.g. "SO:0000735") or description (e.g.
+ * "sequence_location"), or null if not found.
+ *
+ * @param child
+ * @return
+ */
+ protected Term getTerm(String nameOrDescription)
+ {
+ Term t = termsByDescription.get(nameOrDescription);
+ if (t == null)
+ {
+ try
+ {
+ t = ontology.getTerm(nameOrDescription);
+ } catch (NoSuchElementException e)
+ {
+ // not found
+ }
+ }
+ return t;
+ }
+
+ public boolean isSequenceVariant(String soTerm)
+ {
+ return isA(soTerm, SEQUENCE_VARIANT);
+ }
+
+ /**
+ * Sorts (case-insensitive) and returns the list of valid terms queried for
+ */
+ @Override
+ public List<String> termsFound()
+ {
+ synchronized (termsFound)
+ {
+ Collections.sort(termsFound, String.CASE_INSENSITIVE_ORDER);
+ return termsFound;
+ }
+ }
+
+ /**
+ * Sorts (case-insensitive) and returns the list of invalid terms queried for
+ */
+ @Override
+ public List<String> termsNotFound()
+ {
+ synchronized (termsNotFound)
+ {
+ Collections.sort(termsNotFound, String.CASE_INSENSITIVE_ORDER);
+ return termsNotFound;
+ }
+ }
+}
--- /dev/null
+package jalview.io.gff;
+
+public class SequenceOntologyFactory
+{
+ private static SequenceOntologyI instance;
+
+ public static synchronized SequenceOntologyI getInstance()
+ {
+ if (instance == null)
+ {
+ // instance = new SequenceOntology();
+ instance = new SequenceOntologyLite();
+ }
+ return instance;
+ }
+
+ public static void setInstance(SequenceOntologyI so)
+ {
+ instance = so;
+ }
+}
--- /dev/null
+package jalview.io.gff;
+
+import java.util.List;
+
+public interface SequenceOntologyI
+{
+ /*
+ * selected commonly used values for quick reference
+ */
+ // SO:0000104
+ public static final String POLYPEPTIDE = "polypeptide";
+
+ // SO:0000349
+ public static final String PROTEIN_MATCH = "protein_match";
+
+ // SO:0000347
+ public static final String NUCLEOTIDE_MATCH = "nucleotide_match";
+
+ // SO:0000316
+ public static final String CDS = "CDS";
+
+ // SO:0001060
+ public static final String SEQUENCE_VARIANT = "sequence_variant";
+
+ // SO:0000147
+ public static final String EXON = "exon";
+
+ // SO:0000673
+ public static final String TRANSCRIPT = "transcript";
+
+ // SO:0001621 isA sequence_variant but used in Ensembl as a transcript
+ public static final String NMD_TRANSCRIPT_VARIANT = "NMD_transcript_variant";
+
+ // SO:0000704
+ public static final String GENE = "gene";
+
+ public boolean isA(String childTerm, String parentTerm);
+
+ /**
+ * Returns a sorted list of all valid terms queried for (i.e. terms processed
+ * which were valid in the SO), using the friendly description.
+ *
+ * This can be used to check that any hard-coded stand-in for the full SO
+ * includes all the terms needed for correct processing.
+ *
+ * @return
+ */
+ public List<String> termsFound();
+
+ /**
+ * Returns a sorted list of all invalid terms queried for (i.e. terms
+ * processed which were not found in the SO), using the friendly description.
+ *
+ * This can be used to report any 'non-compliance' in data, and/or to report
+ * valid terms missing from any hard-coded stand-in for the full SO.
+ *
+ * @return
+ */
+ public List<String> termsNotFound();
+}
--- /dev/null
+package jalview.io.gff;
+
+import java.util.ArrayList;
+import java.util.Collections;
+import java.util.HashMap;
+import java.util.List;
+import java.util.Map;
+
+/**
+ * An implementation of SequenceOntologyI that hard codes terms of interest.
+ *
+ * Use this in unit testing by calling SequenceOntology.setInstance(new
+ * SequenceOntologyLite()).
+ *
+ * May also become a stand-in for SequenceOntology in the applet if we want to
+ * avoid the additional jars needed for parsing the full SO.
+ *
+ * @author gmcarstairs
+ *
+ */
+public class SequenceOntologyLite implements SequenceOntologyI
+{
+ /*
+ * initial selection of types of interest when processing Ensembl features
+ * NB unlike the full SequenceOntology we don't traverse indirect
+ * child-parent relationships here so e.g. need to list every sub-type
+ * of gene (direct or indirect) that is of interest
+ */
+ // @formatter:off
+ private final String[][] TERMS = new String[][] {
+
+ /*
+ * gene sub-types:
+ */
+ { "gene", "gene" },
+ { "ncRNA_gene", "gene" },
+ { "snRNA_gene", "gene" },
+ { "miRNA_gene", "gene" },
+ { "lincRNA_gene", "gene" },
+ { "rRNA_gene", "gene" },
+
+ /*
+ * transcript sub-types:
+ */
+ { "transcript", "transcript" },
+ { "mature_transcript", "transcript" },
+ { "processed_transcript", "transcript" },
+ { "aberrant_processed_transcript", "transcript" },
+ { "ncRNA", "transcript" },
+ { "snRNA", "transcript" },
+ { "miRNA", "transcript" },
+ { "lincRNA", "transcript" },
+ { "rRNA", "transcript" },
+ // there are many more sub-types of ncRNA...
+
+ /*
+ * sequence_variant sub-types:
+ */
+ { "sequence_variant", "sequence_variant" },
+ { "feature_variant", "sequence_variant" },
+ { "gene_variant", "sequence_variant" },
+ // NB Ensembl uses NMD_transcript_variant as if a 'transcript'
+ // but we model it here correctly as per the SO
+ { "NMD_transcript_variant", "sequence_variant" },
+ { "transcript_variant", "sequence_variant" },
+ { "structural_variant", "sequence_variant" },
+
+ /*
+ * no sub-types of exon or CDS yet seen in Ensembl
+ * some added here for testing purposes
+ */
+ { "exon", "exon" },
+ { "coding_exon", "exon" },
+ { "CDS", "CDS" },
+ { "CDS_predicted", "CDS" },
+
+ /*
+ * terms used in exonerate or PASA GFF
+ */
+ { "protein_match", "protein_match"},
+ { "nucleotide_match", "nucleotide_match"},
+ { "cDNA_match", "nucleotide_match"},
+
+ /*
+ * used in InterProScan GFF
+ */
+ { "polypeptide", "polypeptide" }
+ };
+ // @formatter:on
+
+ /*
+ * hard-coded list of any parents (direct or indirect)
+ * that we care about for a term
+ */
+ private Map<String, List<String>> parents;
+
+ private List<String> termsFound;
+
+ private List<String> termsNotFound;
+
+ public SequenceOntologyLite()
+ {
+ termsFound = new ArrayList<String>();
+ termsNotFound = new ArrayList<String>();
+ loadStaticData();
+ }
+
+ /**
+ * Loads hard-coded data into a lookup table of {term, {list_of_parents}}
+ */
+ private void loadStaticData()
+ {
+ parents = new HashMap<String, List<String>>();
+ for (String [] pair : TERMS) {
+ List<String> p = parents.get(pair[0]);
+ if (p == null)
+ {
+ p = new ArrayList<String>();
+ parents.put(pair[0], p);
+ }
+ p.add(pair[1]);
+ }
+ }
+
+ /**
+ * Answers true if 'child' isA 'parent' (including equality). In this
+ * implementation, based only on hard-coded values.
+ */
+ @Override
+ public boolean isA(String child, String parent)
+ {
+ if (child == null || parent == null)
+ {
+ return false;
+ }
+ if (child.equals(parent))
+ {
+ termFound(child);
+ return true;
+ }
+
+ List<String> p = parents.get(child);
+ if (p == null)
+ {
+ termNotFound(child);
+ return false;
+ }
+ termFound(child);
+ if (p.contains(parent))
+ {
+ return true;
+ }
+ return false;
+ }
+
+ /**
+ * Records a valid term queried for, for reporting purposes
+ *
+ * @param term
+ */
+ private void termFound(String term)
+ {
+ if (!termsFound.contains(term))
+ {
+ synchronized (termsFound)
+ {
+ termsFound.add(term);
+ }
+ }
+ }
+
+ /**
+ * Records an invalid term queried for, for reporting purposes
+ *
+ * @param term
+ */
+ private void termNotFound(String term)
+ {
+ synchronized (termsNotFound)
+ {
+ if (!termsNotFound.contains(term))
+ {
+ System.out.println("SO term " + term
+ + " not known - may be invalid, or model if needed in "
+ + getClass().getName());
+ termsNotFound.add(term);
+ }
+ }
+ }
+
+ /**
+ * Sorts (case-insensitive) and returns the list of valid terms queried for
+ */
+ @Override
+ public List<String> termsFound()
+ {
+ synchronized (termsFound)
+ {
+ Collections.sort(termsFound, String.CASE_INSENSITIVE_ORDER);
+ return termsFound;
+ }
+ }
+
+ /**
+ * Sorts (case-insensitive) and returns the list of invalid terms queried for
+ */
+ @Override
+ public List<String> termsNotFound()
+ {
+ synchronized (termsNotFound)
+ {
+ Collections.sort(termsNotFound, String.CASE_INSENSITIVE_ORDER);
+ return termsNotFound;
+ }
+ }
+}
import jalview.io.NewickFile;
import java.util.ArrayList;
+import java.util.HashMap;
import java.util.Hashtable;
import java.util.List;
+import java.util.Map;
public class JalviewDataset
{
/**
* @return the featureColours
*/
- public Hashtable getFeatureColours()
+ public Map<String, Object> getFeatureColours()
{
return featureColours;
}
* @param featureColours
* the featureColours to set
*/
- public void setFeatureColours(Hashtable featureColours)
+ public void setFeatureColours(Map<String, Object> featureColours)
{
this.featureColours = featureColours;
}
/**
* current set of feature colours
*/
- Hashtable featureColours;
+ Map<String, Object> featureColours;
/**
* original identity of each sequence in results
seqDetails = new Hashtable();
al = new ArrayList<AlignmentSet>();
parentDataset = null;
- featureColours = new Hashtable();
+ featureColours = new HashMap<String, Object>();
}
/**
*
* @param parentAlignment
*/
- public JalviewDataset(AlignmentI aldataset, Hashtable fc,
+ public JalviewDataset(AlignmentI aldataset, Map<String, Object> fc,
Hashtable seqDets)
{
+ // TODO not used - remove?
this(aldataset, fc, seqDets, null);
}
* (may be null) alignment to associate new annotation and trees
* with.
*/
- public JalviewDataset(AlignmentI aldataset, Hashtable fc,
+ public JalviewDataset(AlignmentI aldataset, Map<String, Object> fc,
Hashtable seqDets, AlignmentI parentAlignment)
{
this();
import java.io.BufferedReader;
import java.io.IOException;
import java.util.ArrayList;
-import java.util.Hashtable;
+import java.util.HashMap;
import java.util.List;
public class ParsePackedSet
String fmt = null;
try
{
- fmt = new IdentifyFile().Identify(src, false);
+ fmt = new IdentifyFile().identify(src, false);
} catch (Exception ex)
{
exerror = ex;
// if not, create one.
if (context.featureColours == null)
{
- context.featureColours = new Hashtable();
+ context.featureColours = new HashMap<String, Object>();
}
try
{
import jalview.util.UrlLink;
import java.util.Enumeration;
+import java.util.Iterator;
import java.util.Vector;
import uk.ac.vamsas.objects.core.DataSetAnnotations;
doJvUpdate();
}
+ @Override
public void addToDocument()
{
DataSetAnnotations dsa = (DataSetAnnotations) vobj;
dataset.addDataSetAnnotations(dsa);
}
+ @Override
public void addFromDocument()
{
DataSetAnnotations dsa = (DataSetAnnotations) vobj;
bindjvvobj(sf, dsa);
}
+ @Override
public void conflict()
{
log.warn("Untested sequencefeature conflict code");
addToDocument(); // and create a new feature in the document
}
+ @Override
public void updateToDoc()
{
DataSetAnnotations dsa = (DataSetAnnotations) vobj;
}
+ @Override
public void updateFromDoc()
{
DataSetAnnotations dsa = (DataSetAnnotations) vobj;
}
if (feature.otherDetails != null)
{
- Enumeration iter = feature.otherDetails.keys();
+ Iterator<String> iter = feature.otherDetails.keySet().iterator();
Vector props = dsa.getPropertyAsReference();
- while (iter.hasMoreElements())
+ while (iter.hasNext())
{
- String key = (String) iter.nextElement();
+ String key = iter.next();
if (!key.equalsIgnoreCase("score")
&& !key.equalsIgnoreCase("status"))
{
protected JMenuItem showTranslation = new JMenuItem();
+ protected JMenuItem showReverse = new JMenuItem();
+
+ protected JMenuItem showReverseComplement = new JMenuItem();
+
protected JMenu showProducts = new JMenu();
protected JMenuItem rnahelicesColour = new JMenuItem();
showTranslation_actionPerformed(e);
}
});
+ showReverse.setText(MessageManager.getString("label.reverse"));
+ showReverse.addActionListener(new ActionListener()
+ {
+ @Override
+ public void actionPerformed(ActionEvent e)
+ {
+ showReverse_actionPerformed(false);
+ }
+ });
+ showReverseComplement.setText(MessageManager
+ .getString("label.reverse_complement"));
+ showReverseComplement.addActionListener(new ActionListener()
+ {
+ @Override
+ public void actionPerformed(ActionEvent e)
+ {
+ showReverse_actionPerformed(true);
+ }
+ });
JMenuItem extractScores = new JMenuItem(
MessageManager.getString("label.extract_scores"));
calculateMenu.add(PCAMenuItem);
calculateMenu.addSeparator();
calculateMenu.add(showTranslation);
+ calculateMenu.add(showReverse);
+ calculateMenu.add(showReverseComplement);
calculateMenu.add(showProducts);
calculateMenu.add(autoCalculate);
calculateMenu.add(sortByTree);
}
/**
+ * Generate the reverse sequence (or reverse complement if the flag is true)
+ * and add it to the alignment
+ *
+ * @param complement
+ */
+ protected void showReverse_actionPerformed(boolean complement)
+ {
+ }
+
+ /**
* Adds the given action listener and key accelerator to the given menu item.
* Also saves in a lookup table to support lookup of action by key stroke.
*
return this.splitFrame;
}
- protected void showComplement_actionPerformed(boolean state)
+ protected void showComplement_actionPerformed(boolean complement)
{
}
}
protected JMenuItem fitToWindow = new JMenuItem();
+ protected JMenuItem highlightSelection = new JMenuItem();
+
protected JRadioButtonMenuItem seqColour = new JRadioButtonMenuItem();
protected JRadioButtonMenuItem chainColour = new JRadioButtonMenuItem();
pdbFile.setText(MessageManager.getString("label.pdb_file"));
pdbFile.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
pdbFile_actionPerformed(actionEvent);
png.setText("PNG");
png.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
png_actionPerformed(actionEvent);
eps.setText("EPS");
eps.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
eps_actionPerformed(actionEvent);
viewMapping.setText(MessageManager.getString("label.view_mapping"));
viewMapping.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
viewMapping_actionPerformed(actionEvent);
fitToWindow.setText(MessageManager.getString("label.fit_to_window"));
fitToWindow.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
fitToWindow_actionPerformed();
}
});
+ highlightSelection.setText(MessageManager
+ .getString("label.highlight_selection"));
+ highlightSelection.addActionListener(new ActionListener()
+ {
+ @Override
+ public void actionPerformed(ActionEvent actionEvent)
+ {
+ highlightSelection_actionPerformed();
+ }
+ });
+
JMenu colourMenu = new JMenu();
colourMenu.setText(MessageManager.getString("label.colours"));
.setText(MessageManager.getString("action.background_colour"));
backGround.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
backGround_actionPerformed(actionEvent);
seqColour.setText(MessageManager.getString("action.by_sequence"));
seqColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
seqColour_actionPerformed(actionEvent);
chainColour.setText(MessageManager.getString("action.by_chain"));
chainColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
chainColour_actionPerformed(actionEvent);
chargeColour.setText(MessageManager.getString("label.charge_cysteine"));
chargeColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
chargeColour_actionPerformed(actionEvent);
zappoColour.setText(MessageManager.getString("label.zappo"));
zappoColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
zappoColour_actionPerformed(actionEvent);
taylorColour.setText(MessageManager.getString("label.taylor"));
taylorColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
taylorColour_actionPerformed(actionEvent);
hydroColour.setText(MessageManager.getString("label.hydrophobicity"));
hydroColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
hydroColour_actionPerformed(actionEvent);
.getString("label.strand_propensity"));
strandColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
strandColour_actionPerformed(actionEvent);
helixColour.setText(MessageManager.getString("label.helix_propensity"));
helixColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
helixColour_actionPerformed(actionEvent);
turnColour.setText(MessageManager.getString("label.turn_propensity"));
turnColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
turnColour_actionPerformed(actionEvent);
buriedColour.setText(MessageManager.getString("label.buried_index"));
buriedColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
buriedColour_actionPerformed(actionEvent);
.getString("label.purine_pyrimidine"));
purinePyrimidineColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
purinePyrimidineColour_actionPerformed(actionEvent);
userColour.setText(MessageManager.getString("action.user_defined"));
userColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
userColour_actionPerformed(actionEvent);
.getString("label.let_jmol_manage_structure_colours"));
viewerColour.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
viewerColour_actionPerformed(actionEvent);
helpItem.setText(MessageManager.getString("label.jmol_help"));
helpItem.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
showHelp_actionPerformed(actionEvent);
.setText(MessageManager.getString("label.align_structures"));
alignStructs.addActionListener(new ActionListener()
{
+ @Override
public void actionPerformed(ActionEvent actionEvent)
{
alignStructs_actionPerformed(actionEvent);
{
}
+ protected void highlightSelection_actionPerformed()
+ {
+ }
+
protected void viewerColour_actionPerformed(ActionEvent actionEvent)
{
}
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.viewmodel.seqfeatures.FeatureRendererModel;
import java.awt.AlphaComposite;
import java.awt.Color;
import java.awt.Graphics2D;
import java.awt.image.BufferedImage;
-public class FeatureRenderer extends
- jalview.viewmodel.seqfeatures.FeatureRendererModel
+public class FeatureRenderer extends FeatureRendererModel
{
FontMetrics fm;
BufferedImage offscreenImage;
+ @Override
public Color findFeatureColour(Color initialCol, SequenceI seq, int res)
{
return new Color(findFeatureColour(initialCol.getRGB(), seq, res));
* discover and display.
*
*/
+ @Override
public void featuresAdded()
{
lastSeq = null;
--- /dev/null
+package jalview.schemes;
+
+import jalview.api.FeatureColourI;
+
+import java.awt.Color;
+
+/**
+ * A convenience class with implementations of FeatureColourI methods. Override
+ * methods as required in subclasses.
+ */
+public class FeatureColourAdapter implements FeatureColourI
+{
+ @Override
+ public boolean isGraduatedColour()
+ {
+ return isColourByLabel() || isAboveThreshold() || isBelowThreshold();
+ }
+
+ @Override
+ public Color getColour()
+ {
+ return Color.BLACK;
+ }
+
+ @Override
+ public Color getMinColour()
+ {
+ return Color.WHITE;
+ }
+
+ @Override
+ public Color getMaxColour()
+ {
+ return Color.BLACK;
+ }
+
+ @Override
+ public boolean isColourByLabel()
+ {
+ return false;
+ }
+
+ @Override
+ public boolean isBelowThreshold()
+ {
+ return false;
+ }
+
+ @Override
+ public boolean isAboveThreshold()
+ {
+ return false;
+ }
+
+ @Override
+ public boolean isThresholdMinMax()
+ {
+ return false;
+ }
+
+ @Override
+ public float getThreshold()
+ {
+ return 0f;
+ }
+
+ @Override
+ public boolean isLowToHigh()
+ {
+ return true;
+ }
+
+}
--- /dev/null
+package jalview.schemes;
+
+import jalview.api.FeatureColourI;
+import jalview.api.FeatureSettingsI;
+
+/**
+ * An adapter class that may be extended to instantiate feature colour schemes
+ */
+public class FeatureSettingsAdapter implements FeatureSettingsI
+{
+
+ @Override
+ public boolean isFeatureDisplayed(String type)
+ {
+ return false;
+ }
+
+ @Override
+ public boolean isGroupDisplayed(String group)
+ {
+ return true;
+ }
+
+ @Override
+ public FeatureColourI getFeatureColour(String type)
+ {
+ return null;
+ }
+
+ @Override
+ public float getTransparency()
+ {
+ return 1f;
+ }
+
+ @Override
+ public int compare(String feature1, String feature2)
+ {
+ return 0;
+ }
+
+ @Override
+ public boolean optimiseOrder()
+ {
+ return false;
+ }
+
+}
*/
package jalview.schemes;
+import jalview.api.FeatureColourI;
import jalview.datamodel.SequenceFeature;
import java.awt.Color;
updateBounds(min, max);
}
+ public GraduatedColor(FeatureColourI col)
+ {
+ setColourByLabel(col.isColourByLabel());
+ }
+
public Color getMinColor()
{
return new Color(lr, lg, lb);
public class ResidueProperties
{
- public static Hashtable<String, ScoreModelI> scoreMatrices = new Hashtable();
+ public static Hashtable<String, ScoreModelI> scoreMatrices = new Hashtable<String, ScoreModelI>();
// Stores residue codes/names and colours and other things
public static final int[] aaIndex; // aaHash version 2.1.1 and below
if (col == null)
{
- System.out.println("Unknown colour!! " + colour);
+ System.out.println("Making colour from name: " + colour);
col = createColourFromName(colour);
}
import java.util.Enumeration;
import java.util.HashMap;
import java.util.IdentityHashMap;
-import java.util.LinkedHashSet;
import java.util.List;
import java.util.Map;
-import java.util.Set;
import java.util.Vector;
import MCview.Atom;
/*
* Set of any registered mappings between (dataset) sequences.
*/
- public Set<AlignedCodonFrame> seqmappings = new LinkedHashSet<AlignedCodonFrame>();
+ private List<AlignedCodonFrame> seqmappings = new ArrayList<AlignedCodonFrame>();
private List<CommandListener> commandListeners = new ArrayList<CommandListener>();
* the sequence that the mouse over occurred on
* @param indexpos
* the absolute position being mouseovered in seq (0 to seq.length())
- * @param index
+ * @param seqPos
* the sequence position (if -1, seq.findPosition is called to
* resolve the residue number)
*/
- public void mouseOverSequence(SequenceI seq, int indexpos, int index,
+ public void mouseOverSequence(SequenceI seq, int indexpos, int seqPos,
VamsasSource source)
{
boolean hasSequenceListeners = handlingVamsasMo
|| !seqmappings.isEmpty();
SearchResults results = null;
- if (index == -1)
+ if (seqPos == -1)
{
- index = seq.findPosition(indexpos);
+ seqPos = seq.findPosition(indexpos);
}
for (int i = 0; i < listeners.size(); i++)
{
}
if (listener instanceof StructureListener)
{
- highlightStructure((StructureListener) listener, seq, index);
+ highlightStructure((StructureListener) listener, seq, seqPos);
}
else
{
{
if (results == null)
{
- results = MappingUtils.buildSearchResults(seq, index,
+ results = MappingUtils.buildSearchResults(seq, seqPos,
seqmappings);
}
if (handlingVamsasMo)
{
- results.addResult(seq, index, index);
+ results.addResult(seq, seqPos, seqPos);
}
if (!results.isEmpty())
else if (listener instanceof SecondaryStructureListener)
{
((SecondaryStructureListener) listener).mouseOverSequence(seq,
- indexpos, index);
+ indexpos, seqPos);
}
}
}
/**
* Send suitable messages to a StructureListener to highlight atoms
- * corresponding to the given sequence position.
+ * corresponding to the given sequence position(s)
*
* @param sl
* @param seq
- * @param index
+ * @param positions
*/
- protected void highlightStructure(StructureListener sl, SequenceI seq,
- int index)
+ public void highlightStructure(StructureListener sl, SequenceI seq,
+ int... positions)
{
if (!sl.isListeningFor(seq))
{
{
if (sm.sequence == seq || sm.sequence == seq.getDatasetSequence())
{
- atomNo = sm.getAtomNum(index);
-
- if (atomNo > 0)
+ for (int index : positions)
{
- atoms.add(new AtomSpec(sm.pdbfile, sm.pdbchain, sm
- .getPDBResNum(index), atomNo));
+ atomNo = sm.getAtomNum(index);
+
+ if (atomNo > 0)
+ {
+ atoms.add(new AtomSpec(sm.pdbfile, sm.pdbchain, sm
+ .getPDBResNum(index), atomNo));
+ }
}
}
}
/**
* Add each of the given codonFrames to the stored set, if not aready present.
*
- * @param set
+ * @param mappings
*/
- public void registerMappings(Set<AlignedCodonFrame> set)
+ public void registerMappings(List<AlignedCodonFrame> mappings)
{
- if (set != null)
+ if (mappings != null)
{
- for (AlignedCodonFrame acf : set)
+ for (AlignedCodonFrame acf : mappings)
{
registerMapping(acf);
}
progressIndicator.setProgressBar(message, progressSessionId);
}
+ public List<AlignedCodonFrame> getSequenceMappings()
+ {
+ return seqmappings;
+ }
+
}
import java.util.ArrayList;
import java.util.HashMap;
+import java.util.HashSet;
import java.util.Hashtable;
import java.util.List;
import java.util.Map;
import com.stevesoft.pat.Regex;
+/**
+ * Utilities for handling DBRef objects and their collections.
+ */
public class DBRefUtils
{
+ /*
+ * lookup from lower-case form of a name to its canonical (standardised) form
+ */
private static Map<String, String> canonicalSourceNameLookup = new HashMap<String, String>();
private static Map<String, String> dasCoordinateSystemsLookup = new HashMap<String, String>();
canonicalSourceNameLookup.put("uniprotkb/swiss-prot",
DBRefSource.UNIPROT);
canonicalSourceNameLookup.put("uniprotkb/trembl", DBRefSource.UNIPROT);
+
+ // Ensembl values for dbname in xref REST service:
+ canonicalSourceNameLookup.put("uniprot/sptrembl", DBRefSource.UNIPROT);
+ canonicalSourceNameLookup.put("uniprot/swissprot", DBRefSource.UNIPROT);
+
canonicalSourceNameLookup.put("pdb", DBRefSource.PDB);
+ canonicalSourceNameLookup.put("ensembl", DBRefSource.ENSEMBL);
dasCoordinateSystemsLookup.put("pdbresnum", DBRefSource.PDB);
dasCoordinateSystemsLookup.put("uniprot", DBRefSource.UNIPROT);
}
/**
- * Utilities for handling DBRef objects and their collections.
- */
- /**
*
* @param dbrefs
- * Vector of DBRef objects to search
+ * array of DBRef objects to search
* @param sources
* String[] array of source DBRef IDs to retrieve
- * @return Vector
+ * @return
*/
public static DBRefEntry[] selectRefs(DBRefEntry[] dbrefs,
String[] sources)
{
- if (dbrefs == null)
- {
- return null;
- }
- if (sources == null)
+ if (dbrefs == null || sources == null)
{
return dbrefs;
}
- Map<String, Integer> srcs = new HashMap<String, Integer>();
- ArrayList<DBRefEntry> res = new ArrayList<DBRefEntry>();
-
- for (int i = 0; i < sources.length; i++)
+ HashSet<String> srcs = new HashSet<String>();
+ for (String src : sources)
{
- srcs.put(new String(sources[i]), new Integer(i));
+ srcs.add(src);
}
- for (int i = 0, j = dbrefs.length; i < j; i++)
+
+ List<DBRefEntry> res = new ArrayList<DBRefEntry>();
+ for (DBRefEntry dbr : dbrefs)
{
- if (srcs.containsKey(dbrefs[i].getSource()))
+ String source = getCanonicalName(dbr.getSource());
+ if (srcs.contains(source))
{
- res.add(dbrefs[i]);
+ res.add(dbr);
}
}
DBRefEntry[] reply = new DBRefEntry[res.size()];
return res.toArray(reply);
}
- res = null;
- // there are probable memory leaks in the hashtable!
return null;
}
}
/**
+ * Returns an array of those references that match the given accession id
+ * <ul>
+ * <li>database sources are the same</li>
+ * <li>accession ids are the same</li>
+ * <li>both have no mapping, or the mappings are the same</li>
+ * </ul>
+ *
+ * @param ref
+ * Set of references to search
+ * @param entry
+ * pattern to match
+ * @return
+ */
+ public static DBRefEntry[] searchRefs(DBRefEntry[] ref, String accId)
+ {
+ return searchRefs(ref, new DBRefEntry("", "", accId), matchId);
+ }
+
+ /**
* Returns an array of those references that match the given entry, according
* to the given comparator. Returns null if no matches.
*
/**
* match on all non-null fields in refa
*/
+ // TODO unused - remove?
public static DbRefComp matchNonNullonA = new DbRefComp()
{
+ @Override
public boolean matches(DBRefEntry refa, DBRefEntry refb)
{
if (refa.getSource() == null
* either field is null or field matches for all of source, version, accession
* id and map.
*/
+ // TODO unused - remove?
public static DbRefComp matchEitherNonNull = new DbRefComp()
{
+ @Override
public boolean matches(DBRefEntry refa, DBRefEntry refb)
{
- if ((refa.getSource() == null || refb.getSource() == null)
- || refb.getSource().equals(refa.getSource()))
+ if (nullOrEqual(refa.getSource(), refb.getSource())
+ && nullOrEqual(refa.getVersion(), refb.getVersion())
+ && nullOrEqual(refa.getAccessionId(), refb.getAccessionId())
+ && nullOrEqual(refa.getMap(), refb.getMap()))
{
- if ((refa.getVersion() == null || refb.getVersion() == null)
- || refb.getVersion().equals(refa.getVersion()))
- {
- if ((refa.getAccessionId() == null || refb.getAccessionId() == null)
- || refb.getAccessionId().equals(refa.getAccessionId()))
- {
- if ((refa.getMap() == null || refb.getMap() == null)
- || (refb.getMap() != null && refb.getMap().equals(
- refa.getMap())))
- {
- return true;
- }
- }
- }
+ return true;
}
return false;
}
* accession ID and DB must be identical. Version is ignored. Map is either
* not defined or is a match (or is compatible?)
*/
+ // TODO unused - remove?
public static DbRefComp matchDbAndIdAndEitherMap = new DbRefComp()
{
+ @Override
public boolean matches(DBRefEntry refa, DBRefEntry refb)
{
if (refa.getSource() != null && refb.getSource() != null
&& refb.getSource().equals(refa.getSource()))
{
// We dont care about version
- // if ((refa.getVersion()==null || refb.getVersion()==null)
- // || refb.getVersion().equals(refa.getVersion()))
- // {
if (refa.getAccessionId() != null && refb.getAccessionId() != null
+ // FIXME should be && not || here?
|| refb.getAccessionId().equals(refa.getAccessionId()))
{
if ((refa.getMap() == null || refb.getMap() == null)
* or map but no maplist on either or maplist of map on a is the complement of
* maplist of map on b.
*/
+ // TODO unused - remove?
public static DbRefComp matchDbAndIdAndComplementaryMapList = new DbRefComp()
{
+ @Override
public boolean matches(DBRefEntry refa, DBRefEntry refb)
{
if (refa.getSource() != null && refb.getSource() != null
&& refb.getSource().equals(refa.getSource()))
{
// We dont care about version
- // if ((refa.getVersion()==null || refb.getVersion()==null)
- // || refb.getVersion().equals(refa.getVersion()))
- // {
if (refa.getAccessionId() != null && refb.getAccessionId() != null
|| refb.getAccessionId().equals(refa.getAccessionId()))
{
* or or map but no maplist on either or maplist of map on a is equivalent to
* the maplist of map on b.
*/
+ // TODO unused - remove?
public static DbRefComp matchDbAndIdAndEquivalentMapList = new DbRefComp()
{
+ @Override
public boolean matches(DBRefEntry refa, DBRefEntry refb)
{
if (refa.getSource() != null && refb.getSource() != null
*/
public static DbRefComp matchDbAndIdAndEitherMapOrEquivalentMapList = new DbRefComp()
{
+ @Override
public boolean matches(DBRefEntry refa, DBRefEntry refb)
{
- // System.err.println("Comparing A: "+refa.getSrcAccString()+(refa.hasMap()?" has map.":"."));
- // System.err.println("Comparing B: "+refb.getSrcAccString()+(refb.hasMap()?" has map.":"."));
if (refa.getSource() != null && refb.getSource() != null
&& refb.getSource().equals(refa.getSource()))
{
// We dont care about version
- // if ((refa.getVersion()==null || refb.getVersion()==null)
- // || refb.getVersion().equals(refa.getVersion()))
- // {
if (refa.getAccessionId() != null && refb.getAccessionId() != null
&& refb.getAccessionId().equals(refa.getAccessionId()))
{
};
/**
+ * accession ID only must be identical.
+ */
+ public static DbRefComp matchId = new DbRefComp()
+ {
+ @Override
+ public boolean matches(DBRefEntry refa, DBRefEntry refb)
+ {
+ if (refa.getAccessionId() != null && refb.getAccessionId() != null
+ && refb.getAccessionId().equals(refa.getAccessionId()))
+ {
+ return true;
+ }
+ return false;
+ }
+ };
+
+ /**
* Parses a DBRefEntry and adds it to the sequence, also a PDBEntry if the
* database is PDB.
* <p>
return ref;
}
+ /**
+ * Returns true if either object is null, or they are equal
+ *
+ * @param o1
+ * @param o2
+ * @return
+ */
+ public static boolean nullOrEqual(Object o1, Object o2)
+ {
+ if (o1 == null || o2 == null)
+ {
+ return true;
+ }
+ return (o1 == null ? o2.equals(o1) : o1.equals(o2));
+ }
+
}
/*
* Subregions (base 1) described as { [start1, end1], [start2, end2], ...}
*/
- private List<int[]> fromShifts = new ArrayList<int[]>();
+ private List<int[]> fromShifts;
/*
* Same format as fromShifts, for the 'mapped to' sequence
*/
- private List<int[]> toShifts = new ArrayList<int[]>();
+ private List<int[]> toShifts;
/*
* number of steps in fromShifts to one toRatio unit
private int toHighest;
/**
+ * Constructor
+ */
+ public MapList()
+ {
+ fromShifts = new ArrayList<int[]>();
+ toShifts = new ArrayList<int[]>();
+ }
+
+ /**
* Two MapList objects are equal if they are the same object, or they both
* have populated shift ranges and all values are the same.
*/
}
/**
- * Constructor.
+ * Constructor given from and to ranges as [start1, end1, start2, end2,...].
+ * If any end is equal to the next start, the ranges will be merged. There is
+ * no validation check that the ranges do not overlap each other.
*
* @param from
* contiguous regions as [start1, end1, start2, end2, ...]
*/
public MapList(int from[], int to[], int fromRatio, int toRatio)
{
+ this();
this.fromRatio = fromRatio;
this.toRatio = toRatio;
- fromLowest = from[0];
- fromHighest = from[1];
+ fromLowest = Integer.MAX_VALUE;
+ fromHighest = Integer.MIN_VALUE;
+ int added = 0;
+
for (int i = 0; i < from.length; i += 2)
{
- fromLowest = Math.min(fromLowest, from[i]);
- fromHighest = Math.max(fromHighest, from[i + 1]);
-
- fromShifts.add(new int[] { from[i], from[i + 1] });
+ /*
+ * note lowest and highest values - bearing in mind the
+ * direction may be revesed
+ */
+ fromLowest = Math.min(fromLowest, Math.min(from[i], from[i + 1]));
+ fromHighest = Math.max(fromHighest, Math.max(from[i], from[i + 1]));
+ if (added > 0 && from[i] == fromShifts.get(added - 1)[1])
+ {
+ /*
+ * this range starts where the last ended - just extend it
+ */
+ fromShifts.get(added - 1)[1] = from[i + 1];
+ }
+ else
+ {
+ fromShifts.add(new int[] { from[i], from[i + 1] });
+ added++;
+ }
}
- toLowest = to[0];
- toHighest = to[1];
+ toLowest = Integer.MAX_VALUE;
+ toHighest = Integer.MIN_VALUE;
+ added = 0;
for (int i = 0; i < to.length; i += 2)
{
- toLowest = Math.min(toLowest, to[i]);
- toHighest = Math.max(toHighest, to[i + 1]);
- toShifts.add(new int[] { to[i], to[i + 1] });
+ toLowest = Math.min(toLowest, Math.min(to[i], to[i + 1]));
+ toHighest = Math.max(toHighest, Math.max(to[i], to[i + 1]));
+ if (added > 0 && to[i] == toShifts.get(added - 1)[1])
+ {
+ toShifts.get(added - 1)[1] = to[i + 1];
+ }
+ else
+ {
+ toShifts.add(new int[] { to[i], to[i + 1] });
+ added++;
+ }
}
}
*/
public MapList(MapList map)
{
+ this();
// TODO not used - remove?
this.fromLowest = map.fromLowest;
this.fromHighest = map.fromHighest;
}
/**
- * Constructor given ranges as lists of [start, end] positions
+ * Constructor given ranges as lists of [start, end] positions. There is no
+ * validation check that the ranges do not overlap each other.
*
* @param fromRange
* @param toRange
public MapList(List<int[]> fromRange, List<int[]> toRange, int fromRatio,
int toRatio)
{
+ this();
+ fromRange = coalesceRanges(fromRange);
+ toRange = coalesceRanges(toRange);
this.fromShifts = fromRange;
this.toShifts = toRange;
this.fromRatio = fromRatio;
this.toRatio = toRatio;
fromLowest = Integer.MAX_VALUE;
- fromHighest = 0;
+ fromHighest = Integer.MIN_VALUE;
for (int[] range : fromRange)
{
- fromLowest = Math.min(fromLowest, range[0]);
- fromHighest = Math.max(fromHighest, range[1]);
+ fromLowest = Math.min(fromLowest, Math.min(range[0], range[1]));
+ fromHighest = Math.max(fromHighest, Math.max(range[0], range[1]));
}
toLowest = Integer.MAX_VALUE;
- toHighest = 0;
+ toHighest = Integer.MIN_VALUE;
for (int[] range : toRange)
{
- toLowest = Math.min(toLowest, range[0]);
- toHighest = Math.max(toHighest, range[1]);
+ toLowest = Math.min(toLowest, Math.min(range[0], range[1]));
+ toHighest = Math.max(toHighest, Math.max(range[0], range[1]));
+ }
+ }
+
+ /**
+ * Consolidates a list of ranges so that any contiguous ranges are merged.
+ * This assumes the ranges are already in start order (does not sort them).
+ *
+ * @param ranges
+ * @return the same list (if unchanged), else a new merged list, leaving the
+ * input list unchanged
+ */
+ public static List<int[]> coalesceRanges(final List<int[]> ranges)
+ {
+ if (ranges == null || ranges.size() < 2) {
+ return ranges;
+ }
+
+ boolean changed = false;
+ List<int[]> merged = new ArrayList<int[]>();
+ int[] lastRange = ranges.get(0);
+ int lastDirection = lastRange[1] >= lastRange[0] ? 1 : -1;
+ lastRange = new int[] { lastRange[0], lastRange[1] };
+ merged.add(lastRange);
+ boolean first = true;
+
+ for (final int[] range : ranges)
+ {
+ if (first)
+ {
+ first = false;
+ continue;
+ }
+ if (range[0] == lastRange[0] && range[1] == lastRange[1])
+ {
+ // drop duplicate range
+ changed = true;
+ continue;
+ }
+
+ /*
+ * drop this range if it lies within the last range
+ */
+ if ((lastDirection == 1 && range[0] >= lastRange[0]
+ && range[0] <= lastRange[1] && range[1] >= lastRange[0] && range[1] <= lastRange[1])
+ || (lastDirection == -1 && range[0] <= lastRange[0]
+ && range[0] >= lastRange[1]
+ && range[1] <= lastRange[0] && range[1] >= lastRange[1]))
+ {
+ changed = true;
+ continue;
+ }
+
+ int direction = range[1] >= range[0] ? 1 : -1;
+
+ /*
+ * if next range is in the same direction as last and contiguous,
+ * just update the end position of the last range
+ */
+ boolean sameDirection = range[1] == range[0] || direction == lastDirection;
+ boolean extending = range[0] == lastRange[1] + lastDirection;
+ boolean overlapping = (lastDirection == 1 && range[0] >= lastRange[0] && range[0] <= lastRange[1])
+ || (lastDirection == -1 && range[0] <= lastRange[0] && range[0] >= lastRange[1]);
+ if (sameDirection && (overlapping || extending))
+ {
+ lastRange[1] = range[1];
+ changed = true;
+ }
+ else
+ {
+ lastRange = new int[] { range[0], range[1] };
+ merged.add(lastRange);
+ // careful: merging [5, 5] after [7, 6] should keep negative direction
+ lastDirection = (range[1] == range[0]) ? lastDirection : direction;
+ }
}
+
+ return changed ? merged : ranges;
}
/**
public String toString()
{
StringBuilder sb = new StringBuilder(64);
- sb.append("From (").append(fromRatio).append(":").append(toRatio)
- .append(") [");
+ sb.append("[");
for (int[] shift : fromShifts)
{
sb.append(" ").append(Arrays.toString(shift));
sb.append(" ]");
return sb.toString();
}
+
+ /**
+ * Extend this map list by adding the given map's ranges. There is no
+ * validation check that the ranges do not overlap existing ranges (or each
+ * other), but contiguous ranges are merged.
+ *
+ * @param map
+ */
+ public void addMapList(MapList map)
+ {
+ this.fromLowest = Math.min(fromLowest, map.fromLowest);
+ this.toLowest = Math.min(toLowest, map.toLowest);
+ this.fromHighest = Math.max(fromHighest, map.fromHighest);
+ this.toHighest = Math.max(toHighest, map.toHighest);
+
+ for (int[] range : map.getFromRanges())
+ {
+ addRange(range, fromShifts);
+ }
+ for (int[] range : map.getToRanges())
+ {
+ addRange(range, toShifts);
+ }
+ }
+
+ /**
+ * Adds the given range to a list of ranges. If the new range just extends
+ * existing ranges, the current endpoint is updated instead.
+ *
+ * @param range
+ * @param addTo
+ */
+ static void addRange(int[] range, List<int[]> addTo)
+ {
+ /*
+ * list is empty - add to it!
+ */
+ if (addTo.size() == 0)
+ {
+ addTo.add(range);
+ return;
+ }
+
+ int[] last = addTo.get(addTo.size() - 1);
+ boolean lastForward = last[1] >= last[0];
+ boolean newForward = range[1] >= range[0];
+
+ /*
+ * contiguous range in the same direction - just update endpoint
+ */
+ if (lastForward == newForward && last[1] == range[0])
+ {
+ last[1] = range[1];
+ return;
+ }
+
+ /*
+ * next range starts at +1 in forward sense - update endpoint
+ */
+ if (lastForward && newForward && range[0] == last[1] + 1)
+ {
+ last[1] = range[1];
+ return;
+ }
+
+ /*
+ * next range starts at -1 in reverse sense - update endpoint
+ */
+ if (!lastForward && !newForward && range[0] == last[1] - 1)
+ {
+ last[1] = range[1];
+ return;
+ }
+
+ /*
+ * just add the new range
+ */
+ addTo.add(range);
+ }
+
+ /**
+ * Returns true if mapping is from forward strand, false if from reverse
+ * strand. Result is just based on the first 'from' range that is not a single
+ * position. Default is true unless proven to be false. Behaviour is not well
+ * defined if the mapping has a mixture of forward and reverse ranges.
+ *
+ * @return
+ */
+ public boolean isFromForwardStrand()
+ {
+ boolean forwardStrand = true;
+ for (int[] range : getFromRanges())
+ {
+ if (range[1] > range[0])
+ {
+ break; // forward strand confirmed
+ }
+ else if (range[1] < range[0])
+ {
+ forwardStrand = false;
+ break; // reverse strand confirmed
+ }
+ }
+ return forwardStrand;
+ }
}
import jalview.datamodel.SequenceI;
import java.util.ArrayList;
-import java.util.Collections;
+import java.util.Arrays;
import java.util.HashMap;
import java.util.Iterator;
import java.util.List;
import java.util.Map;
-import java.util.Set;
/**
* Helper methods for manipulations involving sequence mappings.
*/
protected static void mapCutOrPaste(Edit edit, boolean undo,
List<SequenceI> targetSeqs, EditCommand result,
- Set<AlignedCodonFrame> mappings)
+ List<AlignedCodonFrame> mappings)
{
Action action = edit.getAction();
if (undo)
*/
public static EditCommand mapEditCommand(EditCommand command,
boolean undo, final AlignmentI mapTo, char gapChar,
- Set<AlignedCodonFrame> mappings)
+ List<AlignedCodonFrame> mappings)
{
/*
* For now, only support mapping from protein edits to cDna
Map<SequenceI, SequenceI> originalSequences,
final List<SequenceI> targetSeqs,
Map<SequenceI, SequenceI> targetCopies, char gapChar,
- EditCommand result, Set<AlignedCodonFrame> mappings)
+ EditCommand result, List<AlignedCodonFrame> mappings)
{
Action action = edit.getAction();
* @return
*/
public static SearchResults buildSearchResults(SequenceI seq, int index,
- Set<AlignedCodonFrame> seqmappings)
+ List<AlignedCodonFrame> seqmappings)
{
SearchResults results = new SearchResults();
addSearchResults(results, seq, index, seqmappings);
* @param seqmappings
*/
public static void addSearchResults(SearchResults results, SequenceI seq,
- int index, Set<AlignedCodonFrame> seqmappings)
+ int index, List<AlignedCodonFrame> seqmappings)
{
if (index >= seq.getStart() && index <= seq.getEnd())
{
*/
boolean targetIsNucleotide = mapTo.isNucleotide();
AlignViewportI protein = targetIsNucleotide ? mapFrom : mapTo;
- Set<AlignedCodonFrame> codonFrames = protein.getAlignment()
+ List<AlignedCodonFrame> codonFrames = protein.getAlignment()
.getCodonFrames();
/*
* Copy group name, colours etc, but not sequences or sequence colour scheme
/*
* Found a sequence mapping. Locate the start/end mapped residues.
*/
+ List<AlignedCodonFrame> mapping = Arrays.asList(new AlignedCodonFrame[] { acf });
SearchResults sr = buildSearchResults(selected,
- startResiduePos, Collections.singleton(acf));
+ startResiduePos, mapping);
for (Match m : sr.getResults())
{
mappedStartResidue = m.getStart();
mappedEndResidue = m.getEnd();
}
- sr = buildSearchResults(selected, endResiduePos,
- Collections.singleton(acf));
+ sr = buildSearchResults(selected, endResiduePos, mapping);
for (Match m : sr.getResults())
{
mappedStartResidue = Math.min(mappedStartResidue,
* @return
*/
public static CommandI mapOrderCommand(OrderCommand command,
- boolean undo, AlignmentI mapTo, Set<AlignedCodonFrame> mappings)
+ boolean undo, AlignmentI mapTo, List<AlignedCodonFrame> mappings)
{
SequenceI[] sortOrder = command.getSequenceOrder(undo);
List<SequenceI> mappedOrder = new ArrayList<SequenceI>();
{
boolean targetIsNucleotide = mapTo.isNucleotide();
AlignViewportI protein = targetIsNucleotide ? mapFrom : mapTo;
- Set<AlignedCodonFrame> codonFrames = protein.getAlignment()
+ List<AlignedCodonFrame> codonFrames = protein.getAlignment()
.getCodonFrames();
ColumnSelection mappedColumns = new ColumnSelection();
char fromGapChar = mapFrom.getAlignment().getGapCharacter();
- // FIXME allow for hidden columns
-
/*
* For each mapped column, find the range of columns that residues in that
* column map to.
* @param fromGapChar
*/
protected static void mapHiddenColumns(int[] hidden,
- Set<AlignedCodonFrame> mappings,
+ List<AlignedCodonFrame> mappings,
ColumnSelection mappedColumns, List<SequenceI> fromSequences,
List<SequenceI> toSequences, char fromGapChar)
{
* @param toSequences
* @param fromGapChar
*/
- protected static void mapColumn(int col, Set<AlignedCodonFrame> mappings,
+ protected static void mapColumn(int col,
+ List<AlignedCodonFrame> mappings,
ColumnSelection mappedColumns, List<SequenceI> fromSequences,
List<SequenceI> toSequences, char fromGapChar)
{
* @return
*/
protected static int[] findMappedColumns(int col,
- Set<AlignedCodonFrame> mappings, List<SequenceI> fromSequences,
+ List<AlignedCodonFrame> mappings, List<SequenceI> fromSequences,
List<SequenceI> toSequences, char fromGapChar)
{
int[] mappedTo = new int[] { Integer.MAX_VALUE, Integer.MIN_VALUE };
}
/**
- * Returns the mapped codon for a given aligned sequence column position (base
- * 0).
+ * Returns the mapped codon or codons for a given aligned sequence column
+ * position (base 0).
*
* @param seq
* an aligned peptide sequence
* an aligned column position (base 0)
* @param mappings
* a set of codon mappings
- * @return the bases of the mapped codon in the cDNA dataset sequence, or null
- * if not found
+ * @return the bases of the mapped codon(s) in the cDNA dataset sequence(s),
+ * or an empty list if none found
*/
- public static char[] findCodonFor(SequenceI seq, int col,
- Set<AlignedCodonFrame> mappings)
+ public static List<char[]> findCodonsFor(SequenceI seq, int col,
+ List<AlignedCodonFrame> mappings)
{
+ List<char[]> result = new ArrayList<char[]>();
int dsPos = seq.findPosition(col);
for (AlignedCodonFrame mapping : mappings)
{
if (mapping.involvesSequence(seq))
{
- return mapping.getMappedCodon(seq.getDatasetSequence(), dsPos);
+ List<char[]> codons = mapping.getMappedCodons(
+ seq.getDatasetSequence(), dsPos);
+ if (codons != null)
+ {
+ result.addAll(codons);
+ }
}
}
- return null;
+ return result;
}
/**
- * Converts a series of [start, end] ranges into an array of individual
- * positions.
+ * Converts a series of [start, end] range pairs into an array of individual
+ * positions. This also caters for 'reverse strand' (start > end) cases.
*
* @param ranges
* @return
int count = 0;
for (int i = 0; i < ranges.length - 1; i += 2)
{
- count += ranges[i + 1] - ranges[i] + 1;
+ count += Math.abs(ranges[i + 1] - ranges[i]) + 1;
}
int[] result = new int[count];
int k = 0;
for (int i = 0; i < ranges.length - 1; i += 2)
{
- for (int j = ranges[i]; j <= ranges[i + 1]; j++)
+ int from = ranges[i];
+ final int to = ranges[i + 1];
+ int step = from <= to ? 1 : -1;
+ do
{
- result[k++] = j;
- }
+ result[k++] = from;
+ from += step;
+ } while (from != to + step);
}
return result;
}
* @return
*/
public static List<AlignedCodonFrame> findMappingsForSequence(
- SequenceI sequence, Set<AlignedCodonFrame> mappings)
+ SequenceI sequence, List<AlignedCodonFrame> mappings)
{
List<AlignedCodonFrame> result = new ArrayList<AlignedCodonFrame>();
if (sequence == null || mappings == null)
}
return result;
}
+
+ /**
+ * Returns the total length of the supplied ranges
+ *
+ * @param ranges
+ * @return
+ */
+ public static int getLength(List<int[]> ranges)
+ {
+ if (ranges == null)
+ {
+ return 0;
+ }
+ int length = 0;
+ for (int[] range : ranges)
+ {
+ length += Math.abs(range[1] - range[0]) + 1;
+ }
+ return length;
+ }
+
+ /**
+ * Answers true if any range includes the given value
+ *
+ * @param ranges
+ * @param value
+ * @return
+ */
+ public static boolean contains(List<int[]> ranges, int value)
+ {
+ if (ranges == null)
+ {
+ return false;
+ }
+ for (int[] range : ranges)
+ {
+ if (range[1] >= range[0] && value >= range[0] && value <= range[1])
+ {
+ /*
+ * value within ascending range
+ */
+ return true;
+ }
+ if (range[1] < range[0] && value <= range[0] && value >= range[1])
+ {
+ /*
+ * value within descending range
+ */
+ return true;
+ }
+ }
+ return false;
+ }
}
}
return "" + separator;
}
+
+ /**
+ * Converts a list to a string with a delimiter before each term except the
+ * first. Returns an empty string given a null or zero-length argument. This
+ * can be replaced with StringJoiner in Java 8.
+ *
+ * @param terms
+ * @param delim
+ * @return
+ */
+ public static String listToDelimitedString(List<String> terms,
+ String delim)
+ {
+ StringBuilder sb = new StringBuilder(32);
+ if (terms != null && !terms.isEmpty())
+ {
+ boolean appended = false;
+ for (String term : terms)
+ {
+ if (appended)
+ {
+ sb.append(delim);
+ }
+ appended = true;
+ sb.append(term);
+ }
+ }
+ return sb.toString();
+ }
+
+ /**
+ * Convenience method to parse a string to an integer, returning 0 if the
+ * input is null or not a valid integer
+ *
+ * @param s
+ * @return
+ */
+ public static int parseInt(String s)
+ {
+ int result = 0;
+ if (s != null && s.length() > 0)
+ {
+ try
+ {
+ result = Integer.parseInt(s);
+ } catch (NumberFormatException ex)
+ {
+ }
+ }
+ return result;
+ }
}
import jalview.structure.StructureSelectionManager;
import jalview.structure.VamsasSource;
import jalview.util.Comparison;
+import jalview.util.MapList;
import jalview.util.MappingUtils;
import jalview.viewmodel.styles.ViewStyle;
import jalview.workers.AlignCalcManager;
import java.util.Hashtable;
import java.util.List;
import java.util.Map;
-import java.util.Set;
/**
* base class holding visualization and analysis attributes and common logic for
/*
* A separate thread to compute cDNA consensus for a protein alignment
+ * which has mapping to cDNA
*/
final AlignmentI al = this.getAlignment();
if (!al.isNucleotide() && al.getCodonFrames() != null
&& !al.getCodonFrames().isEmpty())
{
- if (calculator
- .getRegisteredWorkersOfClass(ComplementConsensusThread.class) == null)
+ /*
+ * fudge - check first mapping is protein-to-nucleotide
+ * (we don't want to do this for protein-to-protein)
+ */
+ AlignedCodonFrame mapping = al.getCodonFrames().iterator().next();
+ // TODO hold mapping type e.g. dna-to-protein in AlignedCodonFrame?
+ MapList[] mapLists = mapping.getdnaToProt();
+ // mapLists can be empty if project load has not finished resolving seqs
+ if (mapLists.length > 0 && mapLists[0].getFromRatio() == 3)
{
- calculator.registerWorker(new ComplementConsensusThread(this, ap));
+ if (calculator
+ .getRegisteredWorkersOfClass(ComplementConsensusThread.class) == null)
+ {
+ calculator
+ .registerWorker(new ComplementConsensusThread(this, ap));
+ }
}
}
}
if (hiddenRepSequences == null)
{
- hiddenRepSequences = new Hashtable();
+ hiddenRepSequences = new Hashtable<SequenceI, SequenceCollectionI>();
}
hiddenRepSequences.put(repSequence, sg);
{
if (!alignment.isNucleotide())
{
- final Set<AlignedCodonFrame> codonMappings = alignment
+ final List<AlignedCodonFrame> codonMappings = alignment
.getCodonFrames();
if (codonMappings != null && !codonMappings.isEmpty())
{
- complementConsensus = new AlignmentAnnotation("cDNA Consensus",
- "PID for cDNA", new Annotation[1], 0f, 100f,
- AlignmentAnnotation.BAR_GRAPH);
- initConsensus(complementConsensus);
+ // fudge: check mappings are not protein-to-protein
+ // TODO: nicer
+ AlignedCodonFrame mapping = codonMappings.iterator().next();
+ MapList[] mapLists = mapping.getdnaToProt();
+ // mapLists can be empty if project load has not finished resolving seqs
+ if (mapLists.length > 0 && mapLists[0].getFromRatio() == 3)
+ {
+ complementConsensus = new AlignmentAnnotation("cDNA Consensus",
+ "PID for cDNA", new Annotation[1], 0f, 100f,
+ AlignmentAnnotation.BAR_GRAPH);
+ initConsensus(complementConsensus);
+ }
}
}
}
public boolean areFeaturesDisplayed()
{
return featuresDisplayed != null
- && featuresDisplayed.getRegisterdFeaturesCount() > 0;
+ && featuresDisplayed.getRegisteredFeaturesCount() > 0;
}
/**
{
return 0;
}
- final Set<AlignedCodonFrame> mappings = proteinAlignment
+ final List<AlignedCodonFrame> mappings = proteinAlignment
.getCodonFrames();
/*
package jalview.viewmodel.seqfeatures;
import jalview.api.AlignViewportI;
+import jalview.api.FeatureColourI;
import jalview.api.FeaturesDisplayedI;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.SequenceFeature;
import java.beans.PropertyChangeSupport;
import java.util.ArrayList;
import java.util.Arrays;
+import java.util.HashMap;
import java.util.Hashtable;
import java.util.Iterator;
import java.util.List;
protected Object currentColour;
+ /*
+ * feature types in ordering of rendering, where last means on top
+ */
protected String[] renderOrder;
protected PropertyChangeSupport changeSupport = new PropertyChangeSupport(
protected AlignmentViewport av;
+ @Override
public AlignViewportI getViewport()
{
return av;
* @param featureType
* @return java.awt.Color or GraduatedColor
*/
+ @Override
public Object getFeatureStyle(String featureType)
{
Object fc = featureColours.get(featureType);
return av.getFeaturesDisplayed().isVisible(type);
}
+ @Override
public void setColour(String featureType, Object col)
{
// overwrite
// Object c = featureColours.get(featureType);
// if (c == null || c instanceof Color || (c instanceof GraduatedColor &&
// !((GraduatedColor)c).getMaxColor().equals(_col)))
+ if (col instanceof FeatureColourI)
{
- featureColours.put(featureType, col);
+ if (((FeatureColourI) col).isGraduatedColour())
+ {
+ col = new GraduatedColor((FeatureColourI) col);
+ }
+ else
+ {
+ col = ((FeatureColourI) col).getColour();
+ }
}
+ featureColours.put(featureType, col);
}
public void setTransparency(float value)
*
* @param data
* { String(Type), Colour(Type), Boolean(Displayed) }
+ * @return true if any visible features have been reordered, else false
*/
- public void setFeaturePriority(Object[][] data)
+ public boolean setFeaturePriority(Object[][] data)
{
- setFeaturePriority(data, true);
+ return setFeaturePriority(data, true);
}
/**
+ * Sets the priority order for features
*
* @param data
* { String(Type), Colour(Type), Boolean(Displayed) }
* @param visibleNew
* when true current featureDisplay list will be cleared
+ * @return true if any visible features have been reordered or recoloured,
+ * else false (i.e. no need to repaint)
*/
- public void setFeaturePriority(Object[][] data, boolean visibleNew)
+ public boolean setFeaturePriority(Object[][] data, boolean visibleNew)
{
+ /*
+ * note visible feature ordering and colours before update
+ */
+ List<String> visibleFeatures = getDisplayedFeatureTypes();
+ Map<String, Object> visibleColours = new HashMap<String, Object>(
+ getFeatureColours());
+
FeaturesDisplayedI av_featuresdisplayed = null;
if (visibleNew)
{
}
if (data == null)
{
- return;
+ return false;
}
// The feature table will display high priority
- // features at the top, but theses are the ones
+ // features at the top, but these are the ones
// we need to render last, so invert the data
renderOrder = new String[data.length];
}
}
+ /*
+ * get the new visible ordering and return true if it has changed
+ * order or any colour has changed
+ */
+ List<String> reorderedVisibleFeatures = getDisplayedFeatureTypes();
+ if (!visibleFeatures.equals(reorderedVisibleFeatures))
+ {
+ /*
+ * the list of ordered visible features has changed
+ */
+ return true;
+ }
+
+ /*
+ * return true if any feature colour has changed
+ */
+ for (String feature : visibleFeatures)
+ {
+ if (visibleColours.get(feature) != getFeatureStyle(feature))
+ {
+ return true;
+ }
+ }
+ return false;
}
/**
return av.getFeaturesDisplayed();
}
+ /**
+ * Returns a (possibly empty) list of visible feature types, in render order
+ * (last is on top)
+ */
@Override
- public String[] getDisplayedFeatureTypes()
+ public List<String> getDisplayedFeatureTypes()
{
- String[] typ = null;
- typ = getRenderOrder().toArray(new String[0]);
+ List<String> typ = getRenderOrder();
+ List<String> displayed = new ArrayList<String>();
FeaturesDisplayedI feature_disp = av.getFeaturesDisplayed();
if (feature_disp != null)
{
synchronized (feature_disp)
{
- for (int i = 0; i < typ.length; i++)
+ for (String type : typ)
{
- if (!feature_disp.isVisible(typ[i]))
+ if (feature_disp.isVisible(type))
{
- typ[i] = null;
+ displayed.add(type);
}
}
}
}
- return typ;
+ return displayed;
}
@Override
- public String[] getDisplayedFeatureGroups()
+ public List<String> getDisplayedFeatureGroups()
{
- String[] gps = null;
- ArrayList<String> _gps = new ArrayList<String>();
- Iterator en = getFeatureGroups().iterator();
- int g = 0;
+ List<String> _gps = new ArrayList<String>();
boolean valid = false;
- while (en.hasNext())
+ for (String gp : getFeatureGroups())
{
- String gp = (String) en.next();
if (checkGroupVisibility(gp, false))
{
valid = true;
}
else
{
- gps = new String[_gps.size()];
- _gps.toArray(gps);
+ // gps = new String[_gps.size()];
+ // _gps.toArray(gps);
}
}
- return gps;
+ return _gps;
}
}
}
@Override
- public boolean areVisible(Collection featureTypes)
+ public boolean areVisible(Collection<String> featureTypes)
{
return featuresDisplayed.containsAll(featureTypes);
}
}
@Override
- public void setAllVisible(Collection makeVisible)
+ public void setAllVisible(Collection<String> makeVisible)
{
featuresDisplayed.addAll(makeVisible);
featuresRegistered.addAll(makeVisible);
}
@Override
- public int getRegisterdFeaturesCount()
+ public int getRegisteredFeaturesCount()
{
return featuresRegistered.size();
}
import jalview.viewmodel.seqfeatures.FeatureRendererSettings;
import java.util.LinkedHashSet;
+import java.util.List;
import java.util.Set;
public abstract class AWSThread extends Thread
/**
* generic web service job/subjob poll loop
*/
+ @Override
public void run()
{
JobStateSummary jstate = null;
WsUrl = wsurl2;
if (alframe != null)
{
- Set<AlignedCodonFrame> cf = alframe.getViewport().getAlignment()
+ List<AlignedCodonFrame> cf = alframe.getViewport().getAlignment()
.getCodonFrames();
if (cf != null)
{
// TODO: introduce multithread multisource queries and logic to remove a
// query from other sources if any source for a database returns a
// record
- if (dbsource.getDbSourceProperties().containsKey(
- DBRefSource.MULTIACC))
- {
- maxqlen = ((Integer) dbsource.getDbSourceProperties().get(
- DBRefSource.MULTIACC)).intValue();
- }
- else
- {
- maxqlen = 1;
- }
+ maxqlen = dbsource.getMaximumQueryCount();
+
while (queries.size() > 0 || seqIndex < currSeqs.length)
{
if (queries.size() > 0)
*/
package jalview.ws;
-import jalview.datamodel.Alignment;
-import jalview.datamodel.AlignmentI;
-import jalview.datamodel.DBRefSource;
-import jalview.datamodel.SequenceI;
+import jalview.ext.ensembl.EnsemblGene;
+import jalview.ext.ensembl.EnsemblGenomes;
+import jalview.ws.dbsources.EmblCdsSource;
+import jalview.ws.dbsources.EmblSource;
+import jalview.ws.dbsources.Pdb;
+import jalview.ws.dbsources.PfamFull;
+import jalview.ws.dbsources.PfamSeed;
+import jalview.ws.dbsources.RfamFull;
+import jalview.ws.dbsources.RfamSeed;
+import jalview.ws.dbsources.Uniprot;
+import jalview.ws.dbsources.UniprotName;
import jalview.ws.dbsources.das.api.jalviewSourceI;
import jalview.ws.seqfetcher.ASequenceFetcher;
import jalview.ws.seqfetcher.DbSourceProxy;
import java.util.ArrayList;
-import java.util.Enumeration;
import java.util.List;
-import java.util.Vector;
/**
* This is the the concrete implementation of the sequence retrieval interface
* and abstract class in jalview.ws.seqfetcher. This implements the run-time
- * discovery of sequence database clients, and provides a hardwired main for
- * testing all registered handlers.
+ * discovery of sequence database clientss.
*
*/
public class SequenceFetcher extends ASequenceFetcher
public SequenceFetcher(boolean addDas)
{
- addDBRefSourceImpl(jalview.ws.dbsources.EmblSource.class);
- addDBRefSourceImpl(jalview.ws.dbsources.EmblCdsSouce.class);
- addDBRefSourceImpl(jalview.ws.dbsources.Uniprot.class);
- addDBRefSourceImpl(jalview.ws.dbsources.UnprotName.class);
- addDBRefSourceImpl(jalview.ws.dbsources.Pdb.class);
- addDBRefSourceImpl(jalview.ws.dbsources.PfamFull.class);
- addDBRefSourceImpl(jalview.ws.dbsources.PfamSeed.class);
+ addDBRefSourceImpl(EnsemblGene.class);
+ addDBRefSourceImpl(EnsemblGenomes.class);
+ addDBRefSourceImpl(EmblSource.class);
+ addDBRefSourceImpl(EmblCdsSource.class);
+ addDBRefSourceImpl(Uniprot.class);
+ addDBRefSourceImpl(UniprotName.class);
+ addDBRefSourceImpl(Pdb.class);
+ addDBRefSourceImpl(PfamFull.class);
+ addDBRefSourceImpl(PfamSeed.class);
// ensures Seed alignment is 'default' for PFAM
- addDBRefSourceImpl(jalview.ws.dbsources.RfamFull.class);
- addDBRefSourceImpl(jalview.ws.dbsources.RfamSeed.class);
+ addDBRefSourceImpl(RfamFull.class);
+ addDBRefSourceImpl(RfamSeed.class);
if (addDas)
{
registerDasSequenceSources();
{
// Skip the alignment databases for the moment - they're not useful for
// verifying a single sequence against its reference source
- if (dbs.isA(DBRefSource.ALIGNMENTDB))
+ if (dbs.isAlignmentSource())
{
skip = true;
}
}
/**
- * return plaintext databse list suitable for using in a GUI element
- */
- public String[] _getOrderedSupportedSources()
- {
- String[] srcs = this.getSupportedDb();
- ArrayList dassrc = new ArrayList(), nondas = new ArrayList();
- for (int i = 0; i < srcs.length; i++)
- {
- for (DbSourceProxy dbs : getSourceProxy(srcs[i]))
- {
- String nm = dbs.getDbName();
- if (getSourceProxy(srcs[i]) instanceof jalview.ws.dbsources.das.datamodel.DasSequenceSource)
- {
- if (nm.startsWith("das:"))
- {
- nm = nm.substring(4);
- }
- dassrc.add(new String[] { srcs[i], nm.toUpperCase() });
- }
- else
- {
- nondas.add(new String[] { srcs[i], nm.toUpperCase() });
- }
- }
- }
- Object[] sorted = nondas.toArray();
- String[] tosort = new String[sorted.length];
- nondas.clear();
- for (int j = 0; j < sorted.length; j++)
- {
- tosort[j] = ((String[]) sorted[j])[1];
- }
- jalview.util.QuickSort.sort(tosort, sorted);
- int i = 0;
- // construct array with all sources listed
- srcs = new String[sorted.length + dassrc.size()];
- for (int j = sorted.length - 1; j >= 0; j--, i++)
- {
- srcs[i] = ((String[]) sorted[j])[0];
- sorted[j] = null;
- }
-
- sorted = dassrc.toArray();
- tosort = new String[sorted.length];
- dassrc.clear();
- for (int j = 0; j < sorted.length; j++)
- {
- tosort[j] = ((String[]) sorted[j])[1];
- }
- jalview.util.QuickSort.sort(tosort, sorted);
- for (int j = sorted.length - 1; j >= 0; j--, i++)
- {
- srcs[i] = ((String[]) sorted[j])[0];
- sorted[j] = null;
- }
- return srcs;
- }
-
- /**
- * simple run method to test dbsources.
- *
- * @param argv
- */
- public static void main(String[] argv)
- {
- AlignmentI ds = null;
- Vector noProds = new Vector();
- String usage = "SequenceFetcher.main [-nodas] [<DBNAME> [<ACCNO>]]\n"
- + "With no arguments, all DbSources will be queried with their test Accession number.\n"
- + "With one argument, the argument will be resolved to one or more db sources and each will be queried with their test accession only.\n"
- + "If given two arguments, SequenceFetcher will try to find the DbFetcher corresponding to <DBNAME> and retrieve <ACCNO> from it.\n"
- + "The -nodas option will exclude DAS sources from the database fetchers Jalview will try to use.";
- boolean withDas = true;
- if (argv != null && argv.length > 0
- && argv[0].toLowerCase().startsWith("-nodas"))
- {
- withDas = false;
- String targs[] = new String[argv.length - 1];
- System.arraycopy(argv, 1, targs, 0, targs.length);
- argv = targs;
- }
- if (argv != null && argv.length > 0)
- {
- List<DbSourceProxy> sps = new SequenceFetcher(withDas)
- .getSourceProxy(argv[0]);
-
- if (sps != null)
- {
- for (DbSourceProxy sp : sps)
- {
- AlignmentI al = null;
- try
- {
- al = sp.getSequenceRecords(argv.length > 1 ? argv[1] : sp
- .getTestQuery());
- } catch (Exception e)
- {
- e.printStackTrace();
- System.err.println("Error when retrieving "
- + (argv.length > 1 ? argv[1] : sp.getTestQuery())
- + " from " + argv[0] + "\nUsage: " + usage);
- }
- SequenceI[] prod = al.getSequencesArray();
- if (al != null)
- {
- for (int p = 0; p < prod.length; p++)
- {
- System.out.println("Prod " + p + ": "
- + prod[p].getDisplayId(true) + " : "
- + prod[p].getDescription());
- }
- }
- }
- return;
- }
- else
- {
- System.err.println("Can't resolve " + argv[0]
- + " as a database name. Allowed values are :\n"
- + new SequenceFetcher().getSupportedDb());
- }
- System.out.println(usage);
- return;
- }
- ASequenceFetcher sfetcher = new SequenceFetcher(withDas);
- String[] dbSources = sfetcher.getSupportedDb();
- for (int dbsource = 0; dbsource < dbSources.length; dbsource++)
- {
- String db = dbSources[dbsource];
- // skip me
- if (db.equals(DBRefSource.PDB))
- {
- continue;
- }
- for (DbSourceProxy sp : sfetcher.getSourceProxy(db))
- {
- System.out.println("Source: " + sp.getDbName() + " (" + db
- + "): retrieving test:" + sp.getTestQuery());
- AlignmentI al = null;
- try
- {
- al = sp.getSequenceRecords(sp.getTestQuery());
- if (al != null && al.getHeight() > 0
- && sp.getDbSourceProperties() != null)
- {
- boolean dna = sp.getDbSourceProperties().containsKey(
- DBRefSource.DNACODINGSEQDB)
- || sp.getDbSourceProperties().containsKey(
- DBRefSource.DNASEQDB)
- || sp.getDbSourceProperties().containsKey(
- DBRefSource.CODINGSEQDB);
- // try and find products
- String types[] = jalview.analysis.CrossRef
- .findSequenceXrefTypes(dna, al.getSequencesArray());
- if (types != null)
- {
- System.out.println("Xref Types for: "
- + (dna ? "dna" : "prot"));
- for (int t = 0; t < types.length; t++)
- {
- System.out.println("Type: " + types[t]);
- SequenceI[] prod = jalview.analysis.CrossRef
- .findXrefSequences(al.getSequencesArray(), dna,
- types[t]).getSequencesArray();
- System.out.println("Found "
- + ((prod == null) ? "no" : "" + prod.length)
- + " products");
- if (prod != null)
- {
- for (int p = 0; p < prod.length; p++)
- {
- System.out.println("Prod " + p + ": "
- + prod[p].getDisplayId(true));
- }
- }
- }
- }
- else
- {
- noProds.addElement((dna ? new Object[] { al, al }
- : new Object[] { al }));
- }
-
- }
- } catch (Exception ex)
- {
- System.out.println("ERROR:Failed to retrieve test query.");
- ex.printStackTrace(System.out);
- }
-
- if (al == null)
- {
- System.out.println("ERROR:No alignment retrieved.");
- StringBuffer raw = sp.getRawRecords();
- if (raw != null)
- {
- System.out.println(raw.toString());
- }
- else
- {
- System.out.println("ERROR:No Raw results.");
- }
- }
- else
- {
- System.out.println("Retrieved " + al.getHeight() + " sequences.");
- for (int s = 0; s < al.getHeight(); s++)
- {
- SequenceI sq = al.getSequenceAt(s);
- while (sq.getDatasetSequence() != null)
- {
- sq = sq.getDatasetSequence();
-
- }
- if (ds == null)
- {
- ds = new Alignment(new SequenceI[] { sq });
-
- }
- else
- {
- ds.addSequence(sq);
- }
- }
- }
- System.out.flush();
- System.err.flush();
-
- }
- if (noProds.size() > 0)
- {
- Enumeration ts = noProds.elements();
- while (ts.hasMoreElements())
-
- {
- Object[] typeSq = (Object[]) ts.nextElement();
- boolean dna = (typeSq.length > 1);
- AlignmentI al = (AlignmentI) typeSq[0];
- System.out.println("Trying getProducts for "
- + al.getSequenceAt(0).getDisplayId(true));
- System.out.println("Search DS Xref for: "
- + (dna ? "dna" : "prot"));
- // have a bash at finding the products amongst all the retrieved
- // sequences.
- SequenceI[] seqs = al.getSequencesArray();
- Alignment prodal = jalview.analysis.CrossRef.findXrefSequences(
- seqs, dna, null, ds);
- System.out.println("Found "
- + ((prodal == null) ? "no" : "" + prodal.getHeight())
- + " products");
- if (prodal != null)
- {
- SequenceI[] prod = prodal.getSequencesArray(); // note
- // should
- // test
- // rather
- // than
- // throw
- // away
- // codon
- // mapping
- // (if
- // present)
- for (int p = 0; p < prod.length; p++)
- {
- System.out.println("Prod " + p + ": "
- + prod[p].getDisplayId(true));
- }
- }
- }
-
- }
-
- }
- }
-
- /**
* query the currently defined DAS source registry for sequence sources and
* add a DasSequenceSource instance for each source to the SequenceFetcher
* source list.
import jalview.datamodel.AlignmentI;
import jalview.datamodel.DBRefSource;
-import jalview.ws.seqfetcher.DbSourceProxy;
import com.stevesoft.pat.Regex;
-public class EmblCdsSouce extends EmblXmlSource implements DbSourceProxy
+public class EmblCdsSource extends EmblXmlSource
{
- public EmblCdsSouce()
+ public EmblCdsSource()
{
super();
- addDbSourceProperty(DBRefSource.CODINGSEQDB);
}
+ @Override
public String getAccessionSeparator()
{
return null;
}
+ @Override
public Regex getAccessionValidator()
{
- return new com.stevesoft.pat.Regex("^[A-Z]+[0-9]+");
+ return new Regex("^[A-Z]+[0-9]+");
}
+ @Override
public String getDbSource()
{
return DBRefSource.EMBLCDS;
}
+ @Override
public String getDbVersion()
{
return "0"; // TODO : this is dynamically set for a returned record - not
// tied to proxy
}
+ @Override
public AlignmentI getSequenceRecords(String queries) throws Exception
{
if (queries.indexOf(".") > -1)
return getEmblSequenceRecords(DBRefSource.EMBLCDS, queries);
}
+ @Override
public boolean isValidReference(String accession)
{
// most embl CDS refs look like ..
/**
* cDNA for LDHA_CHICK swissprot sequence
*/
+ @Override
public String getTestQuery()
{
return "CAA37824";
}
+ @Override
public String getDbName()
{
return "EMBL (CDS)";
import jalview.datamodel.AlignmentI;
import jalview.datamodel.DBRefSource;
-import jalview.ws.seqfetcher.DbSourceProxy;
import com.stevesoft.pat.Regex;
* @author JimP
*
*/
-public class EmblSource extends EmblXmlSource implements DbSourceProxy
+public class EmblSource extends EmblXmlSource
{
public EmblSource()
{
- addDbSourceProperty(DBRefSource.DNASEQDB);
- addDbSourceProperty(DBRefSource.CODINGSEQDB);
+ super();
}
/*
*
* @see jalview.ws.DbSourceProxy#getAccessionSeparator()
*/
+ @Override
public String getAccessionSeparator()
{
// TODO Auto-generated method stub
*
* @see jalview.ws.DbSourceProxy#getAccessionValidator()
*/
+ @Override
public Regex getAccessionValidator()
{
- return new com.stevesoft.pat.Regex("^[A-Z]+[0-9]+");
+ return new Regex("^[A-Z]+[0-9]+");
}
/*
*
* @see jalview.ws.DbSourceProxy#getDbSource()
*/
+ @Override
public String getDbSource()
{
return DBRefSource.EMBL;
*
* @see jalview.ws.DbSourceProxy#getDbVersion()
*/
+ @Override
public String getDbVersion()
{
// TODO Auto-generated method stub
*
* @see jalview.ws.DbSourceProxy#getSequenceRecords(java.lang.String[])
*/
+ @Override
public AlignmentI getSequenceRecords(String queries) throws Exception
{
return getEmblSequenceRecords(DBRefSource.EMBL, queries);
*
* @see jalview.ws.DbSourceProxy#isValidReference(java.lang.String)
*/
+ @Override
public boolean isValidReference(String accession)
{
// most embl refs look like ..
/**
* return LHD_CHICK coding gene
*/
+ @Override
public String getTestQuery()
{
return "X53828";
}
+ @Override
public String getDbName()
{
return "EMBL"; // getDbSource();
return al;
}
+ @Override
+ public boolean isDnaCoding()
+ {
+ return true;
+ }
+
}
import jalview.datamodel.AlignmentI;
import jalview.datamodel.DBRefSource;
-import jalview.ws.seqfetcher.DbSourceProxy;
import com.stevesoft.pat.Regex;
* @author JimP
*
*/
-public class GeneDbSource extends EmblXmlSource implements DbSourceProxy
+public class GeneDbSource extends EmblXmlSource
{
public GeneDbSource()
{
- addDbSourceProperty(DBRefSource.DNASEQDB);
- addDbSourceProperty(DBRefSource.CODINGSEQDB);
+ super();
}
/*
*
* @see jalview.ws.DbSourceProxy#getAccessionSeparator()
*/
+ @Override
public String getAccessionSeparator()
{
// TODO Auto-generated method stub
*
* @see jalview.ws.DbSourceProxy#getAccessionValidator()
*/
+ @Override
public Regex getAccessionValidator()
{
// TODO Auto-generated method stub
*
* @see jalview.ws.DbSourceProxy#getDbSource()
*/
+ @Override
public String getDbSource()
{
return DBRefSource.GENEDB;
*
* @see jalview.ws.DbSourceProxy#getDbVersion()
*/
+ @Override
public String getDbVersion()
{
// TODO Auto-generated method stub
*
* @see jalview.ws.DbSourceProxy#getSequenceRecords(java.lang.String[])
*/
+ @Override
public AlignmentI getSequenceRecords(String queries) throws Exception
{
// query of form
*
* @see jalview.ws.DbSourceProxy#isValidReference(java.lang.String)
*/
+ @Override
public boolean isValidReference(String accession)
{
// TODO Auto-generated method stub
/**
* return T.Brucei Mannosyl-Transferase TbPIG-M
*/
+ @Override
public String getTestQuery()
{
return "Tb927.6.3300";
}
+ @Override
public String getDbName()
{
return "GeneDB"; // getDbSource();
import jalview.io.FormatAdapter;
import jalview.util.MessageManager;
import jalview.ws.ebi.EBIFetchClient;
-import jalview.ws.seqfetcher.DbSourceProxy;
import java.util.ArrayList;
import java.util.List;
* @author JimP
*
*/
-public class Pdb extends EbiFileRetrievedProxy implements DbSourceProxy
+public class Pdb extends EbiFileRetrievedProxy
{
public Pdb()
{
super();
- addDbSourceProperty(DBRefSource.PROTSEQDB);
}
/*
*
* @see jalview.ws.DbSourceProxy#getAccessionSeparator()
*/
+ @Override
public String getAccessionSeparator()
{
// TODO Auto-generated method stub
*
* @see jalview.ws.DbSourceProxy#getAccessionValidator()
*/
+ @Override
public Regex getAccessionValidator()
{
return new Regex("([1-9][0-9A-Za-z]{3}):?([ _A-Za-z0-9]?)");
*
* @see jalview.ws.DbSourceProxy#getDbSource()
*/
+ @Override
public String getDbSource()
{
return DBRefSource.PDB;
*
* @see jalview.ws.DbSourceProxy#getDbVersion()
*/
+ @Override
public String getDbVersion()
{
return "0";
*
* @see jalview.ws.DbSourceProxy#getSequenceRecords(java.lang.String[])
*/
+ @Override
public AlignmentI getSequenceRecords(String queries) throws Exception
{
AlignmentI pdbAlignment = null;
*
* @see jalview.ws.DbSourceProxy#isValidReference(java.lang.String)
*/
+ @Override
public boolean isValidReference(String accession)
{
Regex r = getAccessionValidator();
/**
* obtain human glyoxalase chain A sequence
*/
+ @Override
public String getTestQuery()
{
return "1QIPA";
}
+ @Override
public String getDbName()
{
return "PDB"; // getDbSource();
import jalview.datamodel.AlignmentI;
import jalview.datamodel.DBRefEntry;
-import jalview.ws.seqfetcher.DbSourceProxy;
+import jalview.datamodel.DBRefSource;
+import jalview.io.FormatAdapter;
import com.stevesoft.pat.Regex;
* @author JimP
*
*/
-abstract public class Pfam extends Xfam implements DbSourceProxy
+abstract public class Pfam extends Xfam
{
public Pfam()
{
super();
- // all extensions of this PFAM source base class are DOMAINDB sources
- addDbSourceProperty(jalview.datamodel.DBRefSource.DOMAINDB);
- addDbSourceProperty(jalview.datamodel.DBRefSource.ALIGNMENTDB);
}
/*
*
* @see jalview.ws.DbSourceProxy#getAccessionSeparator()
*/
+ @Override
public String getAccessionSeparator()
{
// TODO Auto-generated method stub
*
* @see jalview.ws.DbSourceProxy#getAccessionValidator()
*/
+ @Override
public Regex getAccessionValidator()
{
// TODO Auto-generated method stub
*
* @see jalview.ws.DbSourceProxy#getSequenceRecords(java.lang.String[])
*/
+ @Override
public AlignmentI getSequenceRecords(String queries) throws Exception
{
// TODO: this is not a perfect implementation. We need to be able to add
// individual references to each sequence in each family alignment that's
// retrieved.
startQuery();
- AlignmentI rcds = new jalview.io.FormatAdapter().readFile(getXFAMURL()
+ AlignmentI rcds = new FormatAdapter().readFile(getXFAMURL()
+ queries.trim().toUpperCase(), jalview.io.FormatAdapter.URL,
"STH");
for (int s = 0, sNum = rcds.getHeight(); s < sNum; s++)
{
rcds.getSequenceAt(s).addDBRef(
- new DBRefEntry(jalview.datamodel.DBRefSource.PFAM,
+new DBRefEntry(DBRefSource.PFAM,
// getDbSource(),
getDbVersion(), queries.trim().toUpperCase()));
- if (!getDbSource().equals(jalview.datamodel.DBRefSource.PFAM))
+ if (!getDbSource().equals(DBRefSource.PFAM))
{ // add the specific ref too
rcds.getSequenceAt(s).addDBRef(
new DBRefEntry(getDbSource(), getDbVersion(), queries
*
* @see jalview.ws.DbSourceProxy#isValidReference(java.lang.String)
*/
+ @Override
public boolean isValidReference(String accession)
{
return accession.indexOf("PF") == 0;
* public String getDbName() { return "PFAM"; // getDbSource(); }
*/
+ @Override
public String getXfamSource()
{
- return jalview.datamodel.DBRefSource.PFAM;
+ return DBRefSource.PFAM;
}
}
*/
package jalview.ws.dbsources;
-import jalview.ws.seqfetcher.DbSourceProxy;
/**
* flyweight class specifying retrieval of Full family alignments from PFAM
*
*/
-public class PfamFull extends Pfam implements DbSourceProxy
+public class PfamFull extends Pfam
{
public PfamFull()
{
*
* @see jalview.ws.dbsources.Pfam#getPFAMURL()
*/
+ @Override
protected String getXFAMURL()
{
return "http://pfam.sanger.ac.uk/family/alignment/download/format?alnType=full&format=stockholm&order=t&case=l&gaps=default&entry=";
*
* @see jalview.ws.seqfetcher.DbSourceProxy#getDbName()
*/
+ @Override
public String getDbName()
{
return "PFAM (Full)";
}
+ @Override
public String getDbSource()
{
return getDbName(); // so we have unique DbSource string.
}
+ @Override
public String getTestQuery()
{
return "PF03760";
}
+ @Override
public String getDbVersion()
{
return null;
*/
package jalview.ws.dbsources;
-import jalview.ws.seqfetcher.DbSourceProxy;
/**
* flyweight class specifying retrieval of Seed alignments from PFAM
* @author JimP
*
*/
-public class PfamSeed extends Pfam implements DbSourceProxy
+public class PfamSeed extends Pfam
{
public PfamSeed()
{
*
* @see jalview.ws.dbsources.Pfam#getPFAMURL()
*/
+ @Override
protected String getXFAMURL()
{
return "http://pfam.sanger.ac.uk/family/alignment/download/format?alnType=seed&format=stockholm&order=t&case=l&gaps=default&entry=";
*
* @see jalview.ws.seqfetcher.DbSourceProxy#getDbName()
*/
+ @Override
public String getDbName()
{
return "PFAM (Seed)";
}
+ @Override
public String getDbSource()
{
return jalview.datamodel.DBRefSource.PFAM; // archetype source
}
+ @Override
public String getTestQuery()
{
return "PF03760";
*/
package jalview.ws.dbsources;
-import jalview.ws.seqfetcher.DbSourceProxy;
+import jalview.datamodel.DBRefSource;
import com.stevesoft.pat.Regex;
*
* @author Lauren Michelle Lui
*/
-abstract public class Rfam extends Xfam implements DbSourceProxy
+abstract public class Rfam extends Xfam
{
public Rfam()
{
super();
- // all extensions of this RFAM source base class are DOMAINDB sources
- addDbSourceProperty(jalview.datamodel.DBRefSource.DOMAINDB);
- addDbSourceProperty(jalview.datamodel.DBRefSource.ALIGNMENTDB);
}
/*
* @see jalview.ws.DbSourceProxy#getAccessionSeparator() Left here for
* consistency with Pfam class
*/
+ @Override
public String getAccessionSeparator()
{
// TODO Auto-generated method stub
*
* @see jalview.ws.DbSourceProxy#getAccessionValidator() * Left here for
*/
+ @Override
public Regex getAccessionValidator()
{
// TODO Auto-generated method stub
*
* @see jalview.ws.DbSourceProxy#isValidReference(java.lang.String)
*/
+ @Override
public boolean isValidReference(String accession)
{
return accession.indexOf("RF") == 0;
*
* @see jalview.ws.dbsources.Xfam#getXfamSource()
*/
+ @Override
public String getXfamSource()
{
- return jalview.datamodel.DBRefSource.RFAM;
+ return DBRefSource.RFAM;
}
}
*/
package jalview.ws.dbsources;
-import jalview.ws.seqfetcher.DbSourceProxy;
/**
* Flyweight class specifying retrieval of Full family alignments from RFAM
* @author Lauren Michelle Lui
*
*/
-public class RfamFull extends Rfam implements DbSourceProxy
+public class RfamFull extends Rfam
{
public RfamFull()
{
*
* @see jalview.ws.dbsources.Rfam#getXFAMURL()
*/
+ @Override
protected String getXFAMURL()
{
return "http://rfam.sanger.ac.uk/family/alignment/download/format?alnType=full&nseLabels=0&format=stockholm&acc=";
*
* @see jalview.ws.seqfetcher.DbSourceProxy#getDbName()
*/
+ @Override
public String getDbName()
{
return "RFAM (Full)";
}
+ @Override
public String getDbSource()
{
return getDbName(); // so we have unique DbSource string.
}
+ @Override
public String getTestQuery()
{
// Can be retrieved from http://rfam.janelia.org/cgi-bin/getdesc?acc=RF00014
return "RF00014";
}
+ @Override
public String getDbVersion()
{
return null;
*/
package jalview.ws.dbsources;
-import jalview.ws.seqfetcher.DbSourceProxy;
/**
* Flyweight class specifying retrieval of Seed family alignments from RFAM
* @author Lauren Michelle Lui
*
*/
-public class RfamSeed extends Rfam implements DbSourceProxy
+public class RfamSeed extends Rfam
{
public RfamSeed()
{
*
* @see jalview.ws.dbsources.Rfam#getRFAMURL()
*/
+ @Override
protected String getXFAMURL()
{
return "http://rfam.sanger.ac.uk/family/alignment/download/format?alnType=seed&nseLabels=0&format=stockholm&acc=";
*
* @see jalview.ws.seqfetcher.DbSourceProxy#getDbName()
*/
+ @Override
public String getDbName()
{
return "RFAM (Seed)";
}
+ @Override
public String getDbSource()
{
return getDbName(); // so we have unique DbSource string.
}
+ @Override
public String getTestQuery()
{
return "RF00014";
} // http://rfam.janelia.org/cgi-bin/getdesc?acc=RF00014
+ @Override
public String getDbVersion()
{
return null;
import jalview.datamodel.UniprotEntry;
import jalview.datamodel.UniprotFile;
import jalview.ws.ebi.EBIFetchClient;
-import jalview.ws.seqfetcher.DbSourceProxy;
import jalview.ws.seqfetcher.DbSourceProxyImpl;
import java.io.File;
import java.io.FileReader;
import java.io.Reader;
+import java.net.URL;
import java.util.ArrayList;
import java.util.Vector;
+import org.exolab.castor.mapping.Mapping;
import org.exolab.castor.xml.Unmarshaller;
import com.stevesoft.pat.Regex;
* @author JimP
*
*/
-public class Uniprot extends DbSourceProxyImpl implements DbSourceProxy
+public class Uniprot extends DbSourceProxyImpl
{
-
private static final String BAR_DELIMITER = "|";
- private static org.exolab.castor.mapping.Mapping map;
+ /*
+ * Castor mapping loaded from uniprot_mapping.xml
+ */
+ private static Mapping map;
/**
* Constructor
public Uniprot()
{
super();
- addDbSourceProperty(DBRefSource.SEQDB, DBRefSource.SEQDB);
- addDbSourceProperty(DBRefSource.PROTSEQDB);
}
/*
if (map == null)
{
// 1. Load the mapping information from the file
- map = new org.exolab.castor.mapping.Mapping(uni.getClass()
- .getClassLoader());
- java.net.URL url = getClass().getResource("/uniprot_mapping.xml");
+ map = new Mapping(uni.getClass().getClassLoader());
+ URL url = getClass().getResource("/uniprot_mapping.xml");
map.loadMapping(url);
}
StringBuilder desc = new StringBuilder(32);
if (entry.getProtein() != null && entry.getProtein().getName() != null)
{
+ boolean first = true;
for (String nm : entry.getProtein().getName())
{
- desc.append(nm).append(" ");
+ if (!first)
+ {
+ desc.append(" ");
+ }
+ first = false;
+ desc.append(nm);
}
}
return desc.toString();
public static String getUniprotEntryId(UniprotEntry entry)
{
StringBuilder name = new StringBuilder(32);
- name.append("UniProt/Swiss-Prot");
+ // name.append("UniProt/Swiss-Prot");
+ // use 'canonicalised' name for optimal id matching
+ name.append(DBRefSource.UNIPROT);
for (String accessionId : entry.getAccession())
{
name.append(BAR_DELIMITER);
*/
package jalview.ws.dbsources;
+import jalview.datamodel.DBRefSource;
+
/**
* Canonical Uniprot fetcher instance specifically retrieving UP_NAME
* references.
* @author JimP
*
*/
-public class UnprotName extends Uniprot implements
- jalview.ws.seqfetcher.DbSourceProxy
+public class UniprotName extends Uniprot
{
/*
*
* @see jalview.ws.dbsources.Uniprot#getDbSource()
*/
+ @Override
public String getDbSource()
{
- return jalview.datamodel.DBRefSource.UP_NAME;
+ return DBRefSource.UP_NAME;
}
}
import jalview.datamodel.AlignmentI;
import jalview.datamodel.DBRefEntry;
+import jalview.io.FormatAdapter;
import jalview.ws.seqfetcher.DbSourceProxyImpl;
/**
protected abstract String getXFAMURL();
+ @Override
public abstract String getDbVersion();
abstract String getXfamSource();
+ @Override
public AlignmentI getSequenceRecords(String queries) throws Exception
{
// TODO: this is not a perfect implementation. We need to be able to add
// retrieved.
startQuery();
// TODO: trap HTTP 404 exceptions and return null
- AlignmentI rcds = new jalview.io.FormatAdapter().readFile(getXFAMURL()
- + queries.trim().toUpperCase(), jalview.io.FormatAdapter.URL,
- "STH");
+ AlignmentI rcds = new FormatAdapter().readFile(getXFAMURL()
+ + queries.trim().toUpperCase(), FormatAdapter.URL, "STH");
for (int s = 0, sNum = rcds.getHeight(); s < sNum; s++)
{
rcds.getSequenceAt(s).addDBRef(new DBRefEntry(getXfamSource(),
return rcds;
}
+ /**
+ * Pfam and Rfam provide alignments
+ */
+ @Override
+ public boolean isAlignmentSource()
+ {
+ return true;
+ }
+
}
jalview.bin.Cache.log.debug("Getting associated alignment.");
// we ignore the returned alignment if we only predicted on a single
// sequence
- String format = new jalview.io.IdentifyFile().Identify(
+ String format = new jalview.io.IdentifyFile().identify(
result.getAligfile(), "Paste");
if (jalview.io.FormatAdapter.isValidFormat(format))
*
* @return true if getAlignment will return a valid alignment result.
*/
+ @Override
public boolean hasResults()
{
if (subjobComplete
*
* @return null or { Alignment(+features and annotation), NewickFile)}
*/
- public Object[] getAlignment(Alignment dataset, Map featureColours)
+ public Object[] getAlignment(Alignment dataset,
+ Map<String, Object> featureColours)
{
if (result != null && result.isFinished())
*
* @return boolean true if job can be submitted.
*/
+ @Override
public boolean hasValidInput()
{
if (seqs.getSeqs() != null)
}
}
+ @Override
public boolean isCancellable()
{
return true;
}
+ @Override
public void cancelJob()
{
if (!jobComplete && jobs != null)
}
}
+ @Override
public void pollJob(AWsJob job) throws Exception
{
((SeqSearchWSJob) job).result = server.getResult(((SeqSearchWSJob) job)
.getJobId());
}
+ @Override
public void StartJob(AWsJob job)
{
if (!(job instanceof SeqSearchWSJob))
return msa;
}
+ @Override
public void parseResult()
{
int results = 0; // number of result sets received
wsInfo.showResultsNewFrame
.addActionListener(new java.awt.event.ActionListener()
{
+ @Override
public void actionPerformed(java.awt.event.ActionEvent evt)
{
displayResults(true);
wsInfo.mergeResults
.addActionListener(new java.awt.event.ActionListener()
{
+ @Override
public void actionPerformed(java.awt.event.ActionEvent evt)
{
displayResults(false);
// NewickFile nf[] = new NewickFile[jobs.length];
for (int j = 0; j < jobs.length; j++)
{
- Map featureColours = new HashMap();
+ Map<String, Object> featureColours = new HashMap<String, Object>();
Alignment al = null;
NewickFile nf = null;
if (jobs[j].hasResults())
}
}
+ @Override
public boolean canMergeResults()
{
return false;
*/
package jalview.ws.seqfetcher;
+import jalview.bin.Cache;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.DBRefEntry;
import jalview.datamodel.SequenceI;
import jalview.util.MessageManager;
import java.util.ArrayList;
+import java.util.Collections;
+import java.util.Comparator;
import java.util.Enumeration;
import java.util.HashSet;
import java.util.Hashtable;
-import java.util.Iterator;
import java.util.List;
import java.util.Map;
import java.util.Stack;
public class ASequenceFetcher
{
- /**
+ /*
* set of databases we can retrieve entries from
*/
- protected Hashtable<String, Map<String, DbSourceProxy>> FETCHABLEDBS;
+ protected Hashtable<String, Map<String, DbSourceProxy>> fetchableDbs;
+
+ /*
+ * comparator to sort by tier (0/1/2) and name
+ */
+ private Comparator<DbSourceProxy> proxyComparator;
+ /**
+ * Constructor
+ */
public ASequenceFetcher()
{
super();
+
+ /*
+ * comparator to sort proxies by tier and name
+ */
+ proxyComparator = new Comparator<DbSourceProxy>()
+ {
+ @Override
+ public int compare(DbSourceProxy o1, DbSourceProxy o2)
+ {
+ /*
+ * Tier 0 precedes 1 precedes 2
+ */
+ int compared = Integer.compare(o1.getTier(), o2.getTier());
+ if (compared == 0)
+ {
+ // defend against NullPointer - should never happen
+ String o1Name = o1.getDbName();
+ String o2Name = o2.getDbName();
+ if (o1Name != null && o2Name != null)
+ {
+ compared = o1Name.compareToIgnoreCase(o2Name);
+ }
+ }
+ return compared;
+ }
+ };
}
/**
- * get list of supported Databases
+ * get array of supported Databases
*
* @return database source string for each database - only the latest version
* of a source db is bound to each source.
*/
public String[] getSupportedDb()
{
- if (FETCHABLEDBS == null)
+ if (fetchableDbs == null)
{
return null;
}
- String[] sf = new String[FETCHABLEDBS.size()];
- Enumeration e = FETCHABLEDBS.keys();
- int i = 0;
- while (e.hasMoreElements())
- {
- sf[i++] = (String) e.nextElement();
- }
- ;
+ String[] sf = fetchableDbs.keySet().toArray(
+ new String[fetchableDbs.size()]);
return sf;
}
public boolean isFetchable(String source)
{
- Enumeration e = FETCHABLEDBS.keys();
- while (e.hasMoreElements())
+ for (String db : fetchableDbs.keySet())
{
- String db = (String) e.nextElement();
- if (source.compareToIgnoreCase(db) == 0)
+ if (source.equalsIgnoreCase(db))
{
return true;
}
}
- jalview.bin.Cache.log.warn("isFetchable doesn't know about '" + source
+ Cache.log.warn("isFetchable doesn't know about '" + source
+ "'");
return false;
}
- public SequenceI[] getSequences(jalview.datamodel.DBRefEntry[] refs)
+ /**
+ * Fetch sequences for the given cross-references
+ *
+ * @param refs
+ * @param dna
+ * if true, only fetch from nucleotide data sources, else peptide
+ * @return
+ */
+ public SequenceI[] getSequences(DBRefEntry[] refs, boolean dna)
{
- SequenceI[] ret = null;
- Vector<SequenceI> rseqs = new Vector();
- Hashtable<String, List<String>> queries = new Hashtable();
+ Vector<SequenceI> rseqs = new Vector<SequenceI>();
+ Hashtable<String, List<String>> queries = new Hashtable<String, List<String>>();
for (int r = 0; r < refs.length; r++)
{
if (!queries.containsKey(refs[r].getSource()))
"Don't know how to fetch from this database :" + db));
continue;
}
- Iterator<DbSourceProxy> fetchers = getSourceProxy(db).iterator();
+
Stack<String> queriesLeft = new Stack<String>();
- // List<String> queriesFailed = new ArrayList<String>();
queriesLeft.addAll(query);
- while (fetchers.hasNext())
+
+ List<DbSourceProxy> proxies = getSourceProxy(db);
+ for (DbSourceProxy fetcher : proxies)
{
List<String> queriesMade = new ArrayList<String>();
- HashSet queriesFound = new HashSet<String>();
+ HashSet<String> queriesFound = new HashSet<String>();
try
{
- DbSourceProxy fetcher = fetchers.next();
- boolean doMultiple = fetcher.getAccessionSeparator() != null; // No
- // separator
- // - no
- // Multiple
- // Queries
+ if (fetcher.isDnaCoding() != dna)
+ {
+ continue; // wrong sort of data
+ }
+ boolean doMultiple = fetcher.getMaximumQueryCount() > 1;
while (!queriesLeft.isEmpty())
{
StringBuffer qsb = new StringBuffer();
try
{
// create a fetcher and go to it
- seqset = fetcher.getSequenceRecords(qsb.toString()); // ,
- // queriesFailed);
+ seqset = fetcher.getSequenceRecords(qsb.toString());
} catch (Exception ex)
{
System.err.println("Failed to retrieve the following from "
{
System.out.println("# Adding " + queriesMade.size()
+ " ids back to queries list for searching again (" + db
- + ".");
+ + ")");
queriesLeft.addAll(queriesMade);
}
}
}
+
+ SequenceI[] result = null;
if (rseqs.size() > 0)
{
- ret = new SequenceI[rseqs.size()];
- Enumeration sqs = rseqs.elements();
+ result = new SequenceI[rseqs.size()];
int si = 0;
- while (sqs.hasMoreElements())
+ for (SequenceI s : rseqs)
{
- SequenceI s = (SequenceI) sqs.nextElement();
- ret[si++] = s;
+ result[si++] = s;
s.updatePDBIds();
}
}
- return ret;
+ return result;
}
public void reportStdError(String db, List<String> queriesMade,
}
/**
- * Retrieve an instance of the proxy for the given source
+ * Returns a list of proxies for the given source
*
* @param db
* database source string TODO: add version string/wildcard for
* retrieval of specific DB source/version combinations.
- * @return an instance of DbSourceProxy for that db.
+ * @return a list of DbSourceProxy for the db
*/
public List<DbSourceProxy> getSourceProxy(String db)
{
- List<DbSourceProxy> dbs;
- Map<String, DbSourceProxy> dblist = FETCHABLEDBS.get(db);
+ db = DBRefUtils.getCanonicalName(db);
+ Map<String, DbSourceProxy> dblist = fetchableDbs.get(db);
if (dblist == null)
{
return new ArrayList<DbSourceProxy>();
}
- ;
- if (dblist.size() > 1)
- {
- DbSourceProxy[] l = dblist.values().toArray(new DbSourceProxy[0]);
- int i = 0;
- String[] nm = new String[l.length];
- // make sure standard dbs appear first, followed by reference das sources,
- // followed by anything else.
- for (DbSourceProxy s : l)
- {
- nm[i++] = "" + s.getTier() + s.getDbName().toLowerCase();
- }
- jalview.util.QuickSort.sort(nm, l);
- dbs = new ArrayList<DbSourceProxy>();
- for (i = l.length - 1; i >= 0; i--)
- {
- dbs.add(l[i]);
- }
- }
- else
- {
- dbs = new ArrayList<DbSourceProxy>(dblist.values());
- }
+
+ /*
+ * sort so that primary sources precede secondary
+ */
+ List<DbSourceProxy> dbs = new ArrayList<DbSourceProxy>(dblist.values());
+ Collections.sort(dbs, proxyComparator);
return dbs;
}
/**
- * constructs and instance of the proxy and registers it as a valid
- * dbrefsource
+ * constructs an instance of the proxy and registers it as a valid dbrefsource
*
* @param dbSourceProxy
* reference for class implementing
*/
protected void addDBRefSourceImpl(
Class<? extends DbSourceProxy> dbSourceProxy)
- throws java.lang.IllegalArgumentException
+ throws IllegalArgumentException
{
DbSourceProxy proxy = null;
try
{
if (proxy != null)
{
- if (FETCHABLEDBS == null)
+ if (fetchableDbs == null)
{
- FETCHABLEDBS = new Hashtable<String, Map<String, DbSourceProxy>>();
+ fetchableDbs = new Hashtable<String, Map<String, DbSourceProxy>>();
}
- Map<String, DbSourceProxy> slist = FETCHABLEDBS.get(proxy
+ Map<String, DbSourceProxy> slist = fetchableDbs.get(proxy
.getDbSource());
if (slist == null)
{
- FETCHABLEDBS.put(proxy.getDbSource(),
+ fetchableDbs.put(proxy.getDbSource(),
slist = new Hashtable<String, DbSourceProxy>());
}
slist.put(proxy.getDbName(), proxy);
}
/**
- * test if the database handler for dbName contains the given dbProperty when
- * a dbName resolves to a set of proxies - this method will return the result
- * of the test for the first instance. TODO implement additional method to
- * query all sources for a db to find one with a particular property
- *
- * @param dbName
- * @param dbProperty
- * @return true if proxy has the given property
- */
- public boolean hasDbSourceProperty(String dbName, String dbProperty)
- {
- // TODO: decide if invalidDbName exception is thrown here.
-
- List<DbSourceProxy> proxies = getSourceProxy(dbName);
- if (proxies != null)
- {
- for (DbSourceProxy proxy : proxies)
- {
- if (proxy.getDbSourceProperties() != null)
- {
- return proxy.getDbSourceProperties().containsKey(dbProperty);
- }
- }
- }
- return false;
- }
-
- /**
* select sources which are implemented by instances of the given class
*
* @param class that implements DbSourceProxy
*/
public String[] getDbInstances(Class class1)
{
- if (!jalview.ws.seqfetcher.DbSourceProxy.class.isAssignableFrom(class1))
+ if (!DbSourceProxy.class.isAssignableFrom(class1))
{
throw new Error(
MessageManager
"error.implementation_error_dbinstance_must_implement_interface",
new String[] { class1.toString() }));
}
- if (FETCHABLEDBS == null)
+ if (fetchableDbs == null)
{
return null;
}
String[] sources = null;
- Vector src = new Vector();
- Enumeration dbs = FETCHABLEDBS.keys();
+ Vector<String> src = new Vector<String>();
+ Enumeration<String> dbs = fetchableDbs.keys();
while (dbs.hasMoreElements())
{
- String dbn = (String) dbs.nextElement();
- for (DbSourceProxy dbp : FETCHABLEDBS.get(dbn).values())
+ String dbn = dbs.nextElement();
+ for (DbSourceProxy dbp : fetchableDbs.get(dbn).values())
{
if (class1.isAssignableFrom(dbp.getClass()))
{
public DbSourceProxy[] getDbSourceProxyInstances(Class class1)
{
- ArrayList<DbSourceProxy> prlist = new ArrayList<DbSourceProxy>();
+ List<DbSourceProxy> prlist = new ArrayList<DbSourceProxy>();
for (String fetchable : getSupportedDb())
{
for (DbSourceProxy pr : getSourceProxy(fetchable))
*/
package jalview.ws.seqfetcher;
+import jalview.api.FeatureSettingsI;
import jalview.datamodel.AlignmentI;
-import java.util.Hashtable;
-
import com.stevesoft.pat.Regex;
/**
* generic Reference Retrieval interface for a particular database
- * source/version as cited in DBRefEntry. TODO: add/define property to describe
- * max number of queries that this source can cope with at once. TODO:
- * add/define mechanism for retrieval of Trees and distance matrices from a
- * database (unify with io)
+ * source/version as cited in DBRefEntry.
+ *
+ * TODO: add/define mechanism for retrieval of Trees and distance matrices from
+ * a database (unify with io)
*
- * @author JimP TODO: promote to API
+ * @author JimP
*/
public interface DbSourceProxy
{
*
* @return source string constant used for this DB source
*/
- public String getDbSource();
+ String getDbSource();
/**
* Short meaningful name for this data source for display in menus or
*
* @return String
*/
- public String getDbName();
+ String getDbName();
/**
*
* @return version string for this database.
*/
- public String getDbVersion();
+ String getDbVersion();
/**
* Separator between individual accession queries for a database that allows
* @return string for separating concatenated queries (as individually
* validated by the accession validator)
*/
- public String getAccessionSeparator();
+ String getAccessionSeparator();
/**
* Regular expression for checking form of query string understood by this
*
* @return null or a validation regex
*/
- public Regex getAccessionValidator();
-
- /**
- * DbSource properties hash - define the capabilities of this source Property
- * hash methods defined in DbSourceProxyImpl. See constants in
- * jalview.datamodel.DBRefSource for definition of properties.
- *
- * @return
- */
- public Hashtable getDbSourceProperties();
+ Regex getAccessionValidator();
/**
*
* @return a test/example query that can be used to validate retrieval and
* parsing mechanisms
*/
- public String getTestQuery();
+ String getTestQuery();
/**
- * optionally implemented
+ * Required for sources supporting multiple query retrieval for use with the
+ * DBRefFetcher, which attempts to limit its queries with putative accession
+ * strings for a source to only those that are likely to be valid.
*
* @param accession
* @return
*/
- public boolean isValidReference(String accession);
+ boolean isValidReference(String accession);
/**
* make one or more queries to the database and attempt to parse the response
*
* @param queries
* - one or more queries for database in expected form
- * @return null if queries were successful but result was not parsable
+ * @return null if queries were successful but result was not parsable.
+ * Otherwise, an AlignmentI object containing properly annotated data
+ * (e.g. sequences with accessions for this datasource)
* @throws Exception
* - propagated from underlying transport to database (note -
* exceptions are not raised if query not found in database)
*
*/
- public AlignmentI getSequenceRecords(String queries) throws Exception;
+ AlignmentI getSequenceRecords(String queries) throws Exception;
/**
*
* @return true if a query is currently being made
*/
- public boolean queryInProgress();
+ boolean queryInProgress();
/**
* get the raw reponse from the last set of queries
*
* @return one or more string buffers for each individual query
*/
- public StringBuffer getRawRecords();
+ StringBuffer getRawRecords();
/**
- * Find out more info about the source.
+ * Tier for this data source
*
- * @param dbsourceproperty
- * - one of the database reference source properties in
- * jalview.datamodel.DBRefSource
- * @return true if the source has this property
+ * @return 0 - primary datasource, 1 - das primary source, 2 - secondary
*/
- public boolean isA(Object dbsourceproperty);
+ int getTier();
/**
- * Tier for this data source
+ * Extracts valid accession strings from a query string. If there is an
+ * accession id validator, returns the the matched region or the first
+ * subgroup match from the matched region; else just returns the whole query.
*
- * @return 0 - primary datasource, 1 - das primary source, 2 - secondary
+ * @param query
+ * @return
+ */
+ String getAccessionIdFromQuery(String query);
+
+ /**
+ * Returns the maximum number of accession ids that can be queried in one
+ * request.
+ *
+ * @return
+ */
+ int getMaximumQueryCount();
+
+ /**
+ * Returns true if the source may provide coding DNA i.e. sequences with
+ * implicit peptide products
+ *
+ * @return
+ */
+ boolean isDnaCoding();
+
+ /**
+ * Answers true if the database is a source of alignments (for example, domain
+ * families)
+ *
+ * @return
+ */
+ boolean isAlignmentSource();
+
+ /**
+ * Returns an (optional) description of the source, suitable for display as a
+ * tooltip, or null
+ *
+ * @return
+ */
+ String getDescription();
+
+ /**
+ * Returns the preferred feature colour configuration if there is one, else
+ * null
+ *
+ * @return
*/
- public int getTier();
-}
+ FeatureSettingsI getFeatureColourScheme();
+}
\ No newline at end of file
*/
package jalview.ws.seqfetcher;
+import jalview.api.FeatureSettingsI;
import jalview.datamodel.AlignmentI;
import jalview.io.FormatAdapter;
import jalview.io.IdentifyFile;
-import java.util.Hashtable;
-
/**
* common methods for implementations of the DbSourceProxy interface.
*
*/
public abstract class DbSourceProxyImpl implements DbSourceProxy
{
- public DbSourceProxyImpl()
- {
- // default constructor - do nothing probably.
- }
- private Hashtable props = null;
-
- /*
- * (non-Javadoc)
- *
- * @see jalview.ws.DbSourceProxy#getDbSourceProperties()
- */
- public Hashtable getDbSourceProperties()
- {
- if (props == null)
- {
- props = new Hashtable();
- }
- return props;
- }
+ boolean queryInProgress = false;
- protected void addDbSourceProperty(Object propname)
- {
- addDbSourceProperty(propname, propname);
- }
+ protected StringBuffer results = null;
- protected void addDbSourceProperty(Object propname, Object propvalue)
+ public DbSourceProxyImpl()
{
- if (props == null)
- {
- props = new Hashtable();
- }
- props.put(propname, propvalue);
}
- boolean queryInProgress = false;
-
- protected StringBuffer results = null;
-
/*
* (non-Javadoc)
*
* @see jalview.ws.DbSourceProxy#getRawRecords()
*/
+ @Override
public StringBuffer getRawRecords()
{
return results;
*
* @see jalview.ws.DbSourceProxy#queryInProgress()
*/
+ @Override
public boolean queryInProgress()
{
return queryInProgress;
protected AlignmentI parseResult(String result) throws Exception
{
AlignmentI sequences = null;
- String format = new IdentifyFile().Identify(result, "Paste");
+ String format = new IdentifyFile().identify(result, "Paste");
if (FormatAdapter.isValidFormat(format))
{
sequences = new FormatAdapter().readFile(result.toString(), "Paste",
return sequences;
}
+ /**
+ * Returns the first accession id in the query (up to the first accession id
+ * separator), or the whole query if there is no separator or it is not found
+ */
@Override
- public boolean isA(Object dbsourceproperty)
+ public String getAccessionIdFromQuery(String query)
{
- assert (dbsourceproperty != null);
- return (props == null) ? false : props.containsKey(dbsourceproperty);
+ String sep = getAccessionSeparator();
+ if (sep == null)
+ {
+ return query;
+ }
+ int sepPos = query.indexOf(sep);
+ return sepPos == -1 ? query : query.substring(0, sepPos);
+ }
+
+ /**
+ * Default is only one accession id per query - override if more are allowed.
+ */
+ @Override
+ public int getMaximumQueryCount()
+ {
+ return 1;
+ }
+
+ /**
+ * Returns false - override to return true for DNA coding data sources
+ */
+ @Override
+ public boolean isDnaCoding()
+ {
+ return false;
}
+ /**
+ * Answers false - override as required in subclasses
+ */
+ @Override
+ public boolean isAlignmentSource()
+ {
+ return false;
+ }
+
+ @Override
+ public String getDescription()
+ {
+ return null;
+ }
+
+ @Override
+ public FeatureSettingsI getFeatureColourScheme()
+ {
+ return null;
+ }
}
import jalview.datamodel.SearchResults;
import jalview.datamodel.SearchResults.Match;
import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
import jalview.io.AppletFormatAdapter;
import jalview.io.FormatAdapter;
import java.io.IOException;
import java.util.ArrayList;
import java.util.Arrays;
-import java.util.Collections;
import java.util.HashSet;
import java.util.Iterator;
-import java.util.LinkedHashSet;
+import java.util.LinkedHashMap;
import java.util.List;
import java.util.Map;
import java.util.Set;
* region). The leading gap, and the gaps between codons, are subsumed by
* the protein alignment gap.
*/
- checkAlignSequenceAs("-G-GG--AA-A-", "-A-L-", true, true, map,
- "---G-GG---AA-A-");
+ checkAlignSequenceAs("-G-GG--AA-A---", "-A-L-", true, true, map,
+ "---G-GG---AA-A---");
/*
* Include only unmapped gaps in dna when realigning (outside the exon
* the protein alignment gap.
*/
checkAlignSequenceAs("-G-GG--AA-A-", "-A-L-", false, true, map,
- "---GGG---AAA-");
+ "---GGG---AAA---");
}
/**
@Test(groups = { "Functional" })
public void testAlignSequenceAs_withMapping_withUnmappedProtein()
{
-
/*
* Exons at codon 2 (AAA) and 4 (TTT) mapped to A and P
*/
1, 1, 3, 3 }, 3, 1);
/*
- * Expect alignment does nothing (aborts realignment). Change this test
- * first if different behaviour wanted.
+ * -L- 'aligns' ccc------
*/
- checkAlignSequenceAs("GGGAAACCCTTTGGG", "-A-L-P-", false, false, map,
- "GGGAAACCCTTTGGG");
+ checkAlignSequenceAs("gggAAAcccTTTggg", "-A-L-P-", false, false, map,
+ "gggAAAccc------TTTggg");
}
/**
* Helper method that performs and verifies the method under test.
*
- * @param dnaSeq
- * @param proteinSeq
+ * @param alignee
+ * the sequence to be realigned
+ * @param alignModel
+ * the sequence whose alignment is to be copied
* @param preserveMappedGaps
* @param preserveUnmappedGaps
* @param map
* @param expected
*/
- protected void checkAlignSequenceAs(final String dnaSeq,
- final String proteinSeq, final boolean preserveMappedGaps,
+ protected void checkAlignSequenceAs(final String alignee,
+ final String alignModel, final boolean preserveMappedGaps,
final boolean preserveUnmappedGaps, MapList map,
final String expected)
{
- SequenceI dna = new Sequence("Seq1", dnaSeq);
- dna.createDatasetSequence();
- SequenceI protein = new Sequence("Seq1", proteinSeq);
- protein.createDatasetSequence();
+ SequenceI alignMe = new Sequence("Seq1", alignee);
+ alignMe.createDatasetSequence();
+ SequenceI alignFrom = new Sequence("Seq2", alignModel);
+ alignFrom.createDatasetSequence();
AlignedCodonFrame acf = new AlignedCodonFrame();
- acf.addMap(dna.getDatasetSequence(), protein.getDatasetSequence(), map);
+ acf.addMap(alignMe.getDatasetSequence(), alignFrom.getDatasetSequence(), map);
- AlignmentUtils.alignSequenceAs(dna, protein, acf, "---", '-',
+ AlignmentUtils.alignSequenceAs(alignMe, alignFrom, acf, "---", '-',
preserveMappedGaps, preserveUnmappedGaps);
- assertEquals(expected, dna.getSequenceAsString());
+ assertEquals(expected, alignMe.getSequenceAsString());
}
/**
acf.addMap(dna1.getDatasetSequence(), prot1.getDatasetSequence(), map);
acf.addMap(dna2.getDatasetSequence(), prot2.getDatasetSequence(), map);
acf.addMap(dna3.getDatasetSequence(), prot3.getDatasetSequence(), map);
- protein.setCodonFrames(Collections.singleton(acf));
+ ArrayList<AlignedCodonFrame> acfs = new ArrayList<AlignedCodonFrame>();
+ acfs.add(acf);
+ protein.setCodonFrames(acfs);
/*
* Translated codon order is [1,2,3] [1,3,4] [4,5,6] [4,5,7] [5,6,7] [7,8,9]
@Test(groups = { "Functional" })
public void testTranslatesAs()
{
+ // null arguments check
+ assertFalse(AlignmentUtils.translatesAs(null, 0, null));
+ assertFalse(AlignmentUtils.translatesAs(new char[] { 't' }, 0, null));
+ assertFalse(AlignmentUtils.translatesAs(null, 0, new char[] { 'a' }));
+
+ // straight translation
assertTrue(AlignmentUtils.translatesAs("tttcccaaaggg".toCharArray(), 0,
"FPKG".toCharArray()));
- // with start codon (not in protein)
+ // with extra start codon (not in protein)
assertTrue(AlignmentUtils.translatesAs("atgtttcccaaaggg".toCharArray(),
3, "FPKG".toCharArray()));
// with stop codon1 (not in protein)
assertTrue(AlignmentUtils.translatesAs(
"atgtttcccaaagggtga".toCharArray(), 3, "FPKG".toCharArray()));
- // with embedded stop codon
+ // with embedded stop codons
assertTrue(AlignmentUtils.translatesAs(
"atgtttTAGcccaaaTAAgggtga".toCharArray(), 3,
"F*PK*G".toCharArray()));
// wrong protein
assertFalse(AlignmentUtils.translatesAs("tttcccaaaggg".toCharArray(),
0, "FPMG".toCharArray()));
+
+ // truncated dna
+ assertFalse(AlignmentUtils.translatesAs("tttcccaaagg".toCharArray(), 0,
+ "FPKG".toCharArray()));
+
+ // truncated protein
+ assertFalse(AlignmentUtils.translatesAs("tttcccaaaggg".toCharArray(),
+ 0, "FPK".toCharArray()));
+
+ // overlong dna (doesn't end in stop codon)
+ assertFalse(AlignmentUtils.translatesAs(
+ "tttcccaaagggttt".toCharArray(), 0, "FPKG".toCharArray()));
+
+ // dna + stop codon + more
+ assertFalse(AlignmentUtils.translatesAs(
+ "tttcccaaagggttaga".toCharArray(), 0, "FPKG".toCharArray()));
+
+ // overlong protein
+ assertFalse(AlignmentUtils.translatesAs("tttcccaaaggg".toCharArray(),
+ 0, "FPKGQ".toCharArray()));
}
/**
}
/**
- * Test the method that extracts the exon-only part of a dna alignment.
+ * Test the method that extracts the cds-only part of a dna alignment.
*/
@Test(groups = { "Functional" })
- public void testMakeExonAlignment()
+ public void testMakeCdsAlignment()
{
SequenceI dna1 = new Sequence("dna1", "aaaGGGcccTTTaaa");
SequenceI dna2 = new Sequence("dna2", "GGGcccTTTaaaCCC");
dna2.createDatasetSequence();
pep1.createDatasetSequence();
pep2.createDatasetSequence();
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds1", 4, 6, 0f,
+ null));
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds2", 10, 12, 0f,
+ null));
+ dna2.addSequenceFeature(new SequenceFeature("CDS", "cds3", 1, 3, 0f,
+ null));
+ dna2.addSequenceFeature(new SequenceFeature("CDS", "cds4", 7, 9, 0f,
+ null));
+ dna2.addSequenceFeature(new SequenceFeature("CDS", "cds5", 13, 15, 0f,
+ null));
+ AlignmentI dna = new Alignment(new SequenceI[] { dna1, dna2 });
+ dna.setDataset(null);
- Set<AlignedCodonFrame> mappings = new HashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> mappings = new ArrayList<AlignedCodonFrame>();
MapList map = new MapList(new int[] { 4, 6, 10, 12 },
new int[] { 1, 2 }, 3, 1);
AlignedCodonFrame acf = new AlignedCodonFrame();
acf.addMap(dna2.getDatasetSequence(), pep2.getDatasetSequence(), map);
mappings.add(acf);
- AlignmentI exons = AlignmentUtils.makeExonAlignment(new SequenceI[] {
- dna1, dna2 }, mappings);
- assertEquals(2, exons.getSequences().size());
- assertEquals("GGGTTT", exons.getSequenceAt(0).getSequenceAsString());
- assertEquals("GGGTTTCCC", exons.getSequenceAt(1).getSequenceAsString());
+ AlignmentI cds = AlignmentUtils.makeCdsAlignment(new SequenceI[] {
+ dna1, dna2 }, mappings, dna);
+ assertEquals(2, cds.getSequences().size());
+ assertEquals("---GGG---TTT---", cds.getSequenceAt(0)
+ .getSequenceAsString());
+ assertEquals("GGG---TTT---CCC", cds.getSequenceAt(1)
+ .getSequenceAsString());
+
+ /*
+ * verify shared, extended alignment dataset
+ */
+ assertSame(dna.getDataset(), cds.getDataset());
+ assertTrue(dna.getDataset().getSequences()
+ .contains(cds.getSequenceAt(0).getDatasetSequence()));
+ assertTrue(dna.getDataset().getSequences()
+ .contains(cds.getSequenceAt(1).getDatasetSequence()));
/*
* Verify updated mappings
SearchResults sr = MappingUtils.buildSearchResults(pep1, 1, mappings);
assertEquals(1, sr.getResults().size());
Match m = sr.getResults().get(0);
- assertEquals(exons.getSequenceAt(0).getDatasetSequence(),
+ assertSame(cds.getSequenceAt(0).getDatasetSequence(),
m.getSequence());
assertEquals(1, m.getStart());
assertEquals(3, m.getEnd());
// map F to TTT
sr = MappingUtils.buildSearchResults(pep1, 2, mappings);
m = sr.getResults().get(0);
- assertEquals(exons.getSequenceAt(0).getDatasetSequence(),
+ assertSame(cds.getSequenceAt(0).getDatasetSequence(),
m.getSequence());
assertEquals(4, m.getStart());
assertEquals(6, m.getEnd());
sr = MappingUtils.buildSearchResults(pep2, 1, mappings);
assertEquals(1, sr.getResults().size());
m = sr.getResults().get(0);
- assertEquals(exons.getSequenceAt(1).getDatasetSequence(),
+ assertSame(cds.getSequenceAt(1).getDatasetSequence(),
m.getSequence());
assertEquals(1, m.getStart());
assertEquals(3, m.getEnd());
// map F to TTT
sr = MappingUtils.buildSearchResults(pep2, 2, mappings);
m = sr.getResults().get(0);
- assertEquals(exons.getSequenceAt(1).getDatasetSequence(),
+ assertSame(cds.getSequenceAt(1).getDatasetSequence(),
m.getSequence());
assertEquals(4, m.getStart());
assertEquals(6, m.getEnd());
// map P to CCC
sr = MappingUtils.buildSearchResults(pep2, 3, mappings);
m = sr.getResults().get(0);
- assertEquals(exons.getSequenceAt(1).getDatasetSequence(),
+ assertSame(cds.getSequenceAt(1).getDatasetSequence(),
m.getSequence());
assertEquals(7, m.getStart());
assertEquals(9, m.getEnd());
}
/**
- * Test the method that makes an exon-only sequence from a DNA sequence and
- * its product mapping. Test includes the expected case that the DNA sequence
+ * Test the method that makes a cds-only sequence from a DNA sequence and its
+ * product mapping. Test includes the expected case that the DNA sequence
* already has a protein product (Uniprot translation) which in turn has an
* x-ref to the EMBLCDS record.
*/
@Test(groups = { "Functional" })
- public void testMakeExonSequences()
+ public void testMakeCdsSequences()
{
SequenceI dna1 = new Sequence("dna1", "aaaGGGcccTTTaaa");
SequenceI pep1 = new Sequence("pep1", "GF");
mappings.add(acf);
AlignedCodonFrame newMapping = new AlignedCodonFrame();
- List<SequenceI> exons = AlignmentUtils.makeExonSequences(dna1, acf,
- newMapping);
- assertEquals(1, exons.size());
- SequenceI exon = exons.get(0);
-
- assertEquals("GGGTTT", exon.getSequenceAsString());
- assertEquals("dna1|A12345", exon.getName());
- assertEquals(1, exon.getDBRefs().length);
- DBRefEntry cdsRef = exon.getDBRefs()[0];
+ List<int[]> ungappedColumns = new ArrayList<int[]>();
+ ungappedColumns.add(new int[] { 4, 6 });
+ ungappedColumns.add(new int[] { 10, 12 });
+ List<SequenceI> cdsSeqs = AlignmentUtils.makeCdsSequences(dna1, acf,
+ ungappedColumns,
+ newMapping, '-');
+ assertEquals(1, cdsSeqs.size());
+ SequenceI cdsSeq = cdsSeqs.get(0);
+
+ assertEquals("GGGTTT", cdsSeq.getSequenceAsString());
+ assertEquals("dna1|A12345", cdsSeq.getName());
+ assertEquals(1, cdsSeq.getDBRefs().length);
+ DBRefEntry cdsRef = cdsSeq.getDBRefs()[0];
assertEquals("EMBLCDS", cdsRef.getSource());
assertEquals("2", cdsRef.getVersion());
assertEquals("A12345", cdsRef.getAccessionId());
}
/**
- * Test the method that makes an exon-only alignment from a DNA sequence and
- * its product mappings, for the case where there are multiple exon mappings
- * to different protein products.
+ * Test the method that makes a cds-only alignment from a DNA sequence and its
+ * product mappings, for the case where there are multiple exon mappings to
+ * different protein products.
*/
@Test(groups = { "Functional" })
- public void testMakeExonAlignment_multipleProteins()
+ public void testMakeCdsAlignment_multipleProteins()
{
SequenceI dna1 = new Sequence("dna1", "aaaGGGcccTTTaaa");
SequenceI pep1 = new Sequence("pep1", "GF"); // GGGTTT
pep1.createDatasetSequence();
pep2.createDatasetSequence();
pep3.createDatasetSequence();
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds1", 4, 6, 0f,
+ null));
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds2", 10, 12, 0f,
+ null));
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds3", 1, 3, 0f,
+ null));
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds4", 7, 9, 0f,
+ null));
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds5", 1, 3, 0f,
+ null));
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds6", 10, 12, 0f,
+ null));
pep1.getDatasetSequence().addDBRef(
new DBRefEntry("EMBLCDS", "2", "A12345"));
pep2.getDatasetSequence().addDBRef(
new DBRefEntry("EMBLCDS", "4", "A12347"));
/*
- * Make the mappings from dna to protein. Using LinkedHashset is a
- * convenience so results are in the input order. There is no assertion that
- * the generated exon sequences are in any particular order.
+ * Make the mappings from dna to protein
*/
- Set<AlignedCodonFrame> mappings = new LinkedHashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> mappings = new ArrayList<AlignedCodonFrame>();
// map ...GGG...TTT to GF
MapList map = new MapList(new int[] { 4, 6, 10, 12 },
new int[] { 1, 2 }, 3, 1);
* Create the Exon alignment; also replaces the dna-to-protein mappings with
* exon-to-protein and exon-to-dna mappings
*/
- AlignmentI exal = AlignmentUtils.makeExonAlignment(
- new SequenceI[] { dna1 }, mappings);
+ AlignmentI dna = new Alignment(new SequenceI[] { dna1 });
+ dna.setDataset(null);
+ AlignmentI exal = AlignmentUtils.makeCdsAlignment(
+ new SequenceI[] { dna1 }, mappings, dna);
+
+ /*
+ * Verify we have 3 cds sequences, mapped to pep1/2/3 respectively
+ */
+ List<SequenceI> cds = exal.getSequences();
+ assertEquals(3, cds.size());
+
+ /*
+ * verify shared, extended alignment dataset
+ */
+ assertSame(exal.getDataset(), dna.getDataset());
+ assertTrue(dna.getDataset().getSequences()
+ .contains(cds.get(0).getDatasetSequence()));
+ assertTrue(dna.getDataset().getSequences()
+ .contains(cds.get(1).getDatasetSequence()));
+ assertTrue(dna.getDataset().getSequences()
+ .contains(cds.get(2).getDatasetSequence()));
/*
- * Verify we have 3 exon sequences, mapped to pep1/2/3 respectively
+ * verify aligned cds sequences and their xrefs
*/
- List<SequenceI> exons = exal.getSequences();
- assertEquals(3, exons.size());
-
- SequenceI exon = exons.get(0);
- assertEquals("GGGTTT", exon.getSequenceAsString());
- assertEquals("dna1|A12345", exon.getName());
- assertEquals(1, exon.getDBRefs().length);
- DBRefEntry cdsRef = exon.getDBRefs()[0];
+ SequenceI cdsSeq = cds.get(0);
+ assertEquals("---GGG---TTT", cdsSeq.getSequenceAsString());
+ assertEquals("dna1|A12345", cdsSeq.getName());
+ assertEquals(1, cdsSeq.getDBRefs().length);
+ DBRefEntry cdsRef = cdsSeq.getDBRefs()[0];
assertEquals("EMBLCDS", cdsRef.getSource());
assertEquals("2", cdsRef.getVersion());
assertEquals("A12345", cdsRef.getAccessionId());
- exon = exons.get(1);
- assertEquals("aaaccc", exon.getSequenceAsString());
- assertEquals("dna1|A12346", exon.getName());
- assertEquals(1, exon.getDBRefs().length);
- cdsRef = exon.getDBRefs()[0];
+ cdsSeq = cds.get(1);
+ assertEquals("aaa---ccc---", cdsSeq.getSequenceAsString());
+ assertEquals("dna1|A12346", cdsSeq.getName());
+ assertEquals(1, cdsSeq.getDBRefs().length);
+ cdsRef = cdsSeq.getDBRefs()[0];
assertEquals("EMBLCDS", cdsRef.getSource());
assertEquals("3", cdsRef.getVersion());
assertEquals("A12346", cdsRef.getAccessionId());
- exon = exons.get(2);
- assertEquals("aaaTTT", exon.getSequenceAsString());
- assertEquals("dna1|A12347", exon.getName());
- assertEquals(1, exon.getDBRefs().length);
- cdsRef = exon.getDBRefs()[0];
+ cdsSeq = cds.get(2);
+ assertEquals("aaa------TTT", cdsSeq.getSequenceAsString());
+ assertEquals("dna1|A12347", cdsSeq.getName());
+ assertEquals(1, cdsSeq.getDBRefs().length);
+ cdsRef = cdsSeq.getDBRefs()[0];
assertEquals("EMBLCDS", cdsRef.getSource());
assertEquals("4", cdsRef.getVersion());
assertEquals("A12347", cdsRef.getAccessionId());
/*
- * Verify there are mappings from each exon sequence to its protein product
+ * Verify there are mappings from each cds sequence to its protein product
* and also to its dna source
*/
Iterator<AlignedCodonFrame> newMappingsIterator = mappings.iterator();
// mappings for dna1 - exon1 - pep1
- AlignedCodonFrame exonMapping = newMappingsIterator.next();
- List<Mapping> dnaMappings = exonMapping.getMappingsForSequence(dna1);
+ AlignedCodonFrame cdsMapping = newMappingsIterator.next();
+ List<Mapping> dnaMappings = cdsMapping.getMappingsForSequence(dna1);
assertEquals(1, dnaMappings.size());
- assertSame(exons.get(0).getDatasetSequence(), dnaMappings.get(0)
+ assertSame(cds.get(0).getDatasetSequence(), dnaMappings.get(0)
.getTo());
assertEquals("G(1) in CDS should map to G(4) in DNA", 4, dnaMappings
.get(0).getMap().getToPosition(1));
- List<Mapping> peptideMappings = exonMapping
+ List<Mapping> peptideMappings = cdsMapping
.getMappingsForSequence(pep1);
assertEquals(1, peptideMappings.size());
assertSame(pep1.getDatasetSequence(), peptideMappings.get(0).getTo());
- // mappings for dna1 - exon2 - pep2
- exonMapping = newMappingsIterator.next();
- dnaMappings = exonMapping.getMappingsForSequence(dna1);
+ // mappings for dna1 - cds2 - pep2
+ cdsMapping = newMappingsIterator.next();
+ dnaMappings = cdsMapping.getMappingsForSequence(dna1);
assertEquals(1, dnaMappings.size());
- assertSame(exons.get(1).getDatasetSequence(), dnaMappings.get(0)
+ assertSame(cds.get(1).getDatasetSequence(), dnaMappings.get(0)
.getTo());
assertEquals("c(4) in CDS should map to c(7) in DNA", 7, dnaMappings
.get(0).getMap().getToPosition(4));
- peptideMappings = exonMapping.getMappingsForSequence(pep2);
+ peptideMappings = cdsMapping.getMappingsForSequence(pep2);
assertEquals(1, peptideMappings.size());
assertSame(pep2.getDatasetSequence(), peptideMappings.get(0).getTo());
- // mappings for dna1 - exon3 - pep3
- exonMapping = newMappingsIterator.next();
- dnaMappings = exonMapping.getMappingsForSequence(dna1);
+ // mappings for dna1 - cds3 - pep3
+ cdsMapping = newMappingsIterator.next();
+ dnaMappings = cdsMapping.getMappingsForSequence(dna1);
assertEquals(1, dnaMappings.size());
- assertSame(exons.get(2).getDatasetSequence(), dnaMappings.get(0)
+ assertSame(cds.get(2).getDatasetSequence(), dnaMappings.get(0)
.getTo());
assertEquals("T(4) in CDS should map to T(10) in DNA", 10, dnaMappings
.get(0).getMap().getToPosition(4));
- peptideMappings = exonMapping.getMappingsForSequence(pep3);
+ peptideMappings = cdsMapping.getMappingsForSequence(pep3);
assertEquals(1, peptideMappings.size());
assertSame(pep3.getDatasetSequence(), peptideMappings.get(0).getTo());
}
* @throws IOException
*/
@Test(groups = { "Functional" })
- public void testMapProteinSequenceToCdna_forSubsequence()
+ public void testMapCdnaToProtein_forSubsequence()
throws IOException
{
SequenceI prot = new Sequence("UNIPROT|V12345", "E-I--Q", 10, 12);
SequenceI dna = new Sequence("EMBL|A33333", "GAA--AT-C-CAG", 40, 48);
dna.createDatasetSequence();
- MapList map = AlignmentUtils.mapProteinSequenceToCdna(prot, dna);
+ MapList map = AlignmentUtils.mapCdnaToProtein(prot, dna);
assertEquals(10, map.getToLowest());
assertEquals(12, map.getToHighest());
assertEquals(40, map.getFromLowest());
assertEquals(48, map.getFromHighest());
}
+
+ /**
+ * Test for the alignSequenceAs method where we have protein mapped to protein
+ */
+ @Test(groups = { "Functional" })
+ public void testAlignSequenceAs_mappedProteinProtein()
+ {
+
+ SequenceI alignMe = new Sequence("Match", "MGAASEV");
+ alignMe.createDatasetSequence();
+ SequenceI alignFrom = new Sequence("Query", "LQTGYMGAASEVMFSPTRR");
+ alignFrom.createDatasetSequence();
+
+ AlignedCodonFrame acf = new AlignedCodonFrame();
+ // this is like a domain or motif match of part of a peptide sequence
+ MapList map = new MapList(new int[] { 6, 12 }, new int[] { 1, 7 }, 1, 1);
+ acf.addMap(alignFrom.getDatasetSequence(),
+ alignMe.getDatasetSequence(), map);
+
+ AlignmentUtils.alignSequenceAs(alignMe, alignFrom, acf, "-", '-', true,
+ true);
+ assertEquals("-----MGAASEV-------", alignMe.getSequenceAsString());
+ }
+
+ /**
+ * Test for the alignSequenceAs method where there are trailing unmapped
+ * residues in the model sequence
+ */
+ @Test(groups = { "Functional" })
+ public void testAlignSequenceAs_withTrailingPeptide()
+ {
+ // map first 3 codons to KPF; G is a trailing unmapped residue
+ MapList map = new MapList(new int[] { 1, 9 }, new int[] { 1, 3 }, 3, 1);
+
+ checkAlignSequenceAs("AAACCCTTT", "K-PFG", true, true, map,
+ "AAA---CCCTTT---");
+ }
+
+ /**
+ * Tests for transferring features between mapped sequences
+ */
+ @Test(groups = { "Functional" })
+ public void testTransferFeatures()
+ {
+ SequenceI dna = new Sequence("dna/20-34", "acgTAGcaaGCCcgt");
+ SequenceI cds = new Sequence("cds/10-15", "TAGGCC");
+
+ // no overlap
+ dna.addSequenceFeature(new SequenceFeature("type1", "desc1", 1, 2, 1f,
+ null));
+ // partial overlap - to [1, 1]
+ dna.addSequenceFeature(new SequenceFeature("type2", "desc2", 3, 4, 2f,
+ null));
+ // exact overlap - to [1, 3]
+ dna.addSequenceFeature(new SequenceFeature("type3", "desc3", 4, 6, 3f,
+ null));
+ // spanning overlap - to [2, 5]
+ dna.addSequenceFeature(new SequenceFeature("type4", "desc4", 5, 11, 4f,
+ null));
+ // exactly overlaps whole mapped range [1, 6]
+ dna.addSequenceFeature(new SequenceFeature("type5", "desc5", 4, 12, 5f,
+ null));
+ // no overlap (internal)
+ dna.addSequenceFeature(new SequenceFeature("type6", "desc6", 7, 9, 6f,
+ null));
+ // no overlap (3' end)
+ dna.addSequenceFeature(new SequenceFeature("type7", "desc7", 13, 15,
+ 7f, null));
+ // overlap (3' end) - to [6, 6]
+ dna.addSequenceFeature(new SequenceFeature("type8", "desc8", 12, 12,
+ 8f, null));
+ // extended overlap - to [6, +]
+ dna.addSequenceFeature(new SequenceFeature("type9", "desc9", 12, 13,
+ 9f, null));
+
+ MapList map = new MapList(new int[] { 4, 6, 10, 12 },
+ new int[] { 1, 6 }, 1, 1);
+
+ /*
+ * transferFeatures() will build 'partial overlap' for regions
+ * that partially overlap 5' or 3' (start or end) of target sequence
+ */
+ AlignmentUtils.transferFeatures(dna, cds, map, null);
+ SequenceFeature[] sfs = cds.getSequenceFeatures();
+ assertEquals(6, sfs.length);
+
+ SequenceFeature sf = sfs[0];
+ assertEquals("type2", sf.getType());
+ assertEquals("desc2", sf.getDescription());
+ assertEquals(2f, sf.getScore());
+ assertEquals(1, sf.getBegin());
+ assertEquals(1, sf.getEnd());
+
+ sf = sfs[1];
+ assertEquals("type3", sf.getType());
+ assertEquals("desc3", sf.getDescription());
+ assertEquals(3f, sf.getScore());
+ assertEquals(1, sf.getBegin());
+ assertEquals(3, sf.getEnd());
+
+ sf = sfs[2];
+ assertEquals("type4", sf.getType());
+ assertEquals(2, sf.getBegin());
+ assertEquals(5, sf.getEnd());
+
+ sf = sfs[3];
+ assertEquals("type5", sf.getType());
+ assertEquals(1, sf.getBegin());
+ assertEquals(6, sf.getEnd());
+
+ sf = sfs[4];
+ assertEquals("type8", sf.getType());
+ assertEquals(6, sf.getBegin());
+ assertEquals(6, sf.getEnd());
+
+ sf = sfs[5];
+ assertEquals("type9", sf.getType());
+ assertEquals(6, sf.getBegin());
+ assertEquals(6, sf.getEnd());
+ }
+
+ /**
+ * Tests for transferring features between mapped sequences
+ */
+ @Test(groups = { "Functional" })
+ public void testTransferFeatures_withOmit()
+ {
+ SequenceI dna = new Sequence("dna/20-34", "acgTAGcaaGCCcgt");
+ SequenceI cds = new Sequence("cds/10-15", "TAGGCC");
+
+ MapList map = new MapList(new int[] { 4, 6, 10, 12 },
+ new int[] { 1, 6 }, 1, 1);
+
+ // [5, 11] maps to [2, 5]
+ dna.addSequenceFeature(new SequenceFeature("type4", "desc4", 5, 11, 4f,
+ null));
+ // [4, 12] maps to [1, 6]
+ dna.addSequenceFeature(new SequenceFeature("type5", "desc5", 4, 12, 5f,
+ null));
+ // [12, 12] maps to [6, 6]
+ dna.addSequenceFeature(new SequenceFeature("type8", "desc8", 12, 12,
+ 8f, null));
+
+ // desc4 and desc8 are the 'omit these' varargs
+ AlignmentUtils.transferFeatures(dna, cds, map, null, "type4", "type8");
+ SequenceFeature[] sfs = cds.getSequenceFeatures();
+ assertEquals(1, sfs.length);
+
+ SequenceFeature sf = sfs[0];
+ assertEquals("type5", sf.getType());
+ assertEquals(1, sf.getBegin());
+ assertEquals(6, sf.getEnd());
+ }
+
+ /**
+ * Tests for transferring features between mapped sequences
+ */
+ @Test(groups = { "Functional" })
+ public void testTransferFeatures_withSelect()
+ {
+ SequenceI dna = new Sequence("dna/20-34", "acgTAGcaaGCCcgt");
+ SequenceI cds = new Sequence("cds/10-15", "TAGGCC");
+
+ MapList map = new MapList(new int[] { 4, 6, 10, 12 },
+ new int[] { 1, 6 }, 1, 1);
+
+ // [5, 11] maps to [2, 5]
+ dna.addSequenceFeature(new SequenceFeature("type4", "desc4", 5, 11, 4f,
+ null));
+ // [4, 12] maps to [1, 6]
+ dna.addSequenceFeature(new SequenceFeature("type5", "desc5", 4, 12, 5f,
+ null));
+ // [12, 12] maps to [6, 6]
+ dna.addSequenceFeature(new SequenceFeature("type8", "desc8", 12, 12,
+ 8f, null));
+
+ // "type5" is the 'select this type' argument
+ AlignmentUtils.transferFeatures(dna, cds, map, "type5");
+ SequenceFeature[] sfs = cds.getSequenceFeatures();
+ assertEquals(1, sfs.length);
+
+ SequenceFeature sf = sfs[0];
+ assertEquals("type5", sf.getType());
+ assertEquals(1, sf.getBegin());
+ assertEquals(6, sf.getEnd());
+ }
+
+ /**
+ * Test the method that extracts the cds-only part of a dna alignment, for the
+ * case where the cds should be aligned to match its nucleotide sequence.
+ */
+ @Test(groups = { "Functional" })
+ public void testMakeCdsAlignment_alternativeTranscripts()
+ {
+ SequenceI dna1 = new Sequence("dna1", "aaaGGGCC-----CTTTaaaGGG");
+ // alternative transcript of same dna skips CCC codon
+ SequenceI dna2 = new Sequence("dna2", "aaaGGGCC-----cttTaaaGGG");
+ // dna3 has no mapping (protein product) so should be ignored here
+ SequenceI dna3 = new Sequence("dna3", "aaaGGGCCCCCGGGcttTaaaGGG");
+ SequenceI pep1 = new Sequence("pep1", "GPFG");
+ SequenceI pep2 = new Sequence("pep2", "GPG");
+ dna1.createDatasetSequence();
+ dna2.createDatasetSequence();
+ dna3.createDatasetSequence();
+ pep1.createDatasetSequence();
+ pep2.createDatasetSequence();
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds1", 4, 8, 0f,
+ null));
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds2", 9, 12, 0f,
+ null));
+ dna1.addSequenceFeature(new SequenceFeature("CDS", "cds3", 16, 18, 0f,
+ null));
+ dna2.addSequenceFeature(new SequenceFeature("CDS", "cds", 4, 8, 0f,
+ null));
+ dna2.addSequenceFeature(new SequenceFeature("CDS", "cds", 12, 12, 0f,
+ null));
+ dna2.addSequenceFeature(new SequenceFeature("CDS", "cds", 16, 18, 0f,
+ null));
+
+ List<AlignedCodonFrame> mappings = new ArrayList<AlignedCodonFrame>();
+ MapList map = new MapList(new int[] { 4, 12, 16, 18 },
+ new int[] { 1, 4 }, 3, 1);
+ AlignedCodonFrame acf = new AlignedCodonFrame();
+ acf.addMap(dna1.getDatasetSequence(), pep1.getDatasetSequence(), map);
+ mappings.add(acf);
+ map = new MapList(new int[] { 4, 8, 12, 12, 16, 18 },
+ new int[] { 1, 3 },
+ 3, 1);
+ acf = new AlignedCodonFrame();
+ acf.addMap(dna2.getDatasetSequence(), pep2.getDatasetSequence(), map);
+ mappings.add(acf);
+
+ AlignmentI dna = new Alignment(new SequenceI[] { dna1, dna2, dna3 });
+ dna.setDataset(null);
+ AlignmentI cds = AlignmentUtils.makeCdsAlignment(new SequenceI[] {
+ dna1, dna2, dna3 }, mappings, dna);
+ List<SequenceI> cdsSeqs = cds.getSequences();
+ assertEquals(2, cdsSeqs.size());
+ assertEquals("GGGCCCTTTGGG", cdsSeqs.get(0).getSequenceAsString());
+ assertEquals("GGGCC---TGGG", cdsSeqs.get(1).getSequenceAsString());
+
+ /*
+ * verify shared, extended alignment dataset
+ */
+ assertSame(dna.getDataset(), cds.getDataset());
+ assertTrue(dna.getDataset().getSequences()
+ .contains(cdsSeqs.get(0).getDatasetSequence()));
+ assertTrue(dna.getDataset().getSequences()
+ .contains(cdsSeqs.get(1).getDatasetSequence()));
+
+ /*
+ * Verify updated mappings
+ */
+ assertEquals(2, mappings.size());
+
+ /*
+ * Mapping from pep1 to GGGTTT in first new CDS sequence
+ */
+ List<AlignedCodonFrame> pep1Mapping = MappingUtils
+ .findMappingsForSequence(pep1, mappings);
+ assertEquals(1, pep1Mapping.size());
+ /*
+ * maps GPFG to 1-3,4-6,7-9,10-12
+ */
+ SearchResults sr = MappingUtils.buildSearchResults(pep1, 1, mappings);
+ assertEquals(1, sr.getResults().size());
+ Match m = sr.getResults().get(0);
+ assertEquals(cds.getSequenceAt(0).getDatasetSequence(),
+ m.getSequence());
+ assertEquals(1, m.getStart());
+ assertEquals(3, m.getEnd());
+ sr = MappingUtils.buildSearchResults(pep1, 2, mappings);
+ m = sr.getResults().get(0);
+ assertEquals(4, m.getStart());
+ assertEquals(6, m.getEnd());
+ sr = MappingUtils.buildSearchResults(pep1, 3, mappings);
+ m = sr.getResults().get(0);
+ assertEquals(7, m.getStart());
+ assertEquals(9, m.getEnd());
+ sr = MappingUtils.buildSearchResults(pep1, 4, mappings);
+ m = sr.getResults().get(0);
+ assertEquals(10, m.getStart());
+ assertEquals(12, m.getEnd());
+
+ /*
+ * GPG in pep2 map to 1-3,4-6,7-9 in second CDS sequence
+ */
+ List<AlignedCodonFrame> pep2Mapping = MappingUtils
+ .findMappingsForSequence(pep2, mappings);
+ assertEquals(1, pep2Mapping.size());
+ sr = MappingUtils.buildSearchResults(pep2, 1, mappings);
+ assertEquals(1, sr.getResults().size());
+ m = sr.getResults().get(0);
+ assertEquals(cds.getSequenceAt(1).getDatasetSequence(),
+ m.getSequence());
+ assertEquals(1, m.getStart());
+ assertEquals(3, m.getEnd());
+ sr = MappingUtils.buildSearchResults(pep2, 2, mappings);
+ m = sr.getResults().get(0);
+ assertEquals(4, m.getStart());
+ assertEquals(6, m.getEnd());
+ sr = MappingUtils.buildSearchResults(pep2, 3, mappings);
+ m = sr.getResults().get(0);
+ assertEquals(7, m.getStart());
+ assertEquals(9, m.getEnd());
+ }
+
+ /**
+ * Tests for gapped column in sequences
+ */
+ @Test(groups = { "Functional" })
+ public void testIsGappedColumn()
+ {
+ SequenceI seq1 = new Sequence("Seq1", "a--c.tc-a-g");
+ SequenceI seq2 = new Sequence("Seq2", "aa---t--a-g");
+ SequenceI seq3 = new Sequence("Seq3", "ag-c t-g-");
+ List<SequenceI> seqs = Arrays
+ .asList(new SequenceI[] { seq1, seq2, seq3 });
+ // the column number is base 1
+ assertFalse(AlignmentUtils.isGappedColumn(seqs, 1));
+ assertFalse(AlignmentUtils.isGappedColumn(seqs, 2));
+ assertTrue(AlignmentUtils.isGappedColumn(seqs, 3));
+ assertFalse(AlignmentUtils.isGappedColumn(seqs, 4));
+ assertTrue(AlignmentUtils.isGappedColumn(seqs, 5));
+ assertFalse(AlignmentUtils.isGappedColumn(seqs, 6));
+ assertFalse(AlignmentUtils.isGappedColumn(seqs, 7));
+ assertFalse(AlignmentUtils.isGappedColumn(seqs, 8));
+ assertFalse(AlignmentUtils.isGappedColumn(seqs, 9));
+ assertTrue(AlignmentUtils.isGappedColumn(seqs, 10));
+ assertFalse(AlignmentUtils.isGappedColumn(seqs, 11));
+ // out of bounds:
+ assertTrue(AlignmentUtils.isGappedColumn(seqs, 0));
+ assertTrue(AlignmentUtils.isGappedColumn(seqs, 100));
+ assertTrue(AlignmentUtils.isGappedColumn(seqs, -100));
+ assertTrue(AlignmentUtils.isGappedColumn(null, 0));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testFindCdsColumns()
+ {
+ // TODO target method belongs in a general-purpose alignment
+ // analysis method to find columns for feature
+
+ /*
+ * NB this method assumes CDS ranges are contiguous (no introns)
+ */
+ SequenceI gene = new Sequence("gene", "aaacccgggtttaaacccgggttt");
+ SequenceI seq1 = new Sequence("Seq1", "--ac-cgGG-GGaaACC--GGtt-");
+ SequenceI seq2 = new Sequence("Seq2", "AA--CCGG--g-AAA--cG-GTTt");
+ seq1.createDatasetSequence();
+ seq2.createDatasetSequence();
+ seq1.addSequenceFeature(new SequenceFeature("CDS", "cds", 5, 6, 0f,
+ null));
+ seq1.addSequenceFeature(new SequenceFeature("CDS", "cds", 7, 8, 0f,
+ null));
+ seq1.addSequenceFeature(new SequenceFeature("CDS", "cds", 11, 13, 0f,
+ null));
+ seq1.addSequenceFeature(new SequenceFeature("CDS", "cds", 14, 15, 0f,
+ null));
+ seq2.addSequenceFeature(new SequenceFeature("CDS", "cds", 1, 2, 0f,
+ null));
+ seq2.addSequenceFeature(new SequenceFeature("CDS", "cds", 3, 6, 0f,
+ null));
+ seq2.addSequenceFeature(new SequenceFeature("CDS", "cds", 8, 10, 0f,
+ null));
+ seq2.addSequenceFeature(new SequenceFeature("CDS", "cds", 12, 12, 0f,
+ null));
+ seq2.addSequenceFeature(new SequenceFeature("CDS", "cds", 13, 15, 0f,
+ null));
+
+ List<int[]> cdsColumns = AlignmentUtils.findCdsColumns(new SequenceI[] {
+ seq1, seq2 });
+ assertEquals(4, cdsColumns.size());
+ assertEquals("[1, 2]", Arrays.toString(cdsColumns.get(0)));
+ assertEquals("[5, 9]", Arrays.toString(cdsColumns.get(1)));
+ assertEquals("[11, 17]", Arrays.toString(cdsColumns.get(2)));
+ assertEquals("[19, 23]", Arrays.toString(cdsColumns.get(3)));
+ }
+
+ /**
+ * Test the method that realigns protein to match mapped codon alignment.
+ */
+ @Test(groups = { "Functional" })
+ public void testAlignProteinAsDna_incompleteStartCodon()
+ {
+ // seq1: incomplete start codon (not mapped), then [3, 11]
+ SequenceI dna1 = new Sequence("Seq1", "ccAAA-TTT-GGG-");
+ // seq2 codons are [4, 5], [8, 11]
+ SequenceI dna2 = new Sequence("Seq2", "ccaAA-ttT-GGG-");
+ // seq3 incomplete start codon at 'tt'
+ SequenceI dna3 = new Sequence("Seq3", "ccaaa-ttt-GGG-");
+ AlignmentI dna = new Alignment(new SequenceI[] { dna1, dna2, dna3 });
+ dna.setDataset(null);
+
+ // prot1 has 'X' for incomplete start codon (not mapped)
+ SequenceI prot1 = new Sequence("Seq1", "XKFG"); // X for incomplete start
+ SequenceI prot2 = new Sequence("Seq2", "NG");
+ SequenceI prot3 = new Sequence("Seq3", "XG"); // X for incomplete start
+ AlignmentI protein = new Alignment(new SequenceI[] { prot1, prot2,
+ prot3 });
+ protein.setDataset(null);
+
+ // map dna1 [3, 11] to prot1 [2, 4] KFG
+ MapList map = new MapList(new int[] { 3, 11 }, new int[] { 2, 4 }, 3, 1);
+ AlignedCodonFrame acf = new AlignedCodonFrame();
+ acf.addMap(dna1.getDatasetSequence(), prot1.getDatasetSequence(), map);
+
+ // map dna2 [4, 5] [8, 11] to prot2 [1, 2] NG
+ map = new MapList(new int[] { 4, 5, 8, 11 }, new int[] { 1, 2 }, 3, 1);
+ acf.addMap(dna2.getDatasetSequence(), prot2.getDatasetSequence(), map);
+
+ // map dna3 [9, 11] to prot3 [2, 2] G
+ map = new MapList(new int[] { 9, 11 }, new int[] { 2, 2 }, 3, 1);
+ acf.addMap(dna3.getDatasetSequence(), prot3.getDatasetSequence(), map);
+
+ ArrayList<AlignedCodonFrame> acfs = new ArrayList<AlignedCodonFrame>();
+ acfs.add(acf);
+ protein.setCodonFrames(acfs);
+
+ /*
+ * verify X is included in the aligned proteins, and placed just
+ * before the first mapped residue
+ * CCT is between CCC and TTT
+ */
+ AlignmentUtils.alignProteinAsDna(protein, dna);
+ assertEquals("XK-FG", prot1.getSequenceAsString());
+ assertEquals("--N-G", prot2.getSequenceAsString());
+ assertEquals("---XG", prot3.getSequenceAsString());
+ }
+
+ /**
+ * Tests for the method that maps the subset of a dna sequence that has CDS
+ * (or subtype) feature - case where the start codon is incomplete.
+ */
+ @Test(groups = "Functional")
+ public void testGetCdsRanges_fivePrimeIncomplete()
+ {
+ SequenceI dnaSeq = new Sequence("dna", "aaagGGCCCaaaTTTttt");
+ dnaSeq.createDatasetSequence();
+ SequenceI ds = dnaSeq.getDatasetSequence();
+
+ // CDS for dna 5-6 (incomplete codon), 7-9
+ SequenceFeature sf = new SequenceFeature("CDS", "", 5, 9, 0f, null);
+ sf.setPhase("2"); // skip 2 bases to start of next codon
+ ds.addSequenceFeature(sf);
+ // CDS for dna 13-15
+ sf = new SequenceFeature("CDS_predicted", "", 13, 15, 0f, null);
+ ds.addSequenceFeature(sf);
+
+ List<int[]> ranges = AlignmentUtils.findCdsPositions(dnaSeq);
+
+ /*
+ * check the mapping starts with the first complete codon
+ */
+ assertEquals(6, MappingUtils.getLength(ranges));
+ assertEquals(2, ranges.size());
+ assertEquals(7, ranges.get(0)[0]);
+ assertEquals(9, ranges.get(0)[1]);
+ assertEquals(13, ranges.get(1)[0]);
+ assertEquals(15, ranges.get(1)[1]);
+ }
+
+ /**
+ * Tests for the method that maps the subset of a dna sequence that has CDS
+ * (or subtype) feature.
+ */
+ @Test(groups = "Functional")
+ public void testGetCdsRanges()
+ {
+ SequenceI dnaSeq = new Sequence("dna", "aaaGGGcccAAATTTttt");
+ dnaSeq.createDatasetSequence();
+ SequenceI ds = dnaSeq.getDatasetSequence();
+
+ // CDS for dna 3-6
+ SequenceFeature sf = new SequenceFeature("CDS", "", 4, 6, 0f, null);
+ ds.addSequenceFeature(sf);
+ // exon feature should be ignored here
+ sf = new SequenceFeature("exon", "", 7, 9, 0f, null);
+ ds.addSequenceFeature(sf);
+ // CDS for dna 10-12
+ sf = new SequenceFeature("CDS_predicted", "", 10, 12, 0f, null);
+ ds.addSequenceFeature(sf);
+
+ List<int[]> ranges = AlignmentUtils.findCdsPositions(dnaSeq);
+ assertEquals(6, MappingUtils.getLength(ranges));
+ assertEquals(2, ranges.size());
+ assertEquals(4, ranges.get(0)[0]);
+ assertEquals(6, ranges.get(0)[1]);
+ assertEquals(10, ranges.get(1)[0]);
+ assertEquals(12, ranges.get(1)[1]);
+ }
+
+ /**
+ * Test the method that computes a map of codon variants for each protein
+ * position from "sequence_variant" features on dna
+ */
+ @Test(groups = "Functional")
+ public void testBuildDnaVariantsMap()
+ {
+ SequenceI dna = new Sequence("dna", "atgAAATTTGGGCCCtag");
+ MapList map = new MapList(new int[] { 1, 18 }, new int[] { 1, 5 }, 3, 1);
+
+ /*
+ * first with no variants on dna
+ */
+ LinkedHashMap<Integer, String[][]> variantsMap = AlignmentUtils
+ .buildDnaVariantsMap(dna, map);
+ assertTrue(variantsMap.isEmpty());
+
+ // single allele codon 1, on base 1
+ SequenceFeature sf = new SequenceFeature("sequence_variant", "", 1, 1,
+ 0f, null);
+ sf.setValue("alleles", "T");
+ dna.addSequenceFeature(sf);
+
+ // two alleles codon 2, on bases 2 and 3
+ sf = new SequenceFeature("sequence_variant", "", 5, 5, 0f, null);
+ sf.setValue("alleles", "T");
+ dna.addSequenceFeature(sf);
+ sf = new SequenceFeature("sequence_variant", "", 6, 6, 0f, null);
+ sf.setValue("alleles", "G");
+ dna.addSequenceFeature(sf);
+
+ // two alleles codon 3, both on base 2
+ sf = new SequenceFeature("sequence_variant", "", 8, 8, 0f, null);
+ sf.setValue("alleles", "C, G");
+ dna.addSequenceFeature(sf);
+
+ // no alleles on codon 4
+ // alleles on codon 5 on all 3 bases
+ sf = new SequenceFeature("sequence_variant", "", 13, 13, 0f, null);
+ sf.setValue("alleles", "C, G"); // (C duplicates given base value)
+ dna.addSequenceFeature(sf);
+ sf = new SequenceFeature("sequence_variant", "", 14, 14, 0f, null);
+ sf.setValue("alleles", "g, a"); // should force to upper-case
+ dna.addSequenceFeature(sf);
+ sf = new SequenceFeature("sequence_variant", "", 15, 15, 0f, null);
+ sf.setValue("alleles", "A, T");
+ dna.addSequenceFeature(sf);
+
+ variantsMap = AlignmentUtils.buildDnaVariantsMap(dna, map);
+ assertEquals(4, variantsMap.size());
+ assertTrue(Arrays.deepEquals(new String[][] { { "A", "T" }, { "T" },
+ { "G" } }, variantsMap.get(1)));
+ assertTrue(Arrays.deepEquals(new String[][] { { "A" }, { "A", "T" },
+ { "A", "G" } }, variantsMap.get(2)));
+ assertTrue(Arrays.deepEquals(new String[][] { { "T" },
+ { "T", "C", "G" }, { "T" } }, variantsMap.get(3)));
+ // duplicated bases are not removed here, handled in computePeptideVariants
+ assertTrue(Arrays.deepEquals(new String[][] { { "C", "C", "G" },
+ { "C", "G", "A" }, { "C", "A", "T" } }, variantsMap.get(5)));
+ }
+
+ /**
+ * Tests for the method that computes all peptide variants given codon
+ * variants
+ */
+ @Test(groups = "Functional")
+ public void testComputePeptideVariants()
+ {
+ String[][] codonVariants = new String[][] { { "A" }, { "G" }, { "T" } };
+
+ /*
+ * AGT codes for S - this is not included in the variants returned
+ */
+ List<String> variants = AlignmentUtils.computePeptideVariants(codonVariants, "S");
+ assertEquals("[]", variants.toString());
+
+ // S is reported if it differs from the current value (A):
+ variants = AlignmentUtils.computePeptideVariants(codonVariants, "A");
+ assertEquals("[S]", variants.toString());
+
+ /*
+ * synonymous variant is not reported
+ */
+ codonVariants = new String[][] { { "A" }, { "G" }, { "C", "T" } };
+ // AGC and AGT both code for S
+ variants = AlignmentUtils.computePeptideVariants(codonVariants, "s");
+ assertEquals("[]", variants.toString());
+
+ /*
+ * equivalent variants are only reported once
+ */
+ codonVariants = new String[][] { { "C" }, { "T" },
+ { "A", "C", "G", "T" } };
+ // CTA CTC CTG CTT all code for L
+ variants = AlignmentUtils.computePeptideVariants(codonVariants, "S");
+ assertEquals("[L]", variants.toString());
+
+ /*
+ * vary codons 1 and 2; variant products are sorted and non-redundant
+ */
+ codonVariants = new String[][] { { "a", "C" }, { "g", "T" }, { "A" } };
+ // aga ata cga cta code for R, I, R, L
+ variants = AlignmentUtils.computePeptideVariants(codonVariants, "S");
+ assertEquals("[I, L, R]", variants.toString());
+
+ /*
+ * vary codons 2 and 3
+ */
+ codonVariants = new String[][] { { "a" }, { "g", "T" }, { "A", "c" } };
+ // aga agc ata atc code for R, S, I, I
+ variants = AlignmentUtils.computePeptideVariants(codonVariants, "S");
+ assertEquals("[I, R]", variants.toString());
+
+ /*
+ * vary codons 1 and 3
+ */
+ codonVariants = new String[][] { { "a", "t" }, { "a" }, { "t", "g" } };
+ // aat aag tat tag code for N, K, Y, STOP - STOP sorted to end
+ variants = AlignmentUtils.computePeptideVariants(codonVariants, "S");
+ assertEquals("[K, N, Y, STOP]", variants.toString());
+
+ /*
+ * vary codons 1, 2 and 3
+ */
+ codonVariants = new String[][] { { "a", "t" }, { "G", "C" },
+ { "t", "g" } };
+ // agt agg act acg tgt tgg tct tcg code for S, R, T, T, C, W, S, S
+ variants = AlignmentUtils.computePeptideVariants(codonVariants, "S");
+ assertEquals("[C, R, T, W]", variants.toString());
+ }
}
assertEquals("[0, 2, 5]", convertCodon("A-A--A").toString());
assertEquals("[1, 3, 4]", convertCodon("-A-AA-").toString());
}
+
+ /**
+ * Test dna complementing
+ */
+ @Test(groups = "Functional")
+ public void testGetComplement()
+ {
+ assertEquals('t', Dna.getComplement('a'));
+ assertEquals('T', Dna.getComplement('A'));
+ assertEquals('a', Dna.getComplement('t'));
+ assertEquals('A', Dna.getComplement('T'));
+ assertEquals('c', Dna.getComplement('g'));
+ assertEquals('C', Dna.getComplement('G'));
+ assertEquals('g', Dna.getComplement('c'));
+ assertEquals('G', Dna.getComplement('C'));
+ // note uU --> aA but not vice versa
+ assertEquals('a', Dna.getComplement('u'));
+ assertEquals('A', Dna.getComplement('U'));
+ // ambiguity codes, see http://www.bioinformatics.org/sms/iupac.html
+ assertEquals('r', Dna.getComplement('y'));
+ assertEquals('R', Dna.getComplement('Y'));
+ assertEquals('y', Dna.getComplement('r'));
+ assertEquals('Y', Dna.getComplement('R'));
+ assertEquals('k', Dna.getComplement('m'));
+ assertEquals('K', Dna.getComplement('M'));
+ assertEquals('m', Dna.getComplement('k'));
+ assertEquals('M', Dna.getComplement('K'));
+ assertEquals('b', Dna.getComplement('v'));
+ assertEquals('B', Dna.getComplement('V'));
+ assertEquals('v', Dna.getComplement('b'));
+ assertEquals('V', Dna.getComplement('B'));
+ assertEquals('d', Dna.getComplement('h'));
+ assertEquals('D', Dna.getComplement('H'));
+ assertEquals('h', Dna.getComplement('d'));
+ assertEquals('H', Dna.getComplement('D'));
+ assertEquals('Q', Dna.getComplement('Q'));
+ }
+
+ @Test(groups = "Functional")
+ public void testReverseSequence()
+ {
+ String seq = "AcGtUrYkMbVdHNX";
+
+ // reverse:
+ SequenceI reversed = Dna.reverseSequence("Seq1", seq, false);
+ assertEquals(new StringBuilder(seq).reverse()
+ .toString(), reversed.getSequenceAsString());
+ assertEquals("Seq1|rev", reversed.getName());
+
+ // reverse complement:
+ SequenceI revcomp = Dna.reverseSequence("Seq1", seq, true);
+ assertEquals("XNDhBvKmRyAaCgT", revcomp.getSequenceAsString());
+ assertEquals("Seq1|revcomp", revcomp.getName());
+ }
}
alf.getFeatureRenderer().setVisible("sf3");
alf.getFeatureRenderer().findAllFeatures(true);
AssertJUnit.assertEquals("Number of feature types", 3, alf
- .getFeatureRenderer().getDisplayedFeatureTypes().length);
+ .getFeatureRenderer().getDisplayedFeatureTypes().size());
AssertJUnit.assertTrue(alf.getCurrentView().areFeaturesDisplayed());
FeatureScoreModel fsm = new FeatureScoreModel();
AssertJUnit.assertTrue(fsm.configureFromAlignmentView(alf
package jalview.datamodel;
import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
import static org.testng.AssertJUnit.assertNull;
+import static org.testng.AssertJUnit.assertSame;
+import static org.testng.AssertJUnit.assertTrue;
+import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
import jalview.util.MapList;
import java.util.Arrays;
+import java.util.List;
import org.testng.annotations.Test;
final Sequence aseq1 = new Sequence("Seq1", "-P-R");
aseq1.createDatasetSequence();
- final Sequence aseq2 = new Sequence("Seq2", "-LY-");
+ final Sequence aseq2 = new Sequence("Seq2", "-LY-Q");
aseq2.createDatasetSequence();
/*
/*
* Set up the mappings for the exons (upper-case bases)
+ * Note residue Q is unmapped
*/
MapList map = new MapList(new int[] { 2, 4, 6, 6, 8, 9 }, new int[] {
1, 2 }, 3, 1);
3, 1);
acf.addMap(seq2.getDatasetSequence(), aseq2.getDatasetSequence(), map);
- assertEquals("[2, 4]",
- Arrays.toString(acf.getMappedRegion(seq1, aseq1, 1)));
- assertEquals("[6, 6, 8, 9]",
- Arrays.toString(acf.getMappedRegion(seq1, aseq1, 2)));
- assertEquals("[1, 2, 4, 4]",
- Arrays.toString(acf.getMappedRegion(seq2, aseq2, 1)));
- assertEquals("[5, 5, 7, 8]",
- Arrays.toString(acf.getMappedRegion(seq2, aseq2, 2)));
+ assertArrayEquals(new int[] { 2, 4 },
+ acf.getMappedRegion(seq1, aseq1, 1));
+ assertArrayEquals(new int[] { 6, 6, 8, 9 },
+ acf.getMappedRegion(seq1, aseq1, 2));
+ assertArrayEquals(new int[] { 1, 2, 4, 4 },
+ acf.getMappedRegion(seq2, aseq2, 1));
+ assertArrayEquals(new int[] { 5, 5, 7, 8 },
+ acf.getMappedRegion(seq2, aseq2, 2));
+
+ /*
+ * No mapping from seq2 to Q
+ */
+ assertNull(acf.getMappedRegion(seq2, aseq2, 3));
/*
* No mapping from sequence 1 to sequence 2
}
@Test(groups = { "Functional" })
- public void testGetMappedCodon()
+ public void testGetMappedCodons()
{
final Sequence seq1 = new Sequence("Seq1", "c-G-TA-gC-gT-T");
seq1.createDatasetSequence();
- final Sequence aseq1 = new Sequence("Seq1", "-P-R");
+ final Sequence aseq1 = new Sequence("Seq1", "-V-L");
aseq1.createDatasetSequence();
/*
*/
AlignedCodonFrame acf = new AlignedCodonFrame();
- assertNull(acf.getMappedCodon(seq1.getDatasetSequence(), 0));
+ assertNull(acf.getMappedCodons(seq1.getDatasetSequence(), 0));
+
+ /*
+ * Set up the mappings for the exons (upper-case bases)
+ */
+ MapList map = new MapList(new int[] { 2, 4, 6, 6, 8, 9 }, new int[] {
+ 1, 2 }, 3, 1);
+ acf.addMap(seq1.getDatasetSequence(), aseq1.getDatasetSequence(), map);
+
+ assertEquals(1, acf.getMappedCodons(aseq1.getDatasetSequence(), 1)
+ .size());
+ assertEquals(
+ "[G, T, A]",
+ Arrays.toString(acf.getMappedCodons(aseq1.getDatasetSequence(),
+ 1).get(0)));
+ assertEquals(
+ "[C, T, T]",
+ Arrays.toString(acf.getMappedCodons(aseq1.getDatasetSequence(),
+ 2).get(0)));
+ }
+
+ /**
+ * Test for the case where there is more than one variant of the DNA mapping
+ * to a protein sequence
+ */
+ @Test(groups = { "Functional" })
+ public void testGetMappedCodons_dnaVariants()
+ {
+ final Sequence seq1 = new Sequence("Seq1", "c-G-TA-gC-gT-T");
+ seq1.createDatasetSequence();
+ final Sequence seq2 = new Sequence("Seq2", "c-G-TT-gT-gT-A");
+ seq2.createDatasetSequence();
+ final Sequence aseq1 = new Sequence("Seq1", "-V-L");
+ aseq1.createDatasetSequence();
+
+ AlignedCodonFrame acf = new AlignedCodonFrame();
/*
* Set up the mappings for the exons (upper-case bases)
MapList map = new MapList(new int[] { 2, 4, 6, 6, 8, 9 }, new int[] {
1, 2 }, 3, 1);
acf.addMap(seq1.getDatasetSequence(), aseq1.getDatasetSequence(), map);
+ acf.addMap(seq2.getDatasetSequence(), aseq1.getDatasetSequence(), map);
- assertEquals("[G, T, A]", Arrays.toString(acf.getMappedCodon(
- aseq1.getDatasetSequence(), 1)));
- assertEquals("[C, T, T]", Arrays.toString(acf.getMappedCodon(
- aseq1.getDatasetSequence(), 2)));
+ assertEquals(2, acf.getMappedCodons(aseq1.getDatasetSequence(), 1)
+ .size());
+ List<char[]> codonsForV = acf.getMappedCodons(
+ aseq1.getDatasetSequence(), 1);
+ assertEquals("[G, T, A]", Arrays.toString(codonsForV.get(0)));
+ assertEquals("[G, T, T]", Arrays.toString(codonsForV.get(1)));
+ List<char[]> codonsForL = acf.getMappedCodons(
+ aseq1.getDatasetSequence(), 2);
+ assertEquals("[C, T, T]", Arrays.toString(codonsForL.get(0)));
+ assertEquals("[T, T, A]", Arrays.toString(codonsForL.get(1)));
}
/**
* Test for the case where sequences have start > 1
*/
@Test(groups = { "Functional" })
- public void testGetMappedCodon_forSubSequences()
+ public void testGetMappedCodons_forSubSequences()
{
final Sequence seq1 = new Sequence("Seq1", "c-G-TA-gC-gT-T", 27, 35);
seq1.createDatasetSequence();
- final Sequence aseq1 = new Sequence("Seq1", "-P-R", 12, 13);
+ final Sequence aseq1 = new Sequence("Seq1", "-V-L", 12, 13);
aseq1.createDatasetSequence();
/*
new int[] { 12, 13 }, 3, 1);
acf.addMap(seq1.getDatasetSequence(), aseq1.getDatasetSequence(), map);
- assertEquals("[G, T, A]", Arrays.toString(acf.getMappedCodon(
- aseq1.getDatasetSequence(), 12)));
- assertEquals("[C, T, T]", Arrays.toString(acf.getMappedCodon(
- aseq1.getDatasetSequence(), 13)));
+ assertEquals(
+ "[G, T, A]",
+ Arrays.toString(acf.getMappedCodons(aseq1.getDatasetSequence(),
+ 12).get(0)));
+ assertEquals(
+ "[C, T, T]",
+ Arrays.toString(acf.getMappedCodons(aseq1.getDatasetSequence(),
+ 13).get(0)));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testCouldReplaceSequence()
+ {
+ SequenceI seq1 = new Sequence("Seq1/10-21", "aaacccgggttt");
+ SequenceI seq1proxy = new SequenceDummy("Seq1");
+
+ // map to region within sequence is ok
+ assertTrue(AlignedCodonFrame.couldRealiseSequence(seq1proxy, seq1, 12,
+ 17));
+ // map to region overlapping sequence is ok
+ assertTrue(AlignedCodonFrame.couldRealiseSequence(seq1proxy, seq1, 5,
+ 10));
+ assertTrue(AlignedCodonFrame.couldRealiseSequence(seq1proxy, seq1, 21,
+ 26));
+ // map to region before sequence is not ok
+ assertFalse(AlignedCodonFrame.couldRealiseSequence(seq1proxy, seq1, 4,
+ 9));
+ // map to region after sequence is not ok
+ assertFalse(AlignedCodonFrame.couldRealiseSequence(seq1proxy, seq1, 22,
+ 27));
+
+ /*
+ * test should fail if name doesn't match
+ */
+ seq1proxy.setName("Seq1a");
+ assertFalse(AlignedCodonFrame.couldRealiseSequence(seq1proxy, seq1, 12,
+ 17));
+ seq1proxy.setName("Seq1");
+ seq1.setName("Seq1a");
+ assertFalse(AlignedCodonFrame.couldRealiseSequence(seq1proxy, seq1, 12,
+ 17));
+
+ /*
+ * a dummy sequence can't replace a real one
+ */
+ assertFalse(AlignedCodonFrame.couldRealiseSequence(seq1, seq1proxy, 12,
+ 17));
+
+ /*
+ * a dummy sequence can't replace a dummy sequence
+ */
+ SequenceI seq1proxy2 = new SequenceDummy("Seq1");
+ assertFalse(AlignedCodonFrame.couldRealiseSequence(seq1proxy,
+ seq1proxy2, 12, 17));
+
+ /*
+ * a real sequence can't replace a real one
+ */
+ SequenceI seq1a = new Sequence("Seq1/10-21", "aaacccgggttt");
+ assertFalse(AlignedCodonFrame.couldRealiseSequence(seq1, seq1a, 12, 17));
+ }
+
+ /**
+ * Tests for the method that tests whether any mapping to a dummy sequence can
+ * be 'realised' to a given real sequence
+ */
+ @Test(groups = { "Functional" })
+ public void testIsRealisableWith()
+ {
+ SequenceI seq1 = new Sequence("Seq1", "tttaaaCCCGGGtttaaa");
+ SequenceI seq2 = new Sequence("Seq2", "PG");
+ SequenceI seq1proxy = new SequenceDummy("Seq1");
+ seq1.createDatasetSequence();
+ seq2.createDatasetSequence();
+ MapList mapList = new MapList(new int[] { 7, 12 }, new int[] { 2, 3 },
+ 3, 1);
+ AlignedCodonFrame acf = new AlignedCodonFrame();
+ acf.addMap(seq1proxy, seq2, mapList);
+
+ /*
+ * Seq2 is mapped to SequenceDummy seq1proxy bases 4-9
+ * This is 'realisable' from real sequence Seq1
+ */
+ assertTrue(acf.isRealisableWith(seq1));
+
+ /*
+ * test should fail if name doesn't match
+ */
+ seq1proxy.setName("Seq1a");
+ assertFalse(acf.isRealisableWith(seq1));
+ seq1proxy.setName("Seq1");
+
+ SequenceI seq1ds = seq1.getDatasetSequence();
+ seq1ds.setName("Seq1a");
+ assertFalse(acf.isRealisableWith(seq1));
+ seq1ds.setName("Seq1");
+
+ /*
+ * test should fail if no sequence overlap with mapping of bases 7-12
+ * use artificial start/end values to test this
+ */
+ seq1ds.setStart(1);
+ seq1ds.setEnd(6);
+ // seq1 precedes mapped region:
+ assertFalse(acf.isRealisableWith(seq1));
+ seq1ds.setEnd(7);
+ // seq1 includes first mapped base:
+ assertTrue(acf.isRealisableWith(seq1));
+ seq1ds.setStart(13);
+ seq1ds.setEnd(18);
+ // seq1 follows mapped region:
+ assertFalse(acf.isRealisableWith(seq1));
+ seq1ds.setStart(12);
+ // seq1 includes last mapped base:
+ assertTrue(acf.isRealisableWith(seq1));
+ }
+
+ /**
+ * Tests for the method that converts mappings to a dummy sequence to mappings
+ * to a compatible real sequence
+ */
+ @Test(groups = { "Functional" })
+ public void testRealiseWith()
+ {
+ SequenceI seq1 = new Sequence("Seq1", "tttCAACCCGGGtttaaa");
+ SequenceI seq2 = new Sequence("Seq2", "QPG");
+ SequenceI seq2a = new Sequence("Seq2a", "QPG");
+ SequenceI seq1proxy = new SequenceDummy("Seq1");
+ seq1.createDatasetSequence();
+ seq2.createDatasetSequence();
+ seq2a.createDatasetSequence();
+
+ /*
+ * Make mappings from Seq2 and Seq2a peptides to dummy sequence Seq1
+ */
+ AlignedCodonFrame acf = new AlignedCodonFrame();
+
+ // map PG to codons 7-12 (CCCGGG)
+ MapList mapping1 = new MapList(new int[] { 7, 12 }, new int[] { 2, 3 },
+ 3, 1);
+ acf.addMap(seq1proxy, seq2, mapping1);
+ acf.addMap(seq1proxy, seq2a, mapping1);
+
+ // map QP to codons 4-9 (CAACCC)
+ MapList mapping2 = new MapList(new int[] { 4, 9 }, new int[] { 1, 2 },
+ 3, 1);
+ acf.addMap(seq1proxy, seq2, mapping2);
+ acf.addMap(seq1proxy, seq2a, mapping2);
+
+ /*
+ * acf now has two mappings one from Seq1 to Seq2, one from Seq1 to Seq2a
+ */
+ assertEquals(2, acf.getdnaSeqs().length);
+ assertSame(seq1proxy, acf.getdnaSeqs()[0]);
+ assertSame(seq1proxy, acf.getdnaSeqs()[1]);
+ assertEquals(2, acf.getProtMappings().length);
+
+ // 'realise' these mappings with the compatible sequence seq1
+ // two mappings should be updated:
+ assertEquals(2, acf.realiseWith(seq1));
+ assertSame(seq1.getDatasetSequence(), acf.getdnaSeqs()[0]);
+ assertSame(seq1.getDatasetSequence(), acf.getdnaSeqs()[1]);
+ }
+
+ /**
+ * Test the method that locates the mapped codon for a protein position.
+ */
+ @Test(groups = { "Functional" })
+ public void testGetMappedRegion_eitherWay()
+ {
+ final Sequence seq1 = new Sequence("Seq1", "AAACCCGGGTTT");
+ seq1.createDatasetSequence();
+ final Sequence seq2 = new Sequence("Seq2", "KPGF");
+ seq2.createDatasetSequence();
+ final Sequence seq3 = new Sequence("Seq3", "QYKPGFSW");
+ seq3.createDatasetSequence();
+
+ /*
+ * map Seq1 to all of Seq2 and part of Seq3
+ */
+ AlignedCodonFrame acf = new AlignedCodonFrame();
+ MapList map = new MapList(new int[] { 1, 12 }, new int[] { 1, 4 }, 3, 1);
+ acf.addMap(seq1.getDatasetSequence(), seq2.getDatasetSequence(), map);
+ map = new MapList(new int[] { 1, 12 }, new int[] { 3, 6 }, 3, 1);
+ acf.addMap(seq1.getDatasetSequence(), seq3.getDatasetSequence(), map);
+
+ /*
+ * map part of Seq3 to Seq2
+ */
+ map = new MapList(new int[] { 3, 6 }, new int[] { 1, 4 }, 1, 1);
+ acf.addMap(seq3.getDatasetSequence(), seq2.getDatasetSequence(), map);
+
+ /*
+ * original case - locate mapped codon for protein position
+ */
+ assertArrayEquals(new int[] { 4, 6 },
+ acf.getMappedRegion(seq1, seq2, 2));
+ assertArrayEquals(new int[] { 7, 9 },
+ acf.getMappedRegion(seq1, seq3, 5));
+ assertNull(acf.getMappedRegion(seq1, seq3, 1));
+
+ /*
+ * locate mapped protein for protein position
+ */
+ assertArrayEquals(new int[] { 4, 4 },
+ acf.getMappedRegion(seq3, seq2, 2));
+
+ /*
+ * reverse location protein-to-protein
+ */
+ assertArrayEquals(new int[] { 2, 2 },
+ acf.getMappedRegion(seq2, seq3, 4));
+
+ /*
+ * reverse location protein-from-nucleotide
+ * any of codon [4, 5, 6] positions map to seq2/2
+ */
+ assertArrayEquals(new int[] { 2, 2 },
+ acf.getMappedRegion(seq2, seq1, 4));
+ assertArrayEquals(new int[] { 2, 2 },
+ acf.getMappedRegion(seq2, seq1, 5));
+ assertArrayEquals(new int[] { 2, 2 },
+ acf.getMappedRegion(seq2, seq1, 6));
}
}
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertNotNull;
+import static org.testng.AssertJUnit.assertNull;
+import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
import jalview.io.AppletFormatAdapter;
import jalview.util.MapList;
import java.io.IOException;
+import java.util.Arrays;
import java.util.Iterator;
+import java.util.List;
import org.testng.annotations.BeforeMethod;
import org.testng.annotations.Test;
((Alignment) al1).alignAs(al2, false, true);
assertEquals("ACG---GCUCCA------ACT", al1.getSequenceAt(0)
.getSequenceAsString());
- assertEquals("---CGT---TAACGA---AGT", al1.getSequenceAt(1)
+ assertEquals("---CGT---TAACGA---AGT---", al1.getSequenceAt(1)
.getSequenceAsString());
}
assertEquals("c--CCGgg-TT--T------AA-A", al1.getSequenceAt(1)
.getSequenceAsString());
}
+
+ @Test(groups = "Functional")
+ public void testCopyConstructor() throws IOException
+ {
+ AlignmentI protein = loadAlignment(AA_SEQS_1, FormatAdapter.PASTE);
+ // create sequence and alignment datasets
+ protein.setDataset(null);
+ AlignedCodonFrame acf = new AlignedCodonFrame();
+ List<AlignedCodonFrame> acfList = Arrays.asList(new AlignedCodonFrame[]
+ { acf });
+ protein.getDataset().setCodonFrames(acfList);
+ AlignmentI copy = new Alignment(protein);
+
+ /*
+ * copy has different aligned sequences but the same dataset sequences
+ */
+ assertFalse(copy.getSequenceAt(0) == protein.getSequenceAt(0));
+ assertFalse(copy.getSequenceAt(1) == protein.getSequenceAt(1));
+ assertSame(copy.getSequenceAt(0).getDatasetSequence(), protein
+ .getSequenceAt(0).getDatasetSequence());
+ assertSame(copy.getSequenceAt(1).getDatasetSequence(), protein
+ .getSequenceAt(1).getDatasetSequence());
+
+ // TODO should the copy constructor copy the dataset?
+ // or make a new one referring to the same dataset sequences??
+ assertNull(copy.getDataset());
+ // assertArrayEquals(copy.getDataset().getSequencesArray(), protein
+ // .getDataset().getSequencesArray());
+ }
+
+ /**
+ * Test behaviour of createDataset
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Functional")
+ public void testCreateDatasetAlignment() throws IOException
+ {
+ AlignmentI protein = new FormatAdapter().readFile(AA_SEQS_1,
+ AppletFormatAdapter.PASTE, "FASTA");
+ /*
+ * create a dataset sequence on first sequence
+ * leave the second without one
+ */
+ protein.getSequenceAt(0).createDatasetSequence();
+ assertNotNull(protein.getSequenceAt(0).getDatasetSequence());
+ assertNull(protein.getSequenceAt(1).getDatasetSequence());
+
+ /*
+ * add a mapping to the alignment
+ */
+ AlignedCodonFrame acf = new AlignedCodonFrame();
+ protein.addCodonFrame(acf);
+ assertNull(protein.getDataset());
+ assertTrue(protein.getCodonFrames().contains(acf));
+
+ /*
+ * create the alignment dataset
+ * note this creates sequence datasets where missing
+ * as a side-effect (in this case, on seq2
+ */
+ // TODO promote this method to AlignmentI
+ ((Alignment) protein).createDatasetAlignment();
+
+ // TODO this method should return AlignmentI not Alignment !!
+ Alignment ds = protein.getDataset();
+
+ // side-effect: dataset created on second sequence
+ assertNotNull(protein.getSequenceAt(1).getDatasetSequence());
+ // dataset alignment has references to dataset sequences
+ assertEquals(ds.getSequenceAt(0), protein.getSequenceAt(0)
+ .getDatasetSequence());
+ assertEquals(ds.getSequenceAt(1), protein.getSequenceAt(1)
+ .getDatasetSequence());
+
+ // codon frames should have been moved to the dataset
+ // getCodonFrames() should delegate to the dataset:
+ assertTrue(protein.getCodonFrames().contains(acf));
+ // prove the codon frames are indeed on the dataset:
+ assertTrue(ds.getCodonFrames().contains(acf));
+ }
+
+ @Test(groups = "Functional")
+ public void testAddCodonFrame()
+ {
+ AlignmentI align = new Alignment(new SequenceI[] {});
+ AlignedCodonFrame acf = new AlignedCodonFrame();
+ align.addCodonFrame(acf);
+ assertEquals(1, align.getCodonFrames().size());
+ assertTrue(align.getCodonFrames().contains(acf));
+ // can't add the same object twice:
+ align.addCodonFrame(acf);
+ assertEquals(1, align.getCodonFrames().size());
+
+ // create dataset alignment - mappings move to dataset
+ ((Alignment) align).createDatasetAlignment();
+ assertSame(align.getCodonFrames(), align.getDataset().getCodonFrames());
+ assertEquals(1, align.getCodonFrames().size());
+
+ AlignedCodonFrame acf2 = new AlignedCodonFrame();
+ align.addCodonFrame(acf2);
+ assertTrue(align.getDataset().getCodonFrames().contains(acf));
+ }
}
assertEquals("[[1, 6], [11, 13], [15, 20]]", result);
}
+ @Test(groups = { "Functional" })
+ public void testToString()
+ {
+ /*
+ * with no sequence
+ */
+ MapList fk = new MapList(new int[] { 1, 6, 8, 13 }, new int[] { 4, 7 },
+ 3, 1);
+ Mapping m = new Mapping(fk);
+ assertEquals("[ [1, 6] [8, 13] ] To [ [4, 7] ] ", m.toString());
+
+ /*
+ * with a sequence
+ */
+ SequenceI seq = new Sequence("Seq1", "");
+ m = new Mapping(seq, fk);
+ assertEquals("[ [1, 6] [8, 13] ] To [ [4, 7] ] Seq1", m.toString());
+ }
}
--- /dev/null
+package jalview.datamodel;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertSame;
+
+import jalview.datamodel.MappingType;
+
+import org.testng.annotations.Test;
+
+public class MappingTypeTest
+{
+
+ @Test(groups = "Functional")
+ public void testGetInverse()
+ {
+ assertSame(MappingType.PeptideToNucleotide,
+ MappingType.NucleotideToPeptide.getInverse());
+ assertSame(MappingType.NucleotideToPeptide,
+ MappingType.PeptideToNucleotide.getInverse());
+ assertSame(MappingType.NucleotideToNucleotide,
+ MappingType.NucleotideToNucleotide.getInverse());
+ assertSame(MappingType.PeptideToPeptide,
+ MappingType.PeptideToPeptide.getInverse());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFromRatio()
+ {
+ assertEquals(1, MappingType.NucleotideToNucleotide.getFromRatio());
+ assertEquals(1, MappingType.PeptideToNucleotide.getFromRatio());
+ assertEquals(1, MappingType.PeptideToPeptide.getFromRatio());
+ assertEquals(3, MappingType.NucleotideToPeptide.getFromRatio());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetToRatio()
+ {
+ assertEquals(1, MappingType.NucleotideToNucleotide.getToRatio());
+ assertEquals(3, MappingType.PeptideToNucleotide.getToRatio());
+ assertEquals(1, MappingType.PeptideToPeptide.getToRatio());
+ assertEquals(1, MappingType.NucleotideToPeptide.getToRatio());
+ }
+}
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
+import jalview.datamodel.SearchResults.Match;
+
import org.testng.annotations.Test;
public class SearchResultsTest
sr2.addResult(seq1, 6, 8);
assertEquals(sr1.hashCode(), sr2.hashCode());
}
+
+ /**
+ * Verify that SearchResults$Match constructor normalises start/end to the
+ * 'forwards' direction
+ */
+ @Test(groups = { "Functional" })
+ public void testMatchConstructor()
+ {
+ SequenceI seq1 = new Sequence("", "abcdefghijklm");
+ Match m = new SearchResults().new Match(seq1, 2, 5);
+ assertSame(seq1, m.getSequence());
+ assertEquals(2, m.getStart());
+ assertEquals(5, m.getEnd());
+
+ // now a reverse mapping:
+ m = new SearchResults().new Match(seq1, 5, 2);
+ assertSame(seq1, m.getSequence());
+ assertEquals(2, m.getStart());
+ assertEquals(5, m.getEnd());
+ }
}
import org.testng.annotations.Test;
+@Test
public class SequenceDummyTest
{
/**
--- /dev/null
+package jalview.datamodel;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertNull;
+import static org.testng.AssertJUnit.assertSame;
+import static org.testng.AssertJUnit.assertTrue;
+
+import org.testng.annotations.Test;
+
+public class SequenceFeatureTest
+{
+ @Test(groups = { "Functional" })
+ public void testCopyConstructor()
+ {
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 22, 33,
+ 12.5f, "group");
+ sf1.setValue("STRAND", "+");
+ sf1.setValue("Note", "Testing");
+ Integer count = new Integer(7);
+ sf1.setValue("Count", count);
+
+ SequenceFeature sf2 = new SequenceFeature(sf1);
+ assertEquals("type", sf2.getType());
+ assertEquals("desc", sf2.getDescription());
+ assertEquals(22, sf2.getBegin());
+ assertEquals(33, sf2.getEnd());
+ assertEquals("+", sf2.getValue("STRAND"));
+ assertEquals("Testing", sf2.getValue("Note"));
+ // shallow clone of otherDetails map - contains the same object values!
+ assertSame(count, sf2.getValue("Count"));
+ }
+
+ /**
+ * Tests for retrieving a 'miscellaneous details' property value, with or
+ * without a supplied default
+ */
+ @Test(groups = { "Functional" })
+ public void testGetValue()
+ {
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 22, 33,
+ 12.5f, "group");
+ sf1.setValue("STRAND", "+");
+ assertEquals("+", sf1.getValue("STRAND"));
+ assertNull(sf1.getValue("strand")); // case-sensitive
+ assertEquals(".", sf1.getValue("unknown", "."));
+ Integer i = new Integer(27);
+ assertSame(i, sf1.getValue("Unknown", i));
+ }
+
+ /**
+ * Tests the method that returns 1 / -1 / 0 for strand "+" / "-" / other
+ */
+ @Test(groups = { "Functional" })
+ public void testGetStrand()
+ {
+ SequenceFeature sf = new SequenceFeature("type", "desc", 22, 33, 12.5f,
+ "group");
+ assertEquals(0, sf.getStrand());
+ sf.setValue("STRAND", "+");
+ assertEquals(1, sf.getStrand());
+ sf.setValue("STRAND", "-");
+ assertEquals(-1, sf.getStrand());
+ sf.setValue("STRAND", ".");
+ assertEquals(0, sf.getStrand());
+ }
+
+ /**
+ * Tests for equality, and that equal objects have the same hashCode
+ */
+ @Test(groups = { "Functional" })
+ public void testEqualsAndHashCode()
+ {
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 22, 33,
+ 12.5f, "group");
+ sf1.setValue("ID", "id");
+ sf1.setValue("Name", "name");
+ sf1.setValue("Parent", "parent");
+ sf1.setStrand("+");
+ sf1.setPhase("1");
+ SequenceFeature sf2 = new SequenceFeature("type", "desc", 22, 33,
+ 12.5f, "group");
+ sf2.setValue("ID", "id");
+ sf2.setValue("Name", "name");
+ sf2.setValue("Parent", "parent");
+ sf2.setStrand("+");
+ sf2.setPhase("1");
+
+ assertFalse(sf1.equals(null));
+ assertTrue(sf1.equals(sf2));
+ assertTrue(sf2.equals(sf1));
+ assertEquals(sf1.hashCode(), sf2.hashCode());
+
+ // changing type breaks equals:
+ sf2.setType("Type");
+ assertFalse(sf1.equals(sf2));
+
+ // changing description breaks equals:
+ sf2.setType("type");
+ sf2.setDescription("Desc");
+ assertFalse(sf1.equals(sf2));
+
+ // changing start position breaks equals:
+ sf2.setDescription("desc");
+ sf2.setBegin(21);
+ assertFalse(sf1.equals(sf2));
+
+ // changing end position breaks equals:
+ sf2.setBegin(22);
+ sf2.setEnd(32);
+ assertFalse(sf1.equals(sf2));
+
+ // changing feature group breaks equals:
+ sf2.setEnd(33);
+ sf2.setFeatureGroup("Group");
+ assertFalse(sf1.equals(sf2));
+
+ // changing ID breaks equals:
+ sf2.setFeatureGroup("group");
+ sf2.setValue("ID", "id2");
+ assertFalse(sf1.equals(sf2));
+
+ // changing Name breaks equals:
+ sf2.setValue("ID", "id");
+ sf2.setValue("Name", "Name");
+ assertFalse(sf1.equals(sf2));
+
+ // changing Parent breaks equals:
+ sf2.setValue("Name", "name");
+ sf1.setValue("Parent", "Parent");
+ assertFalse(sf1.equals(sf2));
+
+ // changing strand breaks equals:
+ sf1.setValue("Parent", "parent");
+ sf2.setStrand("-");
+ assertFalse(sf1.equals(sf2));
+
+ // changing phase breaks equals:
+ sf2.setStrand("+");
+ sf1.setPhase("2");
+ assertFalse(sf1.equals(sf2));
+
+ // restore equality as sanity check:
+ sf1.setPhase("1");
+ assertTrue(sf1.equals(sf2));
+ assertTrue(sf2.equals(sf1));
+ assertEquals(sf1.hashCode(), sf2.hashCode());
+
+ // changing status doesn't change equals:
+ sf1.setStatus("new");
+ assertTrue(sf1.equals(sf2));
+ }
+}
package jalview.datamodel;
import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertNotNull;
import static org.testng.AssertJUnit.assertNull;
import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
+import jalview.datamodel.PDBEntry.Type;
+
import java.util.Arrays;
import java.util.List;
+import java.util.Vector;
import org.testng.annotations.BeforeMethod;
import org.testng.annotations.Test;
assertEquals(2, anns.length);
assertSame(annotation, anns[0]);
assertSame(annotation2, anns[1]);
-
}
@Test(groups = { "Functional" })
public void testGetStartGetEnd()
{
- SequenceI seq = new Sequence("test", "ABCDEF");
- assertEquals(1, seq.getStart());
- assertEquals(6, seq.getEnd());
+ SequenceI sq = new Sequence("test", "ABCDEF");
+ assertEquals(1, sq.getStart());
+ assertEquals(6, sq.getEnd());
- seq = new Sequence("test", "--AB-C-DEF--");
- assertEquals(1, seq.getStart());
- assertEquals(6, seq.getEnd());
+ sq = new Sequence("test", "--AB-C-DEF--");
+ assertEquals(1, sq.getStart());
+ assertEquals(6, sq.getEnd());
- seq = new Sequence("test", "----");
- assertEquals(1, seq.getStart());
- assertEquals(0, seq.getEnd()); // ??
+ sq = new Sequence("test", "----");
+ assertEquals(1, sq.getStart());
+ assertEquals(0, sq.getEnd()); // ??
}
/**
@Test(groups = { "Functional" })
public void testFindIndex()
{
- SequenceI seq = new Sequence("test", "ABCDEF");
- assertEquals(0, seq.findIndex(0));
- assertEquals(1, seq.findIndex(1));
- assertEquals(5, seq.findIndex(5));
- assertEquals(6, seq.findIndex(6));
- assertEquals(6, seq.findIndex(9));
-
- seq = new Sequence("test", "-A--B-C-D-E-F--");
- assertEquals(2, seq.findIndex(1));
- assertEquals(5, seq.findIndex(2));
- assertEquals(7, seq.findIndex(3));
+ SequenceI sq = new Sequence("test", "ABCDEF");
+ assertEquals(0, sq.findIndex(0));
+ assertEquals(1, sq.findIndex(1));
+ assertEquals(5, sq.findIndex(5));
+ assertEquals(6, sq.findIndex(6));
+ assertEquals(6, sq.findIndex(9));
+
+ sq = new Sequence("test", "-A--B-C-D-E-F--");
+ assertEquals(2, sq.findIndex(1));
+ assertEquals(5, sq.findIndex(2));
+ assertEquals(7, sq.findIndex(3));
// before start returns 0
- assertEquals(0, seq.findIndex(0));
- assertEquals(0, seq.findIndex(-1));
+ assertEquals(0, sq.findIndex(0));
+ assertEquals(0, sq.findIndex(-1));
// beyond end returns last residue column
- assertEquals(13, seq.findIndex(99));
+ assertEquals(13, sq.findIndex(99));
}
@Test(groups = { "Functional" })
public void testFindPosition()
{
- SequenceI seq = new Sequence("test", "ABCDEF");
- assertEquals(1, seq.findPosition(0));
- assertEquals(6, seq.findPosition(5));
+ SequenceI sq = new Sequence("test", "ABCDEF");
+ assertEquals(1, sq.findPosition(0));
+ assertEquals(6, sq.findPosition(5));
// assertEquals(-1, seq.findPosition(6)); // fails
- seq = new Sequence("test", "AB-C-D--");
- assertEquals(1, seq.findPosition(0));
- assertEquals(2, seq.findPosition(1));
+ sq = new Sequence("test", "AB-C-D--");
+ assertEquals(1, sq.findPosition(0));
+ assertEquals(2, sq.findPosition(1));
// gap position 'finds' residue to the right (not the left as per javadoc)
- assertEquals(3, seq.findPosition(2));
- assertEquals(3, seq.findPosition(3));
- assertEquals(4, seq.findPosition(4));
- assertEquals(4, seq.findPosition(5));
+ assertEquals(3, sq.findPosition(2));
+ assertEquals(3, sq.findPosition(3));
+ assertEquals(4, sq.findPosition(4));
+ assertEquals(4, sq.findPosition(5));
// returns 1 more than sequence length if off the end ?!?
- assertEquals(5, seq.findPosition(6));
- assertEquals(5, seq.findPosition(7));
-
- seq = new Sequence("test", "--AB-C-DEF--");
- assertEquals(1, seq.findPosition(0));
- assertEquals(1, seq.findPosition(1));
- assertEquals(1, seq.findPosition(2));
- assertEquals(2, seq.findPosition(3));
- assertEquals(3, seq.findPosition(4));
- assertEquals(3, seq.findPosition(5));
- assertEquals(4, seq.findPosition(6));
- assertEquals(4, seq.findPosition(7));
- assertEquals(5, seq.findPosition(8));
- assertEquals(6, seq.findPosition(9));
- assertEquals(7, seq.findPosition(10));
- assertEquals(7, seq.findPosition(11));
+ assertEquals(5, sq.findPosition(6));
+ assertEquals(5, sq.findPosition(7));
+
+ sq = new Sequence("test", "--AB-C-DEF--");
+ assertEquals(1, sq.findPosition(0));
+ assertEquals(1, sq.findPosition(1));
+ assertEquals(1, sq.findPosition(2));
+ assertEquals(2, sq.findPosition(3));
+ assertEquals(3, sq.findPosition(4));
+ assertEquals(3, sq.findPosition(5));
+ assertEquals(4, sq.findPosition(6));
+ assertEquals(4, sq.findPosition(7));
+ assertEquals(5, sq.findPosition(8));
+ assertEquals(6, sq.findPosition(9));
+ assertEquals(7, sq.findPosition(10));
+ assertEquals(7, sq.findPosition(11));
}
@Test(groups = { "Functional" })
public void testDeleteChars()
{
- SequenceI seq = new Sequence("test", "ABCDEF");
- assertEquals(1, seq.getStart());
- assertEquals(6, seq.getEnd());
- seq.deleteChars(2, 3);
- assertEquals("ABDEF", seq.getSequenceAsString());
- assertEquals(1, seq.getStart());
- assertEquals(5, seq.getEnd());
-
- seq = new Sequence("test", "ABCDEF");
- seq.deleteChars(0, 2);
- assertEquals("CDEF", seq.getSequenceAsString());
- assertEquals(3, seq.getStart());
- assertEquals(6, seq.getEnd());
+ SequenceI sq = new Sequence("test", "ABCDEF");
+ assertEquals(1, sq.getStart());
+ assertEquals(6, sq.getEnd());
+ sq.deleteChars(2, 3);
+ assertEquals("ABDEF", sq.getSequenceAsString());
+ assertEquals(1, sq.getStart());
+ assertEquals(5, sq.getEnd());
+
+ sq = new Sequence("test", "ABCDEF");
+ sq.deleteChars(0, 2);
+ assertEquals("CDEF", sq.getSequenceAsString());
+ assertEquals(3, sq.getStart());
+ assertEquals(6, sq.getEnd());
}
@Test(groups = { "Functional" })
public void testInsertCharAt()
{
// non-static methods:
- SequenceI seq = new Sequence("test", "ABCDEF");
- seq.insertCharAt(0, 'z');
- assertEquals("zABCDEF", seq.getSequenceAsString());
- seq.insertCharAt(2, 2, 'x');
- assertEquals("zAxxBCDEF", seq.getSequenceAsString());
+ SequenceI sq = new Sequence("test", "ABCDEF");
+ sq.insertCharAt(0, 'z');
+ assertEquals("zABCDEF", sq.getSequenceAsString());
+ sq.insertCharAt(2, 2, 'x');
+ assertEquals("zAxxBCDEF", sq.getSequenceAsString());
// for static method see StringUtilsTest
}
@Test(groups = { "Functional" })
public void testGapMap()
{
- SequenceI seq = new Sequence("test", "-A--B-CD-E--F-");
- seq.createDatasetSequence();
- assertEquals("[1, 4, 6, 7, 9, 12]", Arrays.toString(seq.gapMap()));
+ SequenceI sq = new Sequence("test", "-A--B-CD-E--F-");
+ sq.createDatasetSequence();
+ assertEquals("[1, 4, 6, 7, 9, 12]", Arrays.toString(sq.gapMap()));
}
/**
@Test(groups = { "Functional" })
public void testGetSequenceFeatures()
{
- SequenceI seq = new Sequence("test", "GATCAT");
- seq.createDatasetSequence();
+ SequenceI sq = new Sequence("test", "GATCAT");
+ sq.createDatasetSequence();
- assertNull(seq.getSequenceFeatures());
+ assertNull(sq.getSequenceFeatures());
/*
* SequenceFeature on sequence
*/
SequenceFeature sf = new SequenceFeature();
- seq.addSequenceFeature(sf);
- SequenceFeature[] sfs = seq.getSequenceFeatures();
+ sq.addSequenceFeature(sf);
+ SequenceFeature[] sfs = sq.getSequenceFeatures();
assertEquals(1, sfs.length);
assertSame(sf, sfs[0]);
* sequence
*/
SequenceFeature sf2 = new SequenceFeature();
- seq.getDatasetSequence().addSequenceFeature(sf2);
- sfs = seq.getSequenceFeatures();
+ sq.getDatasetSequence().addSequenceFeature(sf2);
+ sfs = sq.getSequenceFeatures();
assertEquals(1, sfs.length);
assertSame(sf, sfs[0]);
/*
* SequenceFeature on dataset sequence only
*/
- seq.setSequenceFeatures(null);
- sfs = seq.getSequenceFeatures();
+ sq.setSequenceFeatures(null);
+ sfs = sq.getSequenceFeatures();
assertEquals(1, sfs.length);
assertSame(sf2, sfs[0]);
* Corrupt case - no SequenceFeature, dataset's dataset is the original
* sequence. Test shows no infinite loop results.
*/
- seq.getDatasetSequence().setSequenceFeatures(null);
- seq.getDatasetSequence().setDatasetSequence(seq); // loop!
- assertNull(seq.getSequenceFeatures());
+ sq.getDatasetSequence().setSequenceFeatures(null);
+ sq.getDatasetSequence().setDatasetSequence(sq); // loop!
+ assertNull(sq.getSequenceFeatures());
}
/**
* right. Also it returns a non-existent residue position for a gap beyond
* the sequence.
*/
- Sequence seq = new Sequence("TestSeq", "AB.C-D E.");
- int[] map = seq.findPositionMap();
+ Sequence sq = new Sequence("TestSeq", "AB.C-D E.");
+ int[] map = sq.findPositionMap();
assertEquals(Arrays.toString(new int[] { 1, 2, 3, 3, 4, 4, 5, 5, 6 }),
Arrays.toString(map));
}
@Test(groups = { "Functional" })
public void testGetSubsequence()
{
- SequenceI seq = new Sequence("TestSeq", "ABCDEFG");
- seq.createDatasetSequence();
+ SequenceI sq = new Sequence("TestSeq", "ABCDEFG");
+ sq.createDatasetSequence();
// positions are base 0, end position is exclusive
- SequenceI subseq = seq.getSubSequence(2, 4);
+ SequenceI subseq = sq.getSubSequence(2, 4);
assertEquals("CD", subseq.getSequenceAsString());
// start/end are base 1 positions
assertEquals(3, subseq.getStart());
assertEquals(4, subseq.getEnd());
// subsequence shares the full dataset sequence
- assertSame(seq.getDatasetSequence(), subseq.getDatasetSequence());
+ assertSame(sq.getDatasetSequence(), subseq.getDatasetSequence());
}
/**
@Test(groups = { "Functional" })
public void testDeriveSequence_existingDataset()
{
- SequenceI seq = new Sequence("Seq1", "CD");
- seq.setDatasetSequence(new Sequence("Seq1", "ABCDEF"));
- seq.setStart(3);
- seq.setEnd(4);
- SequenceI derived = seq.deriveSequence();
+ SequenceI sq = new Sequence("Seq1", "CD");
+ sq.setDatasetSequence(new Sequence("Seq1", "ABCDEF"));
+ sq.getDatasetSequence().addSequenceFeature(
+ new SequenceFeature("", "", 1, 2, 0f, null));
+ sq.setStart(3);
+ sq.setEnd(4);
+ SequenceI derived = sq.deriveSequence();
assertEquals("CD", derived.getSequenceAsString());
- assertSame(seq.getDatasetSequence(), derived.getDatasetSequence());
+ assertSame(sq.getDatasetSequence(), derived.getDatasetSequence());
+
+ assertNull(((Sequence) seq).sequenceFeatures);
+ assertNull(((Sequence) derived).sequenceFeatures);
+ assertNotNull(seq.getSequenceFeatures());
+ assertSame(seq.getSequenceFeatures(), derived.getSequenceFeatures());
}
/**
@Test(groups = { "Functional" })
public void testDeriveSequence_noDatasetUngapped()
{
- SequenceI seq = new Sequence("Seq1", "ABCDEF");
- assertEquals(1, seq.getStart());
- assertEquals(6, seq.getEnd());
- SequenceI derived = seq.deriveSequence();
+ SequenceI sq = new Sequence("Seq1", "ABCDEF");
+ assertEquals(1, sq.getStart());
+ assertEquals(6, sq.getEnd());
+ SequenceI derived = sq.deriveSequence();
assertEquals("ABCDEF", derived.getSequenceAsString());
assertEquals("ABCDEF", derived.getDatasetSequence()
.getSequenceAsString());
@Test(groups = { "Functional" })
public void testDeriveSequence_noDatasetGapped()
{
- SequenceI seq = new Sequence("Seq1", "AB-C.D EF");
- assertEquals(1, seq.getStart());
- assertEquals(6, seq.getEnd());
- assertNull(seq.getDatasetSequence());
- SequenceI derived = seq.deriveSequence();
+ SequenceI sq = new Sequence("Seq1", "AB-C.D EF");
+ assertEquals(1, sq.getStart());
+ assertEquals(6, sq.getEnd());
+ assertNull(sq.getDatasetSequence());
+ SequenceI derived = sq.deriveSequence();
assertEquals("AB-C.D EF", derived.getSequenceAsString());
assertEquals("ABCDEF", derived.getDatasetSequence()
.getSequenceAsString());
}
+
+ @Test(groups = { "Functional" })
+ public void testCopyConstructor_noDataset()
+ {
+ SequenceI seq1 = new Sequence("Seq1", "AB-C.D EF");
+ seq1.setDescription("description");
+ seq1.addAlignmentAnnotation(new AlignmentAnnotation("label", "desc",
+ 1.3d));
+ seq1.addSequenceFeature(new SequenceFeature("type", "desc", 22, 33,
+ 12.4f, "group"));
+ seq1.addPDBId(new PDBEntry("1A70", "B", Type.PDB, "File"));
+ seq1.addDBRef(new DBRefEntry("EMBL", "1.2", "AZ12345"));
+
+ SequenceI copy = new Sequence(seq1);
+
+ assertNull(copy.getDatasetSequence());
+
+ verifyCopiedSequence(seq1, copy);
+
+ // copy has a copy of the DBRefEntry
+ // this is murky - DBrefs are only copied for dataset sequences
+ // where the test for 'dataset sequence' is 'dataset is null'
+ // but that doesn't distinguish it from an aligned sequence
+ // which has not yet generated a dataset sequence
+ // NB getDBRef looks inside dataset sequence if not null
+ DBRefEntry[] dbrefs = copy.getDBRefs();
+ assertEquals(1, dbrefs.length);
+ assertFalse(dbrefs[0] == seq1.getDBRefs()[0]);
+ assertTrue(dbrefs[0].equals(seq1.getDBRefs()[0]));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testCopyConstructor_withDataset()
+ {
+ SequenceI seq1 = new Sequence("Seq1", "AB-C.D EF");
+ seq1.createDatasetSequence();
+ seq1.setDescription("description");
+ seq1.addAlignmentAnnotation(new AlignmentAnnotation("label", "desc",
+ 1.3d));
+ seq1.addSequenceFeature(new SequenceFeature("type", "desc", 22, 33,
+ 12.4f, "group"));
+ seq1.addPDBId(new PDBEntry("1A70", "B", Type.PDB, "File"));
+ // here we add DBRef to the dataset sequence:
+ seq1.getDatasetSequence().addDBRef(
+ new DBRefEntry("EMBL", "1.2", "AZ12345"));
+
+ SequenceI copy = new Sequence(seq1);
+
+ assertNotNull(copy.getDatasetSequence());
+ assertSame(copy.getDatasetSequence(), seq1.getDatasetSequence());
+
+ verifyCopiedSequence(seq1, copy);
+
+ // getDBRef looks inside dataset sequence and this is shared,
+ // so holds the same dbref objects
+ DBRefEntry[] dbrefs = copy.getDBRefs();
+ assertEquals(1, dbrefs.length);
+ assertSame(dbrefs[0], seq1.getDBRefs()[0]);
+ }
+
+ /**
+ * Helper to make assertions about a copied sequence
+ *
+ * @param seq1
+ * @param copy
+ */
+ protected void verifyCopiedSequence(SequenceI seq1, SequenceI copy)
+ {
+ // verify basic properties:
+ assertEquals(copy.getName(), seq1.getName());
+ assertEquals(copy.getDescription(), seq1.getDescription());
+ assertEquals(copy.getStart(), seq1.getStart());
+ assertEquals(copy.getEnd(), seq1.getEnd());
+ assertEquals(copy.getSequenceAsString(), seq1.getSequenceAsString());
+
+ // copy has a copy of the annotation:
+ AlignmentAnnotation[] anns = copy.getAnnotation();
+ assertEquals(1, anns.length);
+ assertFalse(anns[0] == seq1.getAnnotation()[0]);
+ assertEquals(anns[0].label, seq1.getAnnotation()[0].label);
+ assertEquals(anns[0].description, seq1.getAnnotation()[0].description);
+ assertEquals(anns[0].score, seq1.getAnnotation()[0].score);
+
+ // copy has a copy of the sequence feature:
+ SequenceFeature[] sfs = copy.getSequenceFeatures();
+ assertEquals(1, sfs.length);
+ assertFalse(sfs[0] == seq1.getSequenceFeatures()[0]);
+ assertTrue(sfs[0].equals(seq1.getSequenceFeatures()[0]));
+
+ // copy has a copy of the PDB entry
+ Vector<PDBEntry> pdbs = copy.getAllPDBEntries();
+ assertEquals(1, pdbs.size());
+ assertFalse(pdbs.get(0) == seq1.getAllPDBEntries().get(0));
+ assertTrue(pdbs.get(0).equals(seq1.getAllPDBEntries().get(0)));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetCharAt()
+ {
+ SequenceI sq = new Sequence("", "abcde");
+ assertEquals('a', sq.getCharAt(0));
+ assertEquals('e', sq.getCharAt(4));
+ assertEquals(' ', sq.getCharAt(5));
+ assertEquals(' ', sq.getCharAt(-1));
+ }
}
--- /dev/null
+##gff-version 3
+# retrieved via http://rest.ensembl.org/overlap/id/ENSG00000157764?feature=gene&feature=transcript&feature=cds&content-type=text/x-gff3
+##sequence-region 7 140719327 140924764
+7 ensembl_havana gene 140719327 140722790 . + . ID=gene:ENSG00000090266;assembly_name=GRCh38;biotype=protein_coding;description=NADH dehydrogenase (ubiquinone) 1 beta subcomplex%2C 2%2C 8kDa [Source:HGNC Symbol%3BAcc:HGNC:7697];external_name=NDUFB2;logic_name=ensembl_havana_gene;version=11
+7 ensembl_havana gene 140719327 140924764 . - . ID=gene:ENSG00000157764;assembly_name=GRCh38;biotype=protein_coding;description=B-Raf proto-oncogene%2C serine/threonine kinase [Source:HGNC Symbol%3BAcc:HGNC:1097];external_name=BRAF;logic_name=ensembl_havana_gene;version=11
+7 ensembl snRNA_gene 140884072 140884178 . + . ID=gene:ENSG00000271932;assembly_name=GRCh38;biotype=snRNA;description=RNA%2C U6 small nuclear 85%2C pseudogene [Source:HGNC Symbol%3BAcc:HGNC:47048];external_name=RNU6-85P;logic_name=ncrna;version=1
+7 ensembl_havana transcript 140719327 140722790 . + . ID=transcript:ENST00000476279;Parent=gene:ENSG00000090266;assembly_name=GRCh38;biotype=protein_coding;external_name=NDUFB2-003;logic_name=havana;version=4
+7 ensembl_havana transcript 140719327 140721955 . + . ID=transcript:ENST00000461457;Parent=gene:ENSG00000090266;assembly_name=GRCh38;biotype=protein_coding;external_name=NDUFB2-004;logic_name=havana;version=1
+7 ensembl_havana transcript 140719327 140783157 . - . ID=transcript:ENST00000496384;Parent=gene:ENSG00000157764;assembly_name=GRCh38;biotype=protein_coding;external_name=BRAF-003;logic_name=havana;version=5
+7 ensembl_havana transcript 140734479 140924764 . - . ID=transcript:ENST00000288602;Parent=gene:ENSG00000157764;assembly_name=GRCh38;biotype=protein_coding;external_name=BRAF-001;logic_name=ensembl_havana_transcript;version=9
+7 ensembl_havana NMD_transcript_variant 140734521 140754211 . - . ID=transcript:ENST00000479537;Parent=gene:ENSG00000157764;assembly_name=GRCh38;biotype=nonsense_mediated_decay;external_name=BRAF-005;logic_name=havana;version=4
+7 ensembl_havana NMD_transcript_variant 140734597 140924658 . - . ID=transcript:ENST00000497784;Parent=gene:ENSG00000157764;assembly_name=GRCh38;biotype=nonsense_mediated_decay;external_name=BRAF-002;logic_name=havana;version=1
+7 ensembl_havana aberrant_processed_transcript 140834061 140924709 . - . ID=transcript:ENST00000469930;Parent=gene:ENSG00000157764;assembly_name=GRCh38;biotype=retained_intron;external_name=BRAF-004;logic_name=havana;version=1
+7 ensembl snRNA 140884072 140884178 . + . ID=transcript:ENST00000605989;Parent=gene:ENSG00000271932;assembly_name=GRCh38;biotype=snRNA;external_name=RNU6-85P-201;logic_name=ncrna;version=1
+7 havana CDS 140696745 140696842 . + 0 ID=CDS:ENSP00000419087;Parent=transcript:ENST00000476279;assembly_name=GRCh38
+7 havana CDS 140702866 140703010 . + 1 ID=CDS:ENSP00000419087;Parent=transcript:ENST00000476279;assembly_name=GRCh38
+7 havana CDS 140704860 140704934 . + 0 ID=CDS:ENSP00000419087;Parent=transcript:ENST00000476279;assembly_name=GRCh38
+7 havana CDS 140696745 140696842 . + 0 ID=CDS:ENSP00000420062;Parent=transcript:ENST00000461457;assembly_name=GRCh38
+7 havana CDS 140721552 140721744 . + 1 ID=CDS:ENSP00000420062;Parent=transcript:ENST00000461457;assembly_name=GRCh38
+7 havana CDS 140783021 140783157 . - 2 ID=CDS:ENSP00000419060;Parent=transcript:ENST00000496384;assembly_name=GRCh38
+7 havana CDS 140781576 140781693 . - 0 ID=CDS:ENSP00000419060;Parent=transcript:ENST00000496384;assembly_name=GRCh38
+7 havana CDS 140777991 140778075 . - 2 ID=CDS:ENSP00000419060;Parent=transcript:ENST00000496384;assembly_name=GRCh38
+7 havana CDS 140776912 140777088 . - 1 ID=CDS:ENSP00000419060;Parent=transcript:ENST00000496384;assembly_name=GRCh38
+7 havana CDS 140754187 140754233 . - 1 ID=CDS:ENSP00000419060;Parent=transcript:ENST00000496384;assembly_name=GRCh38
+7 havana CDS 140753275 140753393 . - 2 ID=CDS:ENSP00000419060;Parent=transcript:ENST00000496384;assembly_name=GRCh38
+7 havana CDS 140749287 140749418 . - 0 ID=CDS:ENSP00000419060;Parent=transcript:ENST00000496384;assembly_name=GRCh38
+7 havana CDS 140739812 140739946 . - 0 ID=CDS:ENSP00000419060;Parent=transcript:ENST00000496384;assembly_name=GRCh38
+7 havana CDS 140734617 140734770 . - 0 ID=CDS:ENSP00000419060;Parent=transcript:ENST00000496384;assembly_name=GRCh38
+7 havana CDS 140726494 140726516 . - 2 ID=CDS:ENSP00000419060;Parent=transcript:ENST00000496384;assembly_name=GRCh38
+7 ensembl_havana CDS 140924566 140924703 . - 0 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140850111 140850212 . - 0 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140834609 140834872 . - 0 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140808892 140808995 . - 0 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140807960 140808062 . - 1 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140801412 140801560 . - 0 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140800362 140800481 . - 1 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140794308 140794467 . - 1 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140787548 140787584 . - 0 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140783021 140783157 . - 2 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140781576 140781693 . - 0 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140777991 140778075 . - 2 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140776912 140777088 . - 1 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140754187 140754233 . - 1 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140753275 140753393 . - 2 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140749287 140749418 . - 0 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140739812 140739946 . - 0 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 ensembl_havana CDS 140734597 140734770 . - 0 ID=CDS:ENSP00000288602;Parent=transcript:ENST00000288602;assembly_name=GRCh38
+7 havana CDS 140754187 140754211 . - 0 ID=CDS:ENSP00000418033;Parent=transcript:ENST00000479537;assembly_name=GRCh38
+7 havana CDS 140753275 140753393 . - 2 ID=CDS:ENSP00000418033;Parent=transcript:ENST00000479537;assembly_name=GRCh38
+7 havana CDS 140749287 140749418 . - 0 ID=CDS:ENSP00000418033;Parent=transcript:ENST00000479537;assembly_name=GRCh38
+7 havana CDS 140747415 140747447 . - 0 ID=CDS:ENSP00000418033;Parent=transcript:ENST00000479537;assembly_name=GRCh38
+7 havana CDS 140924566 140924658 . - 0 ID=CDS:ENSP00000420119;Parent=transcript:ENST00000497784;assembly_name=GRCh38
+7 havana CDS 140850111 140850212 . - 0 ID=CDS:ENSP00000420119;Parent=transcript:ENST00000497784;assembly_name=GRCh38
+7 havana CDS 140834609 140834872 . - 0 ID=CDS:ENSP00000420119;Parent=transcript:ENST00000497784;assembly_name=GRCh38
+7 havana CDS 140808892 140808995 . - 0 ID=CDS:ENSP00000420119;Parent=transcript:ENST00000497784;assembly_name=GRCh38
+7 havana CDS 140808295 140808316 . - 1 ID=CDS:ENSP00000420119;Parent=transcript:ENST00000497784;assembly_name=GRCh38
--- /dev/null
+package jalview.ext.ensembl;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertNull;
+import static org.testng.AssertJUnit.assertTrue;
+
+import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyLite;
+import jalview.util.MapList;
+
+import java.util.List;
+
+import org.testng.Assert;
+import org.testng.annotations.AfterClass;
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.Test;
+
+public class EnsemblCdnaTest
+{
+ @BeforeClass
+ public void setUp()
+ {
+ SequenceOntologyFactory.setInstance(new SequenceOntologyLite());
+ }
+
+ @AfterClass
+ public void tearDown()
+ {
+ SequenceOntologyFactory.setInstance(null);
+ }
+ /**
+ * Test that the cdna part of genomic sequence is correctly identified by
+ * 'exon' features (or subtypes) - reverse strand case.
+ */
+ @Test(groups = "Functional")
+ public void testGetGenomicRangesFromFeatures_reverseStrand()
+ {
+ EnsemblCdna testee = new EnsemblCdna();
+ SequenceI genomic = new SequenceDummy("chr7");
+ genomic.setStart(10000);
+ genomic.setEnd(50000);
+ String transcriptId = "ABC123";
+
+ // exon at (start+10000) length 501
+ SequenceFeature sf = new SequenceFeature("exon", "", 20000, 20500, 0f,
+ null);
+ sf.setValue("Parent", "transcript:" + transcriptId);
+ sf.setStrand("-");
+ genomic.addSequenceFeature(sf);
+
+ // exon (sub-type) at (start + exon_variant) length 101
+ sf = new SequenceFeature("coding_exon", "", 10500, 10600, 0f, null);
+ sf.setValue("Parent", "transcript:" + transcriptId);
+ sf.setStrand("-");
+ genomic.addSequenceFeature(sf);
+
+ // exon belonging to a different transcript doesn't count
+ sf = new SequenceFeature("exon", "", 11500, 12600, 0f, null);
+ sf.setValue("Parent", "transcript:anotherOne");
+ genomic.addSequenceFeature(sf);
+
+ // transcript feature doesn't count
+ sf = new SequenceFeature("transcript", "", 10000, 50000, 0f, null);
+ genomic.addSequenceFeature(sf);
+
+ MapList ranges = testee.getGenomicRangesFromFeatures(genomic,
+ transcriptId, 23);
+ List<int[]> fromRanges = ranges.getFromRanges();
+ assertEquals(2, fromRanges.size());
+
+ /*
+ * from ranges should be sorted by start order descending
+ * and hold mappings from reverse strand sense
+ */
+ assertEquals(20500, fromRanges.get(0)[0]);
+ assertEquals(20000, fromRanges.get(0)[1]);
+ assertEquals(10600, fromRanges.get(1)[0]);
+ assertEquals(10500, fromRanges.get(1)[1]);
+ // to range should start from given start numbering
+ List<int[]> toRanges = ranges.getToRanges();
+ assertEquals(1, toRanges.size());
+ assertEquals(23, toRanges.get(0)[0]);
+ assertEquals(624, toRanges.get(0)[1]);
+ }
+
+ /**
+ * Test that the cdna part of genomic sequence is correctly identified by
+ * 'exon' features (or subtypes) with the desired transcript as parent
+ */
+ @Test(groups = "Functional")
+ public void testGetGenomicRangesFromFeatures()
+ {
+ EnsemblCdna testee = new EnsemblCdna();
+ SequenceI genomic = new SequenceDummy("chr7");
+ genomic.setStart(10000);
+ genomic.setEnd(50000);
+ String transcriptId = "ABC123";
+
+ // exon at (start+10000) length 501
+ SequenceFeature sf = new SequenceFeature("exon", "", 20000, 20500, 0f,
+ null);
+ sf.setValue("Parent", "transcript:" + transcriptId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ // exon (sub-type) at (start + exon_variant) length 101
+ sf = new SequenceFeature("coding_exon", "", 10500, 10600, 0f, null);
+ sf.setValue("Parent", "transcript:" + transcriptId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ // exon belonging to a different transcript doesn't count
+ sf = new SequenceFeature("exon", "", 11500, 12600, 0f, null);
+ sf.setValue("Parent", "transcript:anotherOne");
+ genomic.addSequenceFeature(sf);
+
+ // transcript feature doesn't count
+ sf = new SequenceFeature("transcript", "", 10000, 50000, 0f, null);
+ sf.setStrand("-"); // weird but ignored
+ genomic.addSequenceFeature(sf);
+
+ MapList ranges = testee.getGenomicRangesFromFeatures(genomic,
+ transcriptId, 23);
+ List<int[]> fromRanges = ranges.getFromRanges();
+ assertEquals(2, fromRanges.size());
+ // from ranges should be sorted by start order
+ assertEquals(10500, fromRanges.get(0)[0]);
+ assertEquals(10600, fromRanges.get(0)[1]);
+ assertEquals(20000, fromRanges.get(1)[0]);
+ assertEquals(20500, fromRanges.get(1)[1]);
+ // to range should start from given start numbering
+ List<int[]> toRanges = ranges.getToRanges();
+ assertEquals(1, toRanges.size());
+ assertEquals(23, toRanges.get(0)[0]);
+ assertEquals(624, toRanges.get(0)[1]);
+ }
+
+ /**
+ * The method under test should give up and return null if both forward and
+ * reverse strands are present in the features of interest
+ */
+ @Test(groups = "Functional")
+ public void testGetGenomicRangesFromFeatures_mixedStrand()
+ {
+ EnsemblCdna testee = new EnsemblCdna();
+ SequenceI genomic = new SequenceDummy("chr7");
+ genomic.setStart(10000);
+ genomic.setEnd(50000);
+ String transcriptId = "ABC123";
+
+ SequenceFeature sf = new SequenceFeature("exon", "", 20000, 20500, 0f,
+ null);
+ sf.setValue("Parent", "transcript:" + transcriptId);
+ sf.setStrand("-");
+ genomic.addSequenceFeature(sf);
+
+ sf = new SequenceFeature("coding_exon", "", 10500, 10600, 0f, null);
+ sf.setValue("Parent", "transcript:" + transcriptId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ MapList ranges = testee.getGenomicRangesFromFeatures(genomic,
+ transcriptId, 23);
+ assertNull(ranges);
+ }
+
+ /**
+ * Test the method that retains features except for 'transcript' (or
+ * subtypes), or features with parent other than the given id
+ */
+ @Test(groups = "Functional")
+ public void testRetainFeature()
+ {
+ String accId = "ABC123";
+ EnsemblCdna testee = new EnsemblCdna();
+
+ SequenceFeature sf = new SequenceFeature("transcript", "", 20000,
+ 20500, 0f, null);
+ assertFalse(testee.retainFeature(sf, accId));
+
+ sf.setType("aberrant_processed_transcript");
+ assertFalse(testee.retainFeature(sf, accId));
+
+ sf.setType("NMD_transcript_variant");
+ assertFalse(testee.retainFeature(sf, accId));
+
+ // other feature with no parent is retained
+ sf.setType("sequence_variant");
+ assertTrue(testee.retainFeature(sf, accId));
+
+ // other feature with desired parent is retained
+ sf.setValue("Parent", "transcript:" + accId);
+ assertTrue(testee.retainFeature(sf, accId));
+
+ // feature with wrong parent is not retained
+ sf.setValue("Parent", "transcript:XYZ");
+ assertFalse(testee.retainFeature(sf, accId));
+ }
+
+ /**
+ * Test the method that picks out 'exon' (or subtype) features with the
+ * accession id as parent
+ */
+ @Test(groups = "Functional")
+ public void testIdentifiesSequence()
+ {
+ String accId = "ABC123";
+ EnsemblCdna testee = new EnsemblCdna();
+
+ // exon with no parent not valid
+ SequenceFeature sf = new SequenceFeature("exon", "", 1, 2, 0f, null);
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // exon with wrong parent not valid
+ sf.setValue("Parent", "transcript:XYZ");
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // exon with right parent is valid
+ sf.setValue("Parent", "transcript:" + accId);
+ assertTrue(testee.identifiesSequence(sf, accId));
+
+ // exon sub-type with right parent is valid
+ sf.setType("coding_exon");
+ assertTrue(testee.identifiesSequence(sf, accId));
+
+ // transcript not valid:
+ sf.setType("transcript");
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // CDS not valid:
+ sf.setType("CDS");
+ assertFalse(testee.identifiesSequence(sf, accId));
+ }
+
+ @Test(groups = "Functional")
+ public void testIsValidReference() throws Exception
+ {
+ EnsemblSequenceFetcher esq = new EnsemblCdna();
+ Assert.assertTrue(esq.isValidReference("CCDS5863.1"));
+ Assert.assertTrue(esq.isValidReference("ENST00000288602"));
+ Assert.assertTrue(esq.isValidReference("ENSG00000288602"));
+ Assert.assertFalse(esq.isValidReference("ENSP00000288602"));
+ Assert.assertFalse(esq.isValidReference("ENST0000288602"));
+ // non-human species having a 3 character identifier included:
+ Assert.assertTrue(esq.isValidReference("ENSMUSG00000099398"));
+ }
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertTrue;
+
+import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyLite;
+import jalview.util.MapList;
+
+import java.util.List;
+
+import org.testng.Assert;
+import org.testng.annotations.AfterClass;
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.Test;
+
+public class EnsemblCdsTest
+{
+ @BeforeClass
+ public void setUp()
+ {
+ SequenceOntologyFactory.setInstance(new SequenceOntologyLite());
+ }
+
+ @AfterClass
+ public void tearDown()
+ {
+ SequenceOntologyFactory.setInstance(null);
+ }
+
+ /**
+ * Test that the cdna part of genomic sequence is correctly identified by
+ * 'CDS' features (or subtypes) with the desired transcript as parent
+ */
+ @Test(groups = "Functional")
+ public void testGetGenomicRangesFromFeatures()
+ {
+ EnsemblCds testee = new EnsemblCds();
+ SequenceI genomic = new SequenceDummy("chr7");
+ genomic.setStart(10000);
+ genomic.setEnd(50000);
+ String transcriptId = "ABC123";
+
+ // CDS at (start+10000) length 501
+ SequenceFeature sf = new SequenceFeature("CDS", "", 20000, 20500, 0f,
+ null);
+ sf.setValue("Parent", "transcript:" + transcriptId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ // CDS (sub-type) at (start + 10500) length 101
+ sf = new SequenceFeature("CDS_predicted", "", 10500, 10600, 0f, null);
+ sf.setValue("Parent", "transcript:" + transcriptId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ // CDS belonging to a different transcript doesn't count
+ sf = new SequenceFeature("CDS", "", 11500, 12600, 0f, null);
+ sf.setValue("Parent", "transcript:anotherOne");
+ genomic.addSequenceFeature(sf);
+
+ // exon feature doesn't count
+ sf = new SequenceFeature("exon", "", 10000, 50000, 0f, null);
+ genomic.addSequenceFeature(sf);
+
+ // mRNA_region feature doesn't count (parent of CDS)
+ sf = new SequenceFeature("mRNA_region", "", 10000, 50000, 0f, null);
+ genomic.addSequenceFeature(sf);
+
+ MapList ranges = testee.getGenomicRangesFromFeatures(genomic,
+ transcriptId, 23);
+ List<int[]> fromRanges = ranges.getFromRanges();
+ assertEquals(2, fromRanges.size());
+ // from ranges should be sorted by start order
+ assertEquals(10500, fromRanges.get(0)[0]);
+ assertEquals(10600, fromRanges.get(0)[1]);
+ assertEquals(20000, fromRanges.get(1)[0]);
+ assertEquals(20500, fromRanges.get(1)[1]);
+ // to range should start from given start numbering
+ List<int[]> toRanges = ranges.getToRanges();
+ assertEquals(1, toRanges.size());
+ assertEquals(23, toRanges.get(0)[0]);
+ assertEquals(624, toRanges.get(0)[1]);
+ }
+
+ /**
+ * Test the method that retains features except for 'CDS' (or subtypes), or
+ * features with parent other than the given id
+ */
+ @Test(groups = "Functional")
+ public void testRetainFeature()
+ {
+ String accId = "ABC123";
+ EnsemblCds testee = new EnsemblCds();
+
+ SequenceFeature sf = new SequenceFeature("CDS", "", 20000,
+ 20500, 0f, null);
+ assertFalse(testee.retainFeature(sf, accId));
+
+ sf.setType("CDS_predicted");
+ assertFalse(testee.retainFeature(sf, accId));
+
+ // other feature with no parent is retained
+ sf.setType("sequence_variant");
+ assertTrue(testee.retainFeature(sf, accId));
+
+ // other feature with desired parent is retained
+ sf.setValue("Parent", "transcript:" + accId);
+ assertTrue(testee.retainFeature(sf, accId));
+
+ // feature with wrong parent is not retained
+ sf.setValue("Parent", "transcript:XYZ");
+ assertFalse(testee.retainFeature(sf, accId));
+ }
+
+ /**
+ * Test the method that picks out 'CDS' (or subtype) features with the
+ * accession id as parent
+ */
+ @Test(groups = "Functional")
+ public void testIdentifiesSequence()
+ {
+ String accId = "ABC123";
+ EnsemblCds testee = new EnsemblCds();
+
+ // cds with no parent not valid
+ SequenceFeature sf = new SequenceFeature("CDS", "", 1, 2, 0f, null);
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // cds with wrong parent not valid
+ sf.setValue("Parent", "transcript:XYZ");
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // cds with right parent is valid
+ sf.setValue("Parent", "transcript:" + accId);
+ assertTrue(testee.identifiesSequence(sf, accId));
+
+ // cds sub-type with right parent is valid
+ sf.setType("CDS_predicted");
+ assertTrue(testee.identifiesSequence(sf, accId));
+
+ // transcript not valid:
+ sf.setType("transcript");
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // exon not valid:
+ sf.setType("exon");
+ assertFalse(testee.identifiesSequence(sf, accId));
+ }
+
+ @Test(groups = "Functional")
+ public void testIsValidReference() throws Exception
+ {
+ EnsemblSequenceFetcher esq = new EnsemblCds();
+ Assert.assertTrue(esq.isValidReference("CCDS5863.1"));
+ Assert.assertTrue(esq.isValidReference("ENST00000288602"));
+ Assert.assertTrue(esq.isValidReference("ENSG00000288602"));
+ Assert.assertTrue(esq.isValidReference("ENSP00000288602"));
+ Assert.assertFalse(esq.isValidReference("ENST0000288602"));
+ // non-human species have a 3 character identifier included:
+ Assert.assertTrue(esq.isValidReference("ENSMUSG00000099398"));
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertSame;
+import static org.testng.AssertJUnit.assertTrue;
+
+import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyLite;
+import jalview.util.MapList;
+
+import java.util.List;
+
+import org.testng.annotations.AfterClass;
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.Test;
+
+public class EnsemblGeneTest
+{
+ @BeforeClass
+ public void setUp()
+ {
+ SequenceOntologyFactory.setInstance(new SequenceOntologyLite());
+ }
+
+ @AfterClass
+ public void tearDown()
+ {
+ SequenceOntologyFactory.setInstance(null);
+ }
+
+ /**
+ * Test that the gene part of genomic sequence is uniquely identified by a
+ * 'gene' features (or subtype) with the correct gene ID
+ */
+ @Test(groups = "Functional")
+ public void testGetGenomicRangesFromFeatures()
+ {
+ EnsemblGene testee = new EnsemblGene();
+ SequenceI genomic = new SequenceDummy("chr7");
+ genomic.setStart(10000);
+ genomic.setEnd(50000);
+ String geneId = "ABC123";
+
+ // gene at (start+10000) length 501
+ SequenceFeature sf = new SequenceFeature("gene", "", 20000, 20500, 0f,
+ null);
+ sf.setValue("ID", "gene:" + geneId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ // gene at (start + 10500) length 101
+ // should be ignored - the first 'gene' found defines the whole range
+ sf = new SequenceFeature("gene", "", 10500, 10600, 0f, null);
+ sf.setValue("ID", "gene:" + geneId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ MapList ranges = testee.getGenomicRangesFromFeatures(genomic, geneId,
+ 23);
+ List<int[]> fromRanges = ranges.getFromRanges();
+ assertEquals(1, fromRanges.size());
+ assertEquals(20000, fromRanges.get(0)[0]);
+ assertEquals(20500, fromRanges.get(0)[1]);
+ // to range should start from given start numbering
+ List<int[]> toRanges = ranges.getToRanges();
+ assertEquals(1, toRanges.size());
+ assertEquals(23, toRanges.get(0)[0]);
+ assertEquals(523, toRanges.get(0)[1]);
+ }
+
+ /**
+ * Test variant using a sub-type of gene from the Sequence Ontology
+ */
+ @Test(groups = "Functional")
+ public void testGetGenomicRangesFromFeatures_ncRNA_gene_reverseStrand()
+ {
+ EnsemblGene testee = new EnsemblGene();
+ SequenceI genomic = new SequenceDummy("chr7");
+ genomic.setStart(10000);
+ genomic.setEnd(50000);
+ String geneId = "ABC123";
+
+ // gene at (start+10000) length 501
+ SequenceFeature sf = new SequenceFeature("ncRNA_gene", "", 20000,
+ 20500, 0f, null);
+ sf.setValue("ID", "gene:" + geneId);
+ sf.setStrand("-");
+ genomic.addSequenceFeature(sf);
+
+ // gene at (start + 10500) length 101
+ // should be ignored - the first 'gene' found defines the whole range
+ // (real data would only have one such feature)
+ sf = new SequenceFeature("gene", "", 10500, 10600, 0f, null);
+ sf.setValue("ID", "gene:" + geneId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ MapList ranges = testee.getGenomicRangesFromFeatures(genomic, geneId,
+ 23);
+ List<int[]> fromRanges = ranges.getFromRanges();
+ assertEquals(1, fromRanges.size());
+ // from range on reverse strand:
+ assertEquals(20500, fromRanges.get(0)[0]);
+ assertEquals(20000, fromRanges.get(0)[1]);
+ // to range should start from given start numbering
+ List<int[]> toRanges = ranges.getToRanges();
+ assertEquals(1, toRanges.size());
+ assertEquals(23, toRanges.get(0)[0]);
+ assertEquals(523, toRanges.get(0)[1]);
+ }
+
+ /**
+ * Test the method that extracts transcript (or subtype) features with a
+ * specified gene as parent
+ */
+ @Test(groups = "Functional")
+ public void testGetTranscriptFeatures()
+ {
+ SequenceI genomic = new SequenceDummy("chr7");
+ genomic.setStart(10000);
+ genomic.setEnd(50000);
+ String geneId = "ABC123";
+
+ // transcript feature
+ SequenceFeature sf1 = new SequenceFeature("transcript", "", 20000,
+ 20500, 0f, null);
+ sf1.setValue("Parent", "gene:" + geneId);
+ sf1.setValue("transcript_id", "transcript1");
+ genomic.addSequenceFeature(sf1);
+
+ // transcript sub-type feature
+ SequenceFeature sf2 = new SequenceFeature("snRNA", "", 20000,
+ 20500, 0f, null);
+ sf2.setValue("Parent", "gene:" + geneId);
+ sf2.setValue("transcript_id", "transcript2");
+ genomic.addSequenceFeature(sf2);
+
+ // NMD_transcript_variant treated like transcript in Ensembl
+ SequenceFeature sf3 = new SequenceFeature("NMD_transcript_variant", "",
+ 20000, 20500, 0f, null);
+ sf3.setValue("Parent", "gene:" + geneId);
+ sf3.setValue("transcript_id", "transcript3");
+ genomic.addSequenceFeature(sf3);
+
+ // transcript for a different gene - ignored
+ SequenceFeature sf4 = new SequenceFeature("snRNA", "", 20000, 20500,
+ 0f, null);
+ sf4.setValue("Parent", "gene:XYZ");
+ sf4.setValue("transcript_id", "transcript4");
+ genomic.addSequenceFeature(sf4);
+
+ EnsemblGene testee = new EnsemblGene();
+
+ /*
+ * with no filter
+ */
+ List<SequenceFeature> features = testee.getTranscriptFeatures(geneId,
+ genomic);
+ assertEquals(3, features.size());
+ assertSame(sf1, features.get(0));
+ assertSame(sf2, features.get(1));
+ assertSame(sf3, features.get(2));
+ }
+
+ /**
+ * Test the method that retains features except for 'gene', or 'transcript'
+ * with parent other than the given id
+ */
+ @Test(groups = "Functional")
+ public void testRetainFeature()
+ {
+ String geneId = "ABC123";
+ EnsemblGene testee = new EnsemblGene();
+ SequenceFeature sf = new SequenceFeature("gene", "", 20000,
+ 20500, 0f, null);
+ sf.setValue("ID", "gene:" + geneId);
+ assertFalse(testee.retainFeature(sf, geneId));
+
+ sf.setType("transcript");
+ sf.setValue("Parent", "gene:" + geneId);
+ assertTrue(testee.retainFeature(sf, geneId));
+
+ sf.setType("mature_transcript");
+ sf.setValue("Parent", "gene:" + geneId);
+ assertTrue(testee.retainFeature(sf, geneId));
+
+ sf.setType("NMD_transcript_variant");
+ sf.setValue("Parent", "gene:" + geneId);
+ assertTrue(testee.retainFeature(sf, geneId));
+
+ sf.setValue("Parent", "gene:XYZ");
+ assertFalse(testee.retainFeature(sf, geneId));
+
+ sf.setType("anything");
+ assertTrue(testee.retainFeature(sf, geneId));
+ }
+
+ /**
+ * Test the method that picks out 'gene' (or subtype) features with the
+ * accession id as ID
+ */
+ @Test(groups = "Functional")
+ public void testIdentifiesSequence()
+ {
+ String accId = "ABC123";
+ EnsemblGene testee = new EnsemblGene();
+
+ // gene with no ID not valid
+ SequenceFeature sf = new SequenceFeature("gene", "", 1, 2, 0f, null);
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // gene with wrong ID not valid
+ sf.setValue("ID", "gene:XYZ");
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // gene with right ID is valid
+ sf.setValue("ID", "gene:" + accId);
+ assertTrue(testee.identifiesSequence(sf, accId));
+
+ // gene sub-type with right ID is valid
+ sf.setType("snRNA_gene");
+ assertTrue(testee.identifiesSequence(sf, accId));
+
+ // transcript not valid:
+ sf.setType("transcript");
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // exon not valid:
+ sf.setType("exon");
+ assertFalse(testee.identifiesSequence(sf, accId));
+ }
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertTrue;
+
+import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyLite;
+import jalview.util.MapList;
+
+import java.util.List;
+
+import org.testng.annotations.AfterClass;
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.Test;
+
+public class EnsemblGenomeTest
+{
+ @BeforeClass
+ public void setUp()
+ {
+ SequenceOntologyFactory.setInstance(new SequenceOntologyLite());
+ }
+
+ @AfterClass
+ public void tearDown()
+ {
+ SequenceOntologyFactory.setInstance(null);
+ }
+
+ /**
+ * Test that the genomic sequence part of genomic sequence is correctly
+ * identified by 'transcript' features (or subtypes) with the correct gene ID
+ */
+ @Test(groups = "Functional")
+ public void testGetGenomicRangesFromFeatures()
+ {
+ EnsemblGenome testee = new EnsemblGenome();
+ SequenceI genomic = new SequenceDummy("chr7");
+ genomic.setStart(10000);
+ genomic.setEnd(50000);
+ String transcriptId = "ABC123";
+
+ // transcript at (start+10000) length 501
+ SequenceFeature sf = new SequenceFeature("transcript", "", 20000,
+ 20500, 0f,
+ null);
+ sf.setValue("ID", "transcript:" + transcriptId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ // transcript (sub-type) at (start + 10500) length 101
+ sf = new SequenceFeature("ncRNA", "", 10500, 10600, 0f, null);
+ sf.setValue("ID", "transcript:" + transcriptId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ // Ensembl treats NMD_transcript_variant as if transcript
+ // although strictly it is a sequence_variant in SO
+ sf = new SequenceFeature("NMD_transcript_variant", "", 11000, 12000,
+ 0f, null);
+ sf.setValue("ID", "transcript:" + transcriptId);
+ sf.setStrand("+");
+ genomic.addSequenceFeature(sf);
+
+ // transcript with a different ID doesn't count
+ sf = new SequenceFeature("transcript", "", 11500, 12600, 0f, null);
+ sf.setValue("ID", "transcript:anotherOne");
+ genomic.addSequenceFeature(sf);
+
+ // parent of transcript feature doesn't count
+ sf = new SequenceFeature("gene_member_region", "", 10000, 50000, 0f,
+ null);
+ genomic.addSequenceFeature(sf);
+
+ MapList ranges = testee.getGenomicRangesFromFeatures(genomic,
+ transcriptId, 23);
+ List<int[]> fromRanges = ranges.getFromRanges();
+ assertEquals(3, fromRanges.size());
+ // from ranges should be sorted by start order
+ assertEquals(10500, fromRanges.get(0)[0]);
+ assertEquals(10600, fromRanges.get(0)[1]);
+ assertEquals(11000, fromRanges.get(1)[0]);
+ assertEquals(12000, fromRanges.get(1)[1]);
+ assertEquals(20000, fromRanges.get(2)[0]);
+ assertEquals(20500, fromRanges.get(2)[1]);
+ // to range should start from given start numbering
+ List<int[]> toRanges = ranges.getToRanges();
+ assertEquals(1, toRanges.size());
+ assertEquals(23, toRanges.get(0)[0]);
+ assertEquals(1625, toRanges.get(0)[1]);
+ }
+
+ /**
+ * Test the method that retains features except for 'transcript' (or
+ * sub-type), or those with parent other than the given id
+ */
+ @Test(groups = "Functional")
+ public void testRetainFeature()
+ {
+ String accId = "ABC123";
+ EnsemblGenome testee = new EnsemblGenome();
+
+ SequenceFeature sf = new SequenceFeature("transcript", "", 20000,
+ 20500, 0f, null);
+ assertFalse(testee.retainFeature(sf, accId));
+
+ sf.setType("mature_transcript");
+ assertFalse(testee.retainFeature(sf, accId));
+
+ sf.setType("NMD_transcript_variant");
+ assertFalse(testee.retainFeature(sf, accId));
+
+ // other feature with no parent is kept
+ sf.setType("anything");
+ assertTrue(testee.retainFeature(sf, accId));
+
+ // other feature with correct parent is kept
+ sf.setValue("Parent", "transcript:" + accId);
+ assertTrue(testee.retainFeature(sf, accId));
+
+ // other feature with wrong parent is not kept
+ sf.setValue("Parent", "transcript:XYZ");
+ assertFalse(testee.retainFeature(sf, accId));
+ }
+
+ /**
+ * Test the method that picks out 'transcript' (or subtype) features with the
+ * accession id as ID
+ */
+ @Test(groups = "Functional")
+ public void testIdentifiesSequence()
+ {
+ String accId = "ABC123";
+ EnsemblGenome testee = new EnsemblGenome();
+
+ // transcript with no ID not valid
+ SequenceFeature sf = new SequenceFeature("transcript", "", 1, 2, 0f,
+ null);
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // transcript with wrong ID not valid
+ sf.setValue("ID", "transcript");
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // transcript with right ID is valid
+ sf.setValue("ID", "transcript:" + accId);
+ assertTrue(testee.identifiesSequence(sf, accId));
+
+ // transcript sub-type with right ID is valid
+ sf.setType("ncRNA");
+ assertTrue(testee.identifiesSequence(sf, accId));
+
+ // Ensembl treats NMD_transcript_variant as if a transcript
+ sf.setType("NMD_transcript_variant");
+ assertTrue(testee.identifiesSequence(sf, accId));
+
+ // gene not valid:
+ sf.setType("gene");
+ assertFalse(testee.identifiesSequence(sf, accId));
+
+ // exon not valid:
+ sf.setType("exon");
+ assertFalse(testee.identifiesSequence(sf, accId));
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import static org.testng.AssertJUnit.assertEquals;
+
+import org.testng.Assert;
+import org.testng.annotations.Test;
+
+public class EnsemblProteinTest
+{
+
+ @Test(groups = "Functional")
+ public void testIsValidReference() throws Exception
+ {
+ EnsemblSequenceFetcher esq = new EnsemblProtein();
+ Assert.assertTrue(esq.isValidReference("CCDS5863.1"));
+ Assert.assertTrue(esq.isValidReference("ENSP00000288602"));
+ Assert.assertFalse(esq.isValidReference("ENST00000288602"));
+ Assert.assertFalse(esq.isValidReference("ENSG00000288602"));
+ // non-human species having a 3 character identifier included:
+ Assert.assertTrue(esq.isValidReference("ENSMUSP00000099398"));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetAccesionIdFromQuery() throws Exception
+ {
+ EnsemblSequenceFetcher esq = new EnsemblProtein();
+ assertEquals("ENSP00000288602",
+ esq.getAccessionIdFromQuery("ENSP00000288602"));
+ assertEquals("ENSMUSP00000288602",
+ esq.getAccessionIdFromQuery("ENSMUSP00000288602"));
+
+ // ENST converted to ENSP
+ assertEquals("ENSP00000288602",
+ esq.getAccessionIdFromQuery("ENST00000288602"));
+ assertEquals("ENSMUSP00000288602",
+ esq.getAccessionIdFromQuery("ENSMUST00000288602"));
+
+ // with valid separator:
+ assertEquals("ENSP00000288604",
+ esq.getAccessionIdFromQuery("ENSP00000288604 ENSP00000288602"));
+
+ // with wrong separator:
+ assertEquals("ENSP00000288604,ENSP00000288602",
+ esq.getAccessionIdFromQuery("ENSP00000288604,ENSP00000288602"));
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.datamodel.AlignmentI;
+
+import java.net.MalformedURLException;
+import java.net.URL;
+import java.util.List;
+
+import org.testng.annotations.Test;
+
+public class EnsemblRestClientTest
+{
+
+ @Test(suiteName = "live")
+ public void testLiveCheckEnsembl()
+ {
+ EnsemblRestClient sf = new EnsemblRestClient()
+ {
+
+ @Override
+ public String getDbName()
+ {
+ return null;
+ }
+
+ @Override
+ public AlignmentI getSequenceRecords(String queries) throws Exception
+ {
+ return null;
+ }
+
+ @Override
+ protected URL getUrl(List<String> ids) throws MalformedURLException
+ {
+ return null;
+ }
+
+ @Override
+ protected boolean useGetRequest()
+ {
+ return false;
+ }
+
+ @Override
+ protected String getRequestMimeType(boolean b)
+ {
+ return null;
+ }
+
+ @Override
+ protected String getResponseMimeType()
+ {
+ return null;
+ }
+
+ };
+ boolean isAvailable = sf.isEnsemblAvailable();
+ if (isAvailable)
+ {
+ System.out.println("Ensembl is UP!");
+ }
+ else
+ {
+ System.err
+ .println("Ensembl is DOWN or unreachable ******************* BAD!");
+ }
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import jalview.datamodel.SequenceFeature;
+
+/**
+ * A convenience class to simplify writing unit tests (pending Mockito or
+ * similar?)
+ */
+public class EnsemblSeqProxyAdapter extends EnsemblSeqProxy
+{
+ /**
+ * Default constructor (to use rest.ensembl.org)
+ */
+ public EnsemblSeqProxyAdapter()
+ {
+ super();
+ }
+
+ /**
+ * Constructor given the target domain to fetch data from
+ *
+ * @param d
+ */
+ public EnsemblSeqProxyAdapter(String d)
+ {
+ super(d);
+ }
+
+ @Override
+ public String getDbName()
+ {
+ return null;
+ }
+
+ @Override
+ protected EnsemblFeatureType[] getFeaturesToFetch()
+ {
+ return null;
+ }
+
+ @Override
+ protected EnsemblSeqType getSourceEnsemblType()
+ {
+ return null;
+ }
+
+ @Override
+ protected boolean identifiesSequence(SequenceFeature sf, String accId)
+ {
+ return false;
+ }
+
+}
--- /dev/null
+package jalview.ext.ensembl;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertTrue;
+
+import jalview.analysis.AlignmentUtils;
+import jalview.datamodel.Alignment;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.SequenceI;
+import jalview.io.AppletFormatAdapter;
+import jalview.io.FastaFile;
+import jalview.io.FileParse;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyLite;
+
+import java.lang.reflect.Method;
+import java.net.MalformedURLException;
+import java.net.URL;
+import java.util.Arrays;
+import java.util.List;
+
+import org.testng.Assert;
+import org.testng.annotations.AfterClass;
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.DataProvider;
+import org.testng.annotations.Test;
+
+
+public class EnsemblSeqProxyTest
+{
+ private static final Object[][] allSeqs = new Object[][] {
+ {
+ new EnsemblProtein(),
+ "CCDS5863.1",
+ ">CCDS5863.1\n"
+ + "MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEH\n"
+ + "IEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTV\n"
+ + "TSSSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS\n"
+ + "LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRK\n"
+ + "TFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPI\n"
+ + "PQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQR\n"
+ + "DRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSP\n"
+ + "GPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDV\n"
+ + "AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHH\n"
+ + "LHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATV\n"
+ + "KSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNIN\n"
+ + "NRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS\n"
+ + "LPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH\n" },
+ {
+ new EnsemblCdna(),
+ "CCDS5863.1",
+ ">CCDS5863.1\n"
+ + "ATGGCGGCGCTGAGCGGTGGCGGTGGTGGCGGCGCGGAGCCGGGCCAGGCTCTGTTCAAC\n"
+ + "GGGGACATGGAGCCCGAGGCCGGCGCCGGCGCCGGCGCCGCGGCCTCTTCGGCTGCGGAC\n"
+ + "CCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACAT\n"
+ + "ATAGAGGCCCTATTGGACAAATTTGGTGGGGAGCATAATCCACCATCAATATATCTGGAG\n"
+ + "GCCTATGAAGAATACACCAGCAAGCTAGATGCACTCCAACAAAGAGAACAACAGTTATTG\n"
+ + "GAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTT\n"
+ + "ACATCTTCTTCCTCTTCTAGCCTTTCAGTGCTACCTTCATCTCTTTCAGTTTTTCAAAAT\n"
+ + "CCCACAGATGTGGCACGGAGCAACCCCAAGTCACCACAAAAACCTATCGTTAGAGTCTTC\n"
+ + "CTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGT\n"
+ + "CTAAAGAAAGCACTGATGATGAGAGGTCTAATCCCAGAGTGCTGTGCTGTTTACAGAATT\n"
+ + "CAGGATGGAGAGAAGAAACCAATTGGTTGGGACACTGATATTTCCTGGCTTACTGGAGAA\n"
+ + "GAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAA\n"
+ + "ACGTTTTTCACCTTAGCATTTTGTGACTTTTGTCGAAAGCTGCTTTTCCAGGGTTTCCGC\n"
+ + "TGTCAAACATGTGGTTATAAATTTCACCAGCGTTGTAGTACAGAAGTTCCACTGATGTGT\n"
+ + "GTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATA\n"
+ + "CCACAGGAAGAGGCGTCCTTAGCAGAGACTGCCCTAACATCTGGATCATCCCCTTCCGCA\n"
+ + "CCCGCCTCGGACTCTATTGGGCCCCAAATTCTCACCAGTCCGTCTCCTTCAAAATCCATT\n"
+ + "CCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGA\n"
+ + "GACCGATCCTCATCAGCTCCCAATGTGCATATAAACACAATAGAACCTGTCAATATTGAT\n"
+ + "GACTTGATTAGAGACCAAGGATTTCGTGGTGATGGAGGATCAACCACAGGTTTGTCTGCT\n"
+ + "ACCCCCCCTGCCTCATTACCTGGCTCACTAACTAACGTGAAAGCCTTACAGAAATCTCCA\n"
+ + "GGACCTCAGCGAGAAAGGAAGTCATCTTCATCCTCAGAAGACAGGAATCGAATGAAAACA\n"
+ + "CTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGA\n"
+ + "CAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTG\n"
+ + "GCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAAT\n"
+ + "GAAGTAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCC\n"
+ + "ACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCAT\n"
+ + "CTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACT\n"
+ + "GCACAGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAAT\n"
+ + "AATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTG\n"
+ + "AAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATG\n"
+ + "GCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATAT\n"
+ + "GCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAAC\n"
+ + "AACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAG\n"
+ + "GTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAA\n"
+ + "AGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCA\n"
+ + "TTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACA\n"
+ + "GAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCCAGGCAGGGGGATAT\n"
+ + "GGTGCGTTTCCTGTCCACTGA\n" },
+ {
+ new EnsemblProtein(),
+ "ENSP00000288602",
+ ">ENSP00000288602\n"
+ + "MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEH\n"
+ + "IEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTV\n"
+ + "TSSSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS\n"
+ + "LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRK\n"
+ + "TFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPI\n"
+ + "PQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQR\n"
+ + "DRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSP\n"
+ + "GPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDV\n"
+ + "AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHH\n"
+ + "LHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATV\n"
+ + "KSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNIN\n"
+ + "NRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS\n"
+ + "LPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH" } };
+
+ @BeforeClass
+ public void setUp()
+ {
+ SequenceOntologyFactory.setInstance(new SequenceOntologyLite());
+ }
+
+ @AfterClass
+ public void tearDown()
+ {
+ SequenceOntologyFactory.setInstance(null);
+ }
+
+ @DataProvider(name = "ens_seqs")
+ public Object[][] createData(Method m)
+ {
+ System.out.println(m.getName());
+ return allSeqs;
+ }
+
+ @Test(dataProvider = "ens_seqs", suiteName = "live")
+ public void testGetOneSeqs(EnsemblRestClient proxy, String sq, String fastasq)
+ throws Exception
+ {
+ FileParse fp = proxy.getSequenceReader(Arrays
+ .asList(new String[]
+ { sq }));
+ SequenceI[] sqs = new FastaFile(fp).getSeqsAsArray();
+ FastaFile trueRes = new FastaFile(fastasq, AppletFormatAdapter.PASTE);
+ SequenceI[] trueSqs = trueRes.getSeqsAsArray();
+ Assert.assertEquals(sqs.length, trueSqs.length,
+ "Different number of sequences retrieved for query " + sq);
+ Alignment ral = new Alignment(sqs);
+ for (SequenceI tr : trueSqs)
+ {
+ SequenceI[] rseq;
+ Assert.assertNotNull(
+ rseq = ral.findSequenceMatch(tr.getName()),
+ "Couldn't find sequences matching expected sequence "
+ + tr.getName());
+ Assert.assertEquals(rseq.length, 1,
+ "Expected only one sequence for sequence ID " + tr.getName());
+ Assert.assertEquals(
+ rseq[0].getSequenceAsString(),
+ tr.getSequenceAsString(),
+ "Sequences differ for " + tr.getName() + "\n" + "Exp:"
+ + tr.getSequenceAsString() + "\n" + "Got:"
+ + rseq[0].getSequenceAsString());
+
+ }
+ }
+
+ @Test(suiteName = "live")
+ public void testLiveCheckEnsembl()
+ {
+ EnsemblRestClient sf = new EnsemblRestClient()
+ {
+
+ @Override
+ public String getDbName()
+ {
+ // TODO Auto-generated method stub
+ return null;
+ }
+
+ @Override
+ public AlignmentI getSequenceRecords(String queries) throws Exception
+ {
+ // TODO Auto-generated method stub
+ return null;
+ }
+
+ @Override
+ protected URL getUrl(List<String> ids) throws MalformedURLException
+ {
+ // TODO Auto-generated method stub
+ return null;
+ }
+
+ @Override
+ protected boolean useGetRequest()
+ {
+ // TODO Auto-generated method stub
+ return false;
+ }
+
+ @Override
+ protected String getRequestMimeType(boolean b)
+ {
+ // TODO Auto-generated method stub
+ return null;
+ }
+
+ @Override
+ protected String getResponseMimeType()
+ {
+ // TODO Auto-generated method stub
+ return null;
+ }
+
+ };
+ boolean isAvailable = sf.isEnsemblAvailable();
+ System.out.println("Ensembl is "
+ + (isAvailable ? "UP!"
+ : "DOWN or unreachable ******************* BAD!"));
+ }
+
+ @Test(groups = "Functional")
+ public void getGenomicRangesFromFeatures()
+ {
+
+ }
+
+ @Test(groups = "Functional")
+ public void testIsTranscriptIdentifier()
+ {
+ EnsemblSeqProxy testee = new EnsemblGene();
+ assertFalse(testee.isTranscriptIdentifier(null));
+ assertFalse(testee.isTranscriptIdentifier(""));
+ assertFalse(testee.isTranscriptIdentifier("ENSG00000012345"));
+ assertTrue(testee.isTranscriptIdentifier("ENST00000012345"));
+ assertTrue(testee.isTranscriptIdentifier("ENSMUST00000012345"));
+ assertFalse(testee.isTranscriptIdentifier("enst00000012345"));
+ assertFalse(testee.isTranscriptIdentifier("ENST000000123456"));
+ assertFalse(testee.isTranscriptIdentifier("ENST0000001234"));
+ }
+
+ @Test(groups = "Functional")
+ public void testIsGeneIdentifier()
+ {
+ EnsemblSeqProxy testee = new EnsemblGene();
+ assertFalse(testee.isGeneIdentifier(null));
+ assertFalse(testee.isGeneIdentifier(""));
+ assertFalse(testee.isGeneIdentifier("ENST00000012345"));
+ assertTrue(testee.isGeneIdentifier("ENSG00000012345"));
+ assertTrue(testee.isGeneIdentifier("ENSMUSG00000012345"));
+ assertFalse(testee.isGeneIdentifier("ensg00000012345"));
+ assertFalse(testee.isGeneIdentifier("ENSG000000123456"));
+ assertFalse(testee.isGeneIdentifier("ENSG0000001234"));
+ }
+}
\ No newline at end of file
--- /dev/null
+/**
+ *
+ */
+package jalview.ext.htsjdk;
+
+import jalview.datamodel.SequenceI;
+
+import java.io.File;
+
+import org.testng.Assert;
+import org.testng.annotations.Test;
+
+/**
+ * @author jprocter
+ *
+ */
+public class TestHtsContigDb
+{
+ @Test
+ public final void testHTSReferenceSequence() throws Exception
+ {
+ HtsContigDb remmadb = new HtsContigDb("REEMADB", new File(
+ "test/jalview/ext/htsjdk/pgmb.fasta"));
+
+ Assert.assertTrue(remmadb.isValid());
+
+ SequenceI sq = remmadb.getSequenceProxy("Deminut");
+ Assert.assertNotNull(sq);
+ Assert.assertNotEquals(0, sq.getLength());
+ }
+
+}
--- /dev/null
+>DDB_G0280897
+MTDKINNLINQWLKWDKNEITRKEIEQLKENNNEKELLVRLEERIQFGTAGLRGAMRAGF
+SCMNDLTVTQASQGLCEYVIETIEQSKSKGIVIGYDGRHNSYIFAKITAATFKSKGFKVY
+LFSHIVPTPYVSFAVPNLKAAIGVMITASHNPKNDNGYKVYWETGCQINTPHDKGISKKI
+DENLEPWSNVDATSDIKYGNGDDGESMIDPLSVITELYNKNIKEYSVGSKIELANEPIVY
+TAMHGVGGVYAKKAFETFQLKPFIPVAQQIEPDAEFPTVTYPNPEEGKGALKLSIETAEA
+NNSRLILANDPDADRLAVAEKLADGSWKVFNGNEIGVLLADWAWTNRSTLTKGGSTLENN
+KYFMINTAVSSAMLKTMSEKEGFIHQECLTGFKWIGNAAYNAINNNDGTTFLFGYEEAIG
+FQYGDVSFDKDGVRAAAIFAEFALSLYKKGSSVQDHLESMYKRYGYHISKNRYFFCYEPS
+KMVSIFNKIRNDGKYLTKLGDDDDEQFTITRIRDLTTGYDNGYPDCKARLPVSSSTQMIT
+FYFKNGGIATLRGSGTEPKLKYYVEMIGEVKSNVESTLTKAVELVINQLLKPIENQLEPP
+KDD
+>PPL_06716
+MSNIKELAESWLKWDKNAETRKEIQSLLESDNQSELKSRLEQRIAFGTAGLRGPMKAGFS
+CMNDLTVIQASQGLCIYVEQTLSNSKNSGIVVGYDGRHHSKEFARLTAATFASRGFKVYL
+FSKIVPTPYVVILYLISNYMDCYVHQAFAVPELKASVGVMITASHNPKDDNGYKVYWDNG
+CQINTPHDIRIAMQIDLNLEPWNIDVNELLNGSLVSDPLDTITKSYFGKIAKYSVKNEVK
+LATSEKIVYTAMHGVGGEYAKMAFETFGLPAFIPVDQQIQPDPEFPTVAFPNPEEGKGAL
+KLSIETAERNNSRLILANDPDADRLAVAERQPDGQWKVFNGNEIGVLFADWAWQNARRAD
+STTPAERFCMINTAVSSSMLKTMANKDGYRHEECLTGFKWVGNKARELMDKGYNFLFAYE
+EAIGFMYGDVSLDKDGVRCAPIFAELALTCYQAGKSCQDHLEELYKRYGYHISKNRYFFC
+YDPKKMVAIFDKIRNYGQFPTNCGDFYITRVRDLTVGYDSGYPDHKARLPVSSSTQMITF
+YFENGGIATLRGSGTEPKLKYYVEMIGSDRQLVESTLSQLVEQVINQFLRPVENELTPPK
+DD
+>DFA_03821
+MTDINQLAQNWLKWDRNPKTHKEIEQLVEAKDENELRARLENRIAFGTAGIVSTTIVQSH
+MNIGPMKAGFANMNDLTVIQASQGLSIYVQETISQAQSKGVVVGYDGRYNSEVFAKLTAA
+TFASKGFKVYLFSKIVPTPFVAFAVPELGASVGVMVTASHNPKDDNGYKVYWDNGCQINT
+PHDKGIAKQIDLNLEPWTINIDKLLSSELVNDPLETISNAYFSKIYSYSVKNRSTPLELA
+NEKVVYTAMHGVGGDYVKKAFETFKLPPYVEVAQQIKPDPAFPTVAFPNPEEGKGALKLS
+IETAESVNSRLILANDPDADRLAVAEKLKDGSWKVFNGNEIGILLADWAWTNAKINHPDV
+PAEKFFMINTAVSSAMLKTMAKKEGYICEETLTGFKWVGNKAKEMIDQGYKFLFAYEEAI
+GFMYGDVSLDKDGVRCAPIFAEYALNLYANGSSCQDHLDHLMQRYGYHISKNRYFFCYEP
+SKMVRIFNDIRKSNNGQFPDKCGPYEIIRIRDLTVDYDTAYPDNKARLPVSTSTQMITFY
+FKNGAIATLRGSGTEPKLKYYVEMIGDNKQEVESTLQQVVQQVIDNFLQPVVNQLTPPKD
+D
+>DLA_10096
+MDIYTLANKWLEWDKNEKNRKEIQHFVDEKNEQELRERLENRIQFGTAGLRGPMKAGFAN
+MNDLTVIQASQGLALYVKETIDSALTKGVVVGYDGRHNSQTFARLTAATFLSKGFKVYLF
+SKLVPTPFVAFAVPELGASCGVMITASHNPKDDNGYKVYWDNGCQINTPHDKGISKLIDE
+NLVPWTMNLDDLNKSDLVSDPLERVSKSYFTKISKYSVVKSGATIKQEKVVYTPMHGVGG
+DYAAEAFKVFDLHPFIPVELQIKPDAEFPTVAFPNPEEGKGALKLAIETAESNQSRLILA
+NDPDADRLAVAEKQSSDGSWKVFNGNEIGVLFADWAWRKERALFSEGYNCKPSEYTMIST
+AVSSAMLSTMAKKEGFQHEEVLTGFKWVGNAAKQAMDRGQKFLFAYEEAIGFMYGDVSLD
+KDGVRGASIFAELAFDLYQQGSSCQEHLESLYKKYGYHISNNRYFFCYDPKKMVRIFNEI
+RGNNREYVKELGEFKVERIRDLTTGYDTAFPPEFKAQLPTSSSTQMITFYFTNGSIATLR
+GSGTEPKLKYYVESIGSDKLQVQQTLTKLVSLVIEKLLRPKENELTPPKESVGSERLLAL
+LSEVMSTSMKIQVKYNESITEYNIIKGVKLLTQIDVLCQIFKVDANPDRFVLNYRESNLI
+LSEDNLSKLFSNEISSCSSQSQNGSNGELSSLYSSFGENSSNNNNNSTLKFELILAPIYQ
+VDSVLEHLNNSNLIKKRII
+>DPU1265769
+MSMIRSISGVRGVIGQSWTPTLVSNHIIGFTQLLESEKYYNQKQKKIVVGRDSRVSGPWI
+EMIVNGSLISMGYQVIHIDIAATPTVQYMVEKTKSSGGIVITSSHNPVEWNGLKFVGPDG
+LFIAPVECEVLFSLADNPSSFKFPNYDKLGSVVCNTTANKEHIEAIFKLPFISVDKIKEK
+KFKVCLDSVNGAGGPIMSYLLTELGCEVIGINLEPTGLFAHTPEPVPANLGQLCELVKTH
+KADFGIAVDPDVDRCVFIDDKGVPLGEEYTLAMAVELLLGDCGRRGNVCKNLSSSRAIDD
+ICKKYDSQVICAPVGEIQVAKKMQQVNAVIGGEGNGGVMLPDIHIGRDAPVAATLALQLL
+ANRNAASISEFKRTTLPTYEIVKLKAGIEGLDPDAILAEYTKQYENKEGVVINQEDGLKI
+DSADWWVHLRKSNTEHIIRVISEAKNTKEATDIATKFINEIESKRK
+>440792448
+MASRVSGRMRKISDETQQMVNAWLSVDWDPESREHVKGLVAAGKEEELVAHLGRRISFGT
+AGLRGKMKWGFAFMNAVTVTQASQGLCAYLRTVHPCLTDLRERGVIVGHDGRYNSRMFAR
+LTAAVFLSRKIKVHLFRDDVPTPLVAFGVRHLKCAAGVMVTASHNPKEDNGYKVYWANSA
+QITAPHDAQIARAIEANFSIWDRMPDDKAIDEHPLCLDPTTDVCAAYLAAARHWSFRTPQ
+QNAAAQLRVVYTAMHGVGGQSVERIFDAFGLPPVIAVREQHDPDPDFTTVEFPNPEEANG
+CSLRLAMSTADREGAPLILANDPDADRLAVAERQRDSGEWRILDGNEIALLLADWLWRNY
+TERHPEVDRAKIVMLNSTVSSKALAAMAAKEGFHYRETLTGFKWLGNLADELVRAGYTFL
+FAYEVEIGFMIGDMSLDTDGVRAAPVFVEMANHLYERGLTLSDHLDNLYHKYGYYKMAVG
+YYFCHDPRLMDQIFNEIRNDGLYISTCGDHKVQYVRDLTTGFDNSQPHNRAVLPVSSAAH
+MITFTFENECVATFRGSGTEPKLKYYIEVANASNEQLATDLLDSMKQEIIDRFLQPSQNG
+LRPPAAAEDAHNSPHNSGNSPEQMAPARIARDVIHKEIQALQNLEATLGRDFEKVVEIIE
+SRGSGRVIFTGVGKSGIIAQKISASFSSLGISSFFVHATEAAHGDLGVITAEDVIIAISN
+SGNTPELIFIIPSLRVLAGKIIGITSNKDSLLARYSDASIITGKIMEADQHKIAPTASTI
+VCLAIGDALAVTLSARMKFTLPEFGLRHPGGVLGEKVLGKVFQEFAMKGQGRFLRFWKRM
+TNEERDKLRRDFERIDLAELSRIYLQCRSKAEKGAIDPHSLEPLPSHTWVKLHESDPAAV
+AAWRDAGLRALREGKIGVVLMAGGQATRLGMTMPKGFLDLNLPSHKSLYQLHAEKLLRLQ
+DEVRQTFGGGGGDEEVQQQQQQIQIPFYVMTSPEALQQTHQFFIKHQFFGLCPKQVFFFK
+QRSLPCVAPSGEIIMDTKCSVVFSPDGHGGLFVALKDAKAYEDMKRRGVEYVFAFGVDNP
+LCEVADPAYMGYCIQRNVKMGYKVVDRRDPQETAGVVCVRDGVINCVEYSELPESVAELR
+DEQSGELVYNAANMLNLFFTLRFMRKIADNPSLMEYHLAKKRIPFVNDNGVRTEPLVPNG
+WKFEKYLVDCTPYANNSVAVMFVKREEEFAPIKNGWNSEVDSPRSARRLLAAHYRRRIER
+AGGKLAADDPDKMVEVSPLVTDRKLAQLLQDKHLVTGPAVLQ
+>ENY64621.1
+MALNNYIKKTEMDYLYEQAALWLKWDKTPETRKEIEDLVASKNEEELKKRFCKRIEFGTA
+GLRGKMCAGFNCMNNLIVQQASQGLALAVEELVQNAHEKGVVIGYDGRYHSKEFAAITAK
+VFISKGFKTYLFSTLCPTPWTAFAVGYLKTACGVMVTASHNPKADNGYKVYWENGCQIIE
+PIDANIASKIHSNLEPWDLSNVDISKVIDPLADVSAEYYKQMMLTIPHFECPEQPKVKYV
+YTAMHGVGSKYVQDAFKTAKLPQPILVPLQNEPDPEFPTVPFPNPEEGKGALKCSIEVAE
+ANGATVIIANDPDADRLSVAVKSGNGWRQFTGNEMANLIADWTYNKYIVSGDKTPAFMVR
+STVSSSFISKMGEVEGFDTYETLTGFKWIGNKAKEIVDTQHKKLLMAYEEAIGFVIGNMS
+YDKDGVRAAVCFAAMALEYAEQGFNLEDRLNMLYEKYGYFASNNKYYFCYDPKLMEKIFN
+KMRNNGQYYWKFGKYAVKSIRDLTVGIDTAQPDKKPLLPVSASTQMITYTFENGCKATLR
+GSGTEPKLKYYIELPGKKGVKAEDVIAELMDLSHELLQASLEPEKNGLIPPKAE
+>Ppo014092.000
+MSISPSVQELVGKWLQWDKNPQNIKEIKDLVAANNEAELKNRLATRIAFGTAGLRGPMRA
+GFSCMNDLTVIQASQGLCKYLQQMVSDIKTRGIVVGYDGRHHSKEFAEWTAATFLSQGIT
+VYLFTRLVPTPFVSYATPLLRCAAGIMITASHNPKDDNGYKVYWDNGCQINVPHDKGISD
+CIEQNLTPWDINKAELLKSELVKDPTETVASAYLKEIKAKCCFHHDENSQKIPVTYTAMH
+GVGSEWVARAFEVFGLAPYVPVAPQISADPEFPTVAFPNPEEGKGALKLSMEAADKAGST
+LILATDPDADRLAVAEKLPSGSWKIFTGNEIGALLAYWAWLKYKERNPKVDPSKCVVINS
+TVSSKLLKALADKEGLKYDETLTGFKWIGGQAAIRIKEGYTFIFGFEEAIGFLFGDVNLD
+KDGVRAAAVFAEMNIQLHKQGITVVQQLEKIYKLYGYFITRNRYFFCYDPAKMERIFNAI
+RNYNNSGTYPTSCGPFKIKNTRDLTTGYDDSQTDKKAILPVSKSTQMITFFFENGGVVTL
+RGSGTEPKLKYYTELSGSDPEKVKSTLDEMVQAIIDTCLKPVENQLQPPSDE
+>ADB0001102_3
+MSTTTSINKLAQDWLKWDKNPKTRAEIQELVEQNDVKELTARLENRIAFGTAGLRGPMKA
+GFSCMNDLTVIQASQGLCLYVIDTIPNAIKSGVVIGYDGRYNSKEFAKYTAATFLSKGYK
+VYLFSKVVPTPYVAFAVTDLKASIGVMITASHNPKDDNGYKVYWENGCQINTPHDKGIAK
+LIDLNLEPWEINVDQLLSGPLVEDPLDRIVSSYNTKIAQYSVASHVKFANEKIIYTAMHG
+VGGEYTKMAFEAFKLPPFIPVAQQYQPDPAFPTVTFPNPEEGKGALKLSIETAEANGSRL
+ILANDPDADRLAVAERLKDGTWKVFNGNEIGVLLADWAWQNARRSHPDTPAEKFFMINTA
+VSSAMLKTMAKKDGYRCEETLTGFKWVGNRAREVMDAEGLHFLFAYEEAIGFLYGDVSLD
+KDGVRCAAIFAELALSYYANGSSCEDHLESLYKRYGYHISRNRYFFCYEPPKMVAIFNKI
+RNNRNFPTKCGRFEIERVRDLTIDYDDGFPDKKARLPVSTSTQMITFYFKNGAIATLRGS
+GTEPKLKYYVEMIGQDKAHVQQELAELVQCIINEFLRPVENELTPPKDD
+>Carpum
+MTQSTCITSMVINNYLSIYIFIYTINDYLKRSLFVLCLVAKMSHHKVAITHPISSYNSII
+NELAQNWLRWDKNKETRKEIEQLVEQKNEKELYDCLAKRIAFGTADNEIMMLLTHTLHTG
+LRGQMKAGFSNMNDLTVIQASQGLCKYVKETIPEAQKKGVVVGYDCRHHSETFARLTAAT
+FASQGFTVYLYSKMVPTPFVAFGVTDLKACVGVMVTASHNPKEDNGYKVYWENGCQINSP
+HDKGISQQIELNLEPWTIDVNSLLEKVDDPLERVTKSYMDQISKYSVRGSVDMATENVVY
+TAMHGVGGVFVKDAFAAFGLAPYIPVPAQVGPDAEFPTVTLPNPEEGKGALKLSIETAEA
+NNSRLIVANDPDADRLAAAEKLKDGSWKVFNGNEIGVLFADWAWQNARRQHGGDSINPSE
+YFMVTTAVSSSMLRTMATKEGYGYDETLTGFKWVGNKARDLIDQGKKFLFAYEESIGYMY
+GEVSLDKDGVRGAAVFTEMALSCYARGTSCQEHLESLYVKYGYHLSKNRYYFCYDPSKMV
+SIFNRIRNNGEFPKTCGPFEITRIRDLTVDYDNGYEDKKARLPVSSSTQMITFYFKNGAI
+ATLRGSGTEPKLKYYVEMIGDDKEQVKATLDQVHDQVIQQFLRPTENQLSPPSDE
+>Cephalum
+MTTDIYQIAQNWLRWDRNPKTHKEISQLVQDKNESELKARLESRIAFGTAGLRGPMKAGF
+SCMNDLTVIQASQGLCMYVKQTLAPDAERKGIVVGYDGRYNSEVFAKLTAATFVSQGFKV
+HLFSRLVPTPFVAFAVPFLKACVGVMITASHNPKDDNGYKVYWDNGCQINTPHDKGIAKQ
+IELNLEPWNVFYKEYFDRIERYTVRHNKQMAREKIVYSAMHGVGGEYTKRAFEVFALDPF
+IAVKEQFHPDPAFPTVTFPNPEEGKGALKLSIETAEANNNWAWKNGKPYYEKGLGSFPND
+QYFMINTAVSSAMLKTMAMKEGFTYEEVLTGFKWVGNAAQNLIEKGKHLLFAYEEAIGFM
+YGDVSLDKDGVRCAPIFAELAQHLYSKGSSCQDHLEELYKRYGYHISKNRYFFCYDPLKM
+EKIFNRIRNGGQYPTKCGDFEITRIRDLTTGYDTGYPPENKAQLPTSTSTQMITFYFKNG
+GIATLRGSGTEPKLKYYVEMIGDDKENVELILQSMVDQVINQFLRPIENELIPPKD
+>Violaceum
+MVINPFYPYYLYFCYSPGISYQGVKINKTKLEQSTLTTINQWLNGNYDEQTKKNIQNLLD
+QESYTELTDAFYRNLEFGTGGLRGIMGAGSNRINKYTIGTATQGLSNYLLKKYPGEKIKV
+AIAHDSRNNSDQFAKITADVFSANGIYVYFFKELRPTPELSFAIRELGCRSGVMLTASHN
+PKEYNGYKAYGADGGQFTAPDDRLVMDEVAKITSIDEVKFTRIDANIELIGEEIDQLYLD
+KITALSVSPEAISRQKDLKIVYSPIHGTGITLVPKALAQFGFDNVTIVEEQSKPDGNFPT
+VVYPNPEEKEAMTLALKKAQEIDADLVLATDPDADRVGIAVKNNNNEWILLNGNQTGSLL
+VHYVLTAWEEKGKIDGNQYIVKTVVTSNLIEAIAKAKKVDCYNTLTGFKWIGQLITSLQG
+KKTFVVGGEESYGYSVGELVRDKDAVISCAFIAEMTAYYKDKGSSLYNALIDMYVTHGLY
+KEELVSLTKKGKTGAEEIKAMMEKFRNNPPASLGGSKVSTLKDYELGTETDLNTGKISKL
+SLPKSDVLQFVTEDGSIVSARPSGTEPKIKFYCSVNATLSQASEFDKTDEKLGLKINALM
+EDLQK
+>Deminut
+MTDIYQIAQNWLKWDRNPKTHKEISTLVEKKDEAELRARLETRIAFGTAGLRGPMKAGFS
+CMNDLTVIQASQGLSLYVKKTLAGSESKGAVVGYDGRYNSEVFAKLTAATFASQGFKVYL
+FSKVVPTPYVAFAVPELGASVGVMVTASHNPKDDNGYKVYWDNGCQINTPHDKHISELIE
+SNLEPWNVCIYITLQINIDKLLSGVIDPLQVVTSSYMSKIEKYSVKHLPQPLKLATEQKI
+VYTAMHGVGAEYAKLAFEAFSLPPFIPVTQQVTPDPAFPTVAFPNPEEGKGALKLAIETA
+EANKSRIILANDPDADRLAVAEKQPEYVFLFYLISNNGTWKVFNGNEIGILFADWAWQNC
+RRVYPDVPADQFFMINTAVSSAMLKSMAKKDGYIHEETLTGFKWVGNKARELLDQNKRFL
+FAYEEAIGFMYGDVSLDKDGVRCAAIFAELALYQYANGSSCQRHLDSLYERYGYHISKNR
+YFFCYEPPKMVAIFNAIRNNKNYPTKCGEFEIERIRDLTDDYDNGYPDNKARLPISKSTQ
+MITFFFKNGAIATLRGSGTEPKLKYYVEMIGDNKSEVEAILAKVVTAVIDNFLRPVENQL
+TPPKDD
+>Ellipt
+MADLDKLVEDWMRWDKNTKTRDEVQKMVAQGDKKALAAALQNRIAFGTAGLRGPMKAGFA
+NMNDLTVIQASQGLCIYVSATIADAAKKGVVVGYDGRHNSLQFARLTAATFRSKGFKVYL
+FSTVVPTPYVAFSVPELGACVGVMVTASHNPKDDNGYKIDVEKLLKEDGVEDPLEKITAS
+YMSKVADYSIKSHPATKDIVMSDDKIVYTAMHGVGGEYTRRSFKAFSLPEFIPVVQQFHP
+DPEFPTVTFPNPEEGKGALKLAIETAEKNNSRLILANDPDADRLAVAERQPDGTWKVFNG
+NEIGVLFADWAWKNARARDPTTPASEFFMVNTAVSSAMLKTMAKTEGYTYEETLTGFKWV
+GNKAKEAIDKGGRFLFAYEEAIGFMYGDVSLDKDGVRTAPIFAQMALSLYAKGLSCVDHL
+EQLMKTYGYHISRNRYFFCYEPPKMVAIFDKIRNNGNFPKHCGPFEIVRVRDLTVDYDDA
+YEDKKARLPVSTSTQMITFYFKNGAIATLRGSGTEPKLKYYVEMIGDKSAKKEDVEKTLA
+EVVKQVIDNFLRPVENELTPPKDD
+>Lepto
+MASSERLQQLIQDWLKWDKNPTTLSEIQELVKKNDEKELRARLENRIAFGTAGMFLLGPM
+KAGFSCMNDLTVIQASQGLCIYVSDTIPNALNSGVVVGYDGRYNSKEFAKYTAATFLSKG
+YKVYLFSKVVPTPYVAFAVTELKAAIGVMITASHNPKDDNGYKVYWDNGCQINTPHDKGI
+AKQIQLNLEPWNVCAFFLDINANELLSGSSVVDPLDTIVNSYNSKITSYSVGNSGVKLAN
+EKIVYTAMHGVGGEYTKLAFEAFKLPPFVPVPQQYTPDPAFPTVAFPNPEEGKGALKLSI
+ETAEANGSRLILANDPDADRLAVAERNTNGTWKVFNGNEIGVLLADWAWQNARRAHPDTP
+ANRYFMINTAVSSAMLKTMAKHEGYRCDETLTGFKWVGNQARKVIDEEKLNFLFAYEEAI
+GFMYGDVSLDKDGVRCAPIFAEMALSYYAQGHSCEDHLETLYKRYGYHISRNRYFFCYEP
+PKMVAIFDRIRNGRNFPTKCGRFEIERVRDLTVDYDDAYPDKKARLPVSTSTQMITFWFK
+NGGIATLRGSGTEPKLKYYVEMIGQDKQVVEKELAELVDAVIQQFLRPVENELTPPKDD
--- /dev/null
+DDB_G0280897 603 15 60 61
+PPL_06716 602 641 60 61
+DFA_03821 601 1266 60 61
+DLA_10096 739 1890 60 61
+DPU1265769 466 2654 60 61
+440792448 1302 3139 60 61
+ENY64621.1 594 4476 60 61
+Ppo014092.000 592 5095 60 61
+ADB0001102_3 589 5711 60 61
+Carpum 655 6318 60 61
+Cephalum 536 6994 60 61
+Violaceum 605 7550 60 61
+Deminut 606 8175 60 61
+Ellipt 564 8800 60 61
+Lepto 599 9381 60 61
--- /dev/null
+package jalview.ext.jmol;
+
+import jalview.datamodel.Alignment;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceI;
+import jalview.gui.AlignFrame;
+import jalview.gui.SequenceRenderer;
+import jalview.structure.StructureMappingcommandSet;
+import jalview.structure.StructureSelectionManager;
+
+import org.testng.annotations.Test;
+
+public class JmolCommandsTest
+{
+
+ @Test(groups = { "Functional" })
+ public void testGetColourBySequenceCommand_noFeatures()
+ {
+ SequenceI seq1 = new Sequence("seq1", "MHRSQTRALK");
+ SequenceI seq2 = new Sequence("seq2", "MRLEITQSGD");
+ AlignmentI al = new Alignment(new SequenceI[] { seq1, seq2 });
+ AlignFrame af = new AlignFrame(al, 800, 500);
+ SequenceRenderer sr = new SequenceRenderer(af.getViewport());
+ SequenceI[][] seqs = new SequenceI[][] { { seq1 }, { seq2 } };
+ String[] files = new String[] { "seq1.pdb", "seq2.pdb" };
+ StructureSelectionManager ssm = new StructureSelectionManager();
+
+ // need some mappings!
+
+ StructureMappingcommandSet[] commands = JmolCommands
+ .getColourBySequenceCommand(ssm, files, seqs, sr, null, al);
+ }
+}
import jalview.io.FormatAdapter;
import jalview.structure.StructureSelectionManager;
-import java.util.LinkedHashSet;
-import java.util.Set;
+import java.util.ArrayList;
+import java.util.List;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.BeforeMethod;
AlignedCodonFrame acf1 = new AlignedCodonFrame();
AlignedCodonFrame acf2 = new AlignedCodonFrame();
- Set<AlignedCodonFrame> mappings = new LinkedHashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> mappings = new ArrayList<AlignedCodonFrame>();
mappings.add(acf1);
mappings.add(acf2);
af1.getViewport().getAlignment().setCodonFrames(mappings);
*/
StructureSelectionManager ssm = StructureSelectionManager
.getStructureSelectionManager(Desktop.instance);
- assertEquals(2, ssm.seqmappings.size());
- assertTrue(ssm.seqmappings.contains(acf1));
- assertTrue(ssm.seqmappings.contains(acf2));
+ assertEquals(2, ssm.getSequenceMappings().size());
+ assertTrue(ssm.getSequenceMappings().contains(acf1));
+ assertTrue(ssm.getSequenceMappings().contains(acf2));
/*
* Close the second view. Verify that mappings are not removed as the first
* view still holds a reference to them.
*/
af1.closeMenuItem_actionPerformed(false);
- assertEquals(2, ssm.seqmappings.size());
- assertTrue(ssm.seqmappings.contains(acf1));
- assertTrue(ssm.seqmappings.contains(acf2));
+ assertEquals(2, ssm.getSequenceMappings().size());
+ assertTrue(ssm.getSequenceMappings().contains(acf1));
+ assertTrue(ssm.getSequenceMappings().contains(acf2));
}
/**
AlignedCodonFrame acf2 = new AlignedCodonFrame();
AlignedCodonFrame acf3 = new AlignedCodonFrame();
- Set<AlignedCodonFrame> mappings1 = new LinkedHashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> mappings1 = new ArrayList<AlignedCodonFrame>();
mappings1.add(acf1);
af1.getViewport().getAlignment().setCodonFrames(mappings1);
- Set<AlignedCodonFrame> mappings2 = new LinkedHashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> mappings2 = new ArrayList<AlignedCodonFrame>();
mappings2.add(acf2);
mappings2.add(acf3);
af2.getViewport().getAlignment().setCodonFrames(mappings2);
* AlignFrame1 has mapping acf1, AlignFrame2 has acf2 and acf3
*/
- Set<AlignedCodonFrame> ssmMappings = ssm.seqmappings;
+ List<AlignedCodonFrame> ssmMappings = ssm.getSequenceMappings();
assertEquals(0, ssmMappings.size());
ssm.registerMapping(acf1);
assertEquals(1, ssmMappings.size());
AlignedCodonFrame acf2 = new AlignedCodonFrame();
AlignedCodonFrame acf3 = new AlignedCodonFrame();
- Set<AlignedCodonFrame> mappings1 = new LinkedHashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> mappings1 = new ArrayList<AlignedCodonFrame>();
mappings1.add(acf1);
mappings1.add(acf2);
af1.getViewport().getAlignment().setCodonFrames(mappings1);
- Set<AlignedCodonFrame> mappings2 = new LinkedHashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> mappings2 = new ArrayList<AlignedCodonFrame>();
mappings2.add(acf2);
mappings2.add(acf3);
af2.getViewport().getAlignment().setCodonFrames(mappings2);
* AlignFrame1 has mappings acf1 and acf2, AlignFrame2 has acf2 and acf3
*/
- Set<AlignedCodonFrame> ssmMappings = ssm.seqmappings;
+ List<AlignedCodonFrame> ssmMappings = ssm.getSequenceMappings();
assertEquals(0, ssmMappings.size());
ssm.registerMapping(acf1);
assertEquals(1, ssmMappings.size());
import java.io.File;
-import org.junit.Assert;
import org.testng.annotations.AfterClass;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.BeforeMethod;
{
for (int q = p + 1; q < avec.length; q++)
{
- Assert.assertNotEquals("Found a duplicate annotation row "
- + avec[p].label, avec[p], avec[q]);
+ assertTrue("Found a duplicate annotation row "
+ + avec[p].label, avec[p] != avec[q]);
}
}
}
FormatAdapter rf = new FormatAdapter();
AlignmentI al = rf.readFile(ff, AppletFormatAdapter.FILE,
- new IdentifyFile().Identify(ff, AppletFormatAdapter.FILE));
+ new IdentifyFile().identify(ff, AppletFormatAdapter.FILE));
// make sure dataset is initialised ? not sure about this
for (int i = 0; i < al.getSequencesArray().length; ++i)
package jalview.io;
import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
import static org.testng.AssertJUnit.assertNotNull;
+import static org.testng.AssertJUnit.assertNull;
+import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
+import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
+import jalview.datamodel.AlignedCodonFrame;
+import jalview.datamodel.Alignment;
import jalview.datamodel.AlignmentI;
+import jalview.datamodel.Mapping;
+import jalview.datamodel.SequenceDummy;
import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
import jalview.gui.AlignFrame;
+import jalview.schemes.AnnotationColourGradient;
+import jalview.schemes.GraduatedColor;
import java.awt.Color;
import java.io.File;
import java.io.IOException;
+import java.util.Iterator;
import java.util.Map;
+import java.util.Set;
import org.testng.annotations.Test;
public class FeaturesFileTest
{
- static String TestFiles[][] = { { "Test example features import/export",
- "examples/uniref50.fa", "examples/exampleFeatures.txt" } };
+ private static String simpleGffFile = "examples/testdata/simpleGff3.gff";
@Test(groups = { "Functional" })
public void testParse() throws Exception
{
- testFeaturesFileIO("Features file test");
- }
-
- public static AlignmentI readAlignmentFile(File f) throws IOException
- {
- System.out.println("Reading file: " + f);
- String ff = f.getPath();
- FormatAdapter rf = new FormatAdapter();
-
- AlignmentI al = rf.readFile(ff, AppletFormatAdapter.FILE,
- new IdentifyFile().Identify(ff, AppletFormatAdapter.FILE));
-
- al.setDataset(null); // creates dataset sequences
- assertNotNull("Couldn't read supplied alignment data.", al);
- return al;
- }
-
- /**
- * Helper method for testing
- *
- * @param testname
- * @param f
- * alignment file
- * @param featFile
- * features file to load on to the alignment
- * @throws IOException
- */
- public static void testFeaturesFileIO(String testname) throws IOException
- {
File f = new File("examples/uniref50.fa");
AlignmentI al = readAlignmentFile(f);
AlignFrame af = new AlignFrame(al, 500, 500);
.getFeatureColours();
FeaturesFile featuresFile = new FeaturesFile(
"examples/exampleFeatures.txt", FormatAdapter.FILE);
- assertTrue("Test " + testname + "\nFailed to parse features file.",
+ assertTrue("Test " + "Features file test"
+ + "\nFailed to parse features file.",
featuresFile.parse(al.getDataset(), colours, true));
/*
assertEquals("netphos", sf.featureGroup);
assertEquals("PHOSPHORYLATION (T)", sf.type);
}
+
+ /**
+ * Test parsing a features file with a mix of Jalview and GFF formatted
+ * content
+ *
+ * @throws Exception
+ */
+ @Test(groups = { "Functional" })
+ public void testParse_mixedJalviewGff() throws Exception
+ {
+ File f = new File("examples/uniref50.fa");
+ AlignmentI al = readAlignmentFile(f);
+ AlignFrame af = new AlignFrame(al, 500, 500);
+ Map<String, Object> colours = af.getFeatureRenderer()
+ .getFeatureColours();
+ // GFF2 uses space as name/value separator in column 9
+ String gffData = "METAL\tcc9900\n" + "GFF\n"
+ + "FER_CAPAA\tuniprot\tMETAL\t44\t45\t4.0\t.\t.\tNote Iron-sulfur; Note 2Fe-2S\n"
+ + "FER1_SOLLC\tuniprot\tPfam\t55\t130\t2.0\t.\t.";
+ FeaturesFile featuresFile = new FeaturesFile(gffData,
+ FormatAdapter.PASTE);
+ assertTrue("Failed to parse features file",
+ featuresFile.parse(al.getDataset(), colours, true));
+
+ // verify colours read or synthesized
+ colours = af.getFeatureRenderer().getFeatureColours();
+ assertEquals("1 feature group colours not found", 1, colours.size());
+ assertEquals(colours.get("METAL"), new Color(0xcc9900));
+
+ // verify feature on FER_CAPAA
+ SequenceFeature[] sfs = al.getSequenceAt(0).getDatasetSequence()
+ .getSequenceFeatures();
+ assertEquals(1, sfs.length);
+ SequenceFeature sf = sfs[0];
+ assertEquals("Iron-sulfur; 2Fe-2S", sf.description);
+ assertEquals(44, sf.begin);
+ assertEquals(45, sf.end);
+ assertEquals("uniprot", sf.featureGroup);
+ assertEquals("METAL", sf.type);
+ assertEquals(4f, sf.getScore(), 0.001f);
+
+ // verify feature on FER1_SOLLC
+ sfs = al.getSequenceAt(2).getDatasetSequence().getSequenceFeatures();
+ assertEquals(1, sfs.length);
+ sf = sfs[0];
+ assertEquals("uniprot", sf.description);
+ assertEquals(55, sf.begin);
+ assertEquals(130, sf.end);
+ assertEquals("uniprot", sf.featureGroup);
+ assertEquals("Pfam", sf.type);
+ assertEquals(2f, sf.getScore(), 0.001f);
+ }
+
+ public static AlignmentI readAlignmentFile(File f) throws IOException
+ {
+ System.out.println("Reading file: " + f);
+ String ff = f.getPath();
+ FormatAdapter rf = new FormatAdapter();
+
+ AlignmentI al = rf.readFile(ff, FormatAdapter.FILE,
+ new IdentifyFile().identify(ff, FormatAdapter.FILE));
+
+ al.setDataset(null); // creates dataset sequences
+ assertNotNull("Couldn't read supplied alignment data.", al);
+ return al;
+ }
+
+ /**
+ * Test various ways of describing a feature colour scheme
+ *
+ * @throws Exception
+ */
+ @Test(groups = { "Functional" })
+ public void testParseGraduatedColourScheme() throws Exception
+ {
+ FeaturesFile ff = new FeaturesFile();
+
+ // colour by label:
+ GraduatedColor gc = ff.parseGraduatedColourScheme(
+ "BETA-TURN-IR\t9a6a94", "label");
+ assertTrue(gc.isColourByLabel());
+ assertEquals(Color.white, gc.getMinColor());
+ assertEquals(Color.black, gc.getMaxColor());
+ assertTrue(gc.isAutoScale());
+
+ // using colour name, rgb, etc:
+ String spec = "blue|255,0,255|absolute|20.0|95.0|below|66.0";
+ gc = ff.parseGraduatedColourScheme("BETA-TURN-IR\t" + spec, spec);
+ assertFalse(gc.isColourByLabel());
+ assertEquals(Color.blue, gc.getMinColor());
+ assertEquals(new Color(255, 0, 255), gc.getMaxColor());
+ assertFalse(gc.isAutoScale());
+ assertFalse(gc.getTolow());
+ assertEquals(20.0f, gc.getMin(), 0.001f);
+ assertEquals(95.0f, gc.getMax(), 0.001f);
+ assertEquals(AnnotationColourGradient.BELOW_THRESHOLD,
+ gc.getThreshType());
+ assertEquals(66.0f, gc.getThresh(), 0.001f);
+
+ // inverse gradient high to low:
+ spec = "blue|255,0,255|95.0|20.0|below|66.0";
+ gc = ff.parseGraduatedColourScheme("BETA-TURN-IR\t" + spec, spec);
+ assertTrue(gc.isAutoScale());
+ assertTrue(gc.getTolow());
+ }
+
+ /**
+ * Test parsing a features file with GFF formatted content only
+ *
+ * @throws Exception
+ */
+ @Test(groups = { "Functional" })
+ public void testParse_pureGff3() throws Exception
+ {
+ File f = new File("examples/uniref50.fa");
+ AlignmentI al = readAlignmentFile(f);
+ AlignFrame af = new AlignFrame(al, 500, 500);
+ Map<String, Object> colours = af.getFeatureRenderer()
+ .getFeatureColours();
+ // GFF3 uses '=' separator for name/value pairs in colum 9
+ String gffData = "##gff-version 3\n"
+ + "FER_CAPAA\tuniprot\tMETAL\t39\t39\t0.0\t.\t.\t"
+ + "Note=Iron-sulfur (2Fe-2S);Note=another note;evidence=ECO:0000255|PROSITE-ProRule:PRU00465\n"
+ + "FER1_SOLLC\tuniprot\tPfam\t55\t130\t3.0\t.\t.\tID=$23";
+ FeaturesFile featuresFile = new FeaturesFile(gffData,
+ FormatAdapter.PASTE);
+ assertTrue("Failed to parse features file",
+ featuresFile.parse(al.getDataset(), colours, true));
+
+ // verify feature on FER_CAPAA
+ SequenceFeature[] sfs = al.getSequenceAt(0).getDatasetSequence()
+ .getSequenceFeatures();
+ assertEquals(1, sfs.length);
+ SequenceFeature sf = sfs[0];
+ // description parsed from Note attribute
+ assertEquals("Iron-sulfur (2Fe-2S); another note", sf.description);
+ assertEquals(39, sf.begin);
+ assertEquals(39, sf.end);
+ assertEquals("uniprot", sf.featureGroup);
+ assertEquals("METAL", sf.type);
+ assertEquals(
+ "Note=Iron-sulfur (2Fe-2S);Note=another note;evidence=ECO:0000255|PROSITE-ProRule:PRU00465",
+ sf.getValue("ATTRIBUTES"));
+
+ // verify feature on FER1_SOLLC1
+ sfs = al.getSequenceAt(2).getDatasetSequence().getSequenceFeatures();
+ assertEquals(1, sfs.length);
+ sf = sfs[0];
+ assertEquals("uniprot", sf.description);
+ assertEquals(55, sf.begin);
+ assertEquals(130, sf.end);
+ assertEquals("uniprot", sf.featureGroup);
+ assertEquals("Pfam", sf.type);
+ assertEquals(3f, sf.getScore(), 0.001f);
+ }
+
+ /**
+ * Test parsing a features file with Jalview format features (but no colour
+ * descriptors or startgroup to give the hint not to parse as GFF)
+ *
+ * @throws Exception
+ */
+ @Test(groups = { "Functional" })
+ public void testParse_jalviewFeaturesOnly() throws Exception
+ {
+ File f = new File("examples/uniref50.fa");
+ AlignmentI al = readAlignmentFile(f);
+ AlignFrame af = new AlignFrame(al, 500, 500);
+ Map<String, Object> colours = af.getFeatureRenderer()
+ .getFeatureColours();
+
+ /*
+ * one feature on FER_CAPAA and one on sequence 3 (index 2) FER1_SOLLC
+ */
+ String featureData = "Iron-sulfur (2Fe-2S)\tFER_CAPAA\t-1\t39\t39\tMETAL\n"
+ + "Iron-phosphorus (2Fe-P)\tID_NOT_SPECIFIED\t2\t86\t87\tMETALLIC\n";
+ FeaturesFile featuresFile = new FeaturesFile(featureData,
+ FormatAdapter.PASTE);
+ assertTrue("Failed to parse features file",
+ featuresFile.parse(al.getDataset(), colours, true));
+
+ // verify FER_CAPAA feature
+ SequenceFeature[] sfs = al.getSequenceAt(0).getDatasetSequence()
+ .getSequenceFeatures();
+ assertEquals(1, sfs.length);
+ SequenceFeature sf = sfs[0];
+ assertEquals("Iron-sulfur (2Fe-2S)", sf.description);
+ assertEquals(39, sf.begin);
+ assertEquals(39, sf.end);
+ assertEquals("METAL", sf.type);
+
+ // verify FER1_SOLLC feature
+ sfs = al.getSequenceAt(2).getDatasetSequence().getSequenceFeatures();
+ assertEquals(1, sfs.length);
+ sf = sfs[0];
+ assertEquals("Iron-phosphorus (2Fe-P)", sf.description);
+ assertEquals(86, sf.begin);
+ assertEquals(87, sf.end);
+ assertEquals("METALLIC", sf.type);
+ }
+
+ private void checkDatasetfromSimpleGff3(AlignmentI dataset)
+ {
+ assertEquals("no sequences extracted from GFF3 file", 2,
+ dataset.getHeight());
+
+ SequenceI seq1 = dataset.findName("seq1");
+ SequenceI seq2 = dataset.findName("seq2");
+ assertNotNull(seq1);
+ assertNotNull(seq2);
+ assertFalse(
+ "Failed to replace dummy seq1 with real sequence",
+ seq1 instanceof SequenceDummy
+ && ((SequenceDummy) seq1).isDummy());
+ assertFalse(
+ "Failed to replace dummy seq2 with real sequence",
+ seq2 instanceof SequenceDummy
+ && ((SequenceDummy) seq2).isDummy());
+ String placeholderseq = new SequenceDummy("foo").getSequenceAsString();
+ assertFalse("dummy replacement buggy for seq1",
+ placeholderseq.equals(seq1.getSequenceAsString()));
+ assertFalse("dummy replacement buggy for seq2",
+ placeholderseq.equals(seq2.getSequenceAsString()));
+ assertNotNull("No features added to seq1", seq1.getSequenceFeatures());
+ assertEquals("Wrong number of features", 3,
+ seq1.getSequenceFeatures().length);
+ assertNull(seq2.getSequenceFeatures());
+ assertEquals(
+ "Wrong number of features",
+ 0,
+ seq2.getSequenceFeatures() == null ? 0 : seq2
+ .getSequenceFeatures().length);
+ assertTrue(
+ "Expected at least one CDNA/Protein mapping for seq1",
+ dataset.getCodonFrame(seq1) != null
+ && dataset.getCodonFrame(seq1).size() > 0);
+
+ }
+
+ @Test(groups = { "Functional" })
+ public void readGff3File() throws IOException
+ {
+ FeaturesFile gffreader = new FeaturesFile(true, simpleGffFile,
+ FormatAdapter.FILE);
+ Alignment dataset = new Alignment(gffreader.getSeqsAsArray());
+ gffreader.addProperties(dataset);
+ checkDatasetfromSimpleGff3(dataset);
+ }
+
+ @Test(groups = { "Functional" })
+ public void simpleGff3FileClass() throws IOException
+ {
+ AlignmentI dataset = new Alignment(new SequenceI[] {});
+ FeaturesFile ffile = new FeaturesFile(simpleGffFile,
+ FormatAdapter.FILE);
+
+ boolean parseResult = ffile.parse(dataset, null, false, false);
+ assertTrue("return result should be true", parseResult);
+ checkDatasetfromSimpleGff3(dataset);
+ }
+
+ @Test(groups = { "Functional" })
+ public void simpleGff3FileLoader() throws IOException
+ {
+ AlignFrame af = new FileLoader(false).LoadFileWaitTillLoaded(
+ simpleGffFile, FormatAdapter.FILE);
+ assertTrue(
+ "Didn't read the alignment into an alignframe from Gff3 File",
+ af != null);
+ checkDatasetfromSimpleGff3(af.getViewport().getAlignment());
+ }
+
+ @Test(groups = { "Functional" })
+ public void simpleGff3RelaxedIdMatching() throws IOException
+ {
+ AlignmentI dataset = new Alignment(new SequenceI[] {});
+ FeaturesFile ffile = new FeaturesFile(simpleGffFile,
+ FormatAdapter.FILE);
+
+ boolean parseResult = ffile.parse(dataset, null, false, true);
+ assertTrue("return result (relaxedID matching) should be true",
+ parseResult);
+ checkDatasetfromSimpleGff3(dataset);
+ }
}
{
AssertJUnit.assertTrue("Couldn't resolve " + src + " as a valid file",
fp.isValid());
- String type = new IdentifyFile().Identify(fp);
+ String type = new IdentifyFile().identify(fp);
AssertJUnit.assertTrue("Data from '" + src + "' Expected to be '" + fmt
+ "' identified as '" + type + "'", type.equalsIgnoreCase(fmt));
}
+++ /dev/null
-/*
- * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
- * Copyright (C) $$Year-Rel$$ The Jalview Authors
- *
- * This file is part of Jalview.
- *
- * Jalview is free software: you can redistribute it and/or
- * modify it under the terms of the GNU General Public License
- * as published by the Free Software Foundation, either version 3
- * of the License, or (at your option) any later version.
- *
- * Jalview is distributed in the hope that it will be useful, but
- * WITHOUT ANY WARRANTY; without even the implied warranty
- * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
- * PURPOSE. See the GNU General Public License for more details.
- *
- * You should have received a copy of the GNU General Public License
- * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
- * The Jalview Authors are detailed in the 'AUTHORS' file.
- */
-package jalview.io;
-
-import static org.testng.AssertJUnit.assertEquals;
-import static org.testng.AssertJUnit.assertFalse;
-import static org.testng.AssertJUnit.assertNotNull;
-import static org.testng.AssertJUnit.assertNull;
-import static org.testng.AssertJUnit.assertTrue;
-
-import jalview.datamodel.Alignment;
-import jalview.datamodel.AlignmentI;
-import jalview.datamodel.SequenceDummy;
-import jalview.datamodel.SequenceI;
-import jalview.gui.AlignFrame;
-
-import java.io.IOException;
-
-import org.testng.annotations.Test;
-
-public class Gff3tests
-{
-
- private static String exonerateSeqs = "examples/testdata/exonerateseqs.fa",
- exonerateOutput = "examples/testdata/exonerateoutput.gff",
- simpleGff3file = "examples/testdata/simpleGff3.gff";
-
- @Test(groups = { "Functional" })
- public void testExonerateImport()
- {
- // exonerate does not tag sequences after features, so we have a more
- // conventional annotation import test here
-
- FileLoader loader = new FileLoader(false);
-
- AlignFrame af = loader.LoadFileWaitTillLoaded(exonerateSeqs,
- FormatAdapter.FILE);
-
- assertEquals("Unexpected number of DNA protein associations", 0, af
- .getViewport().getAlignment().getCodonFrames().size());
-
- af.loadJalviewDataFile(exonerateOutput, FormatAdapter.FILE, null, null);
-
- assertTrue("Expected at least one DNA protein association", af
- .getViewport().getAlignment().getDataset().getCodonFrames()
- .size() > 0);
-
- }
-
- @Test(groups = { "Functional" })
- public void simpleGff3FileIdentify()
- {
- assertEquals("Didn't recognise file correctly.", IdentifyFile.GFF3File,
- new IdentifyFile().Identify(simpleGff3file, FormatAdapter.FILE));
- }
-
- @Test(groups = { "Functional" })
- public void simpleGff3FileClass() throws IOException
- {
- AlignmentI dataset = new Alignment(new SequenceI[] {});
- FeaturesFile ffile = new FeaturesFile(simpleGff3file,
- FormatAdapter.FILE);
-
- boolean parseResult = ffile.parse(dataset, null, null, false, false);
- assertTrue("return result should be true", parseResult);
- checkDatasetfromSimpleGff3(dataset);
- }
-
- @Test(groups = { "Functional" })
- public void simpleGff3FileLoader() throws IOException
- {
- AlignFrame af = new FileLoader(false).LoadFileWaitTillLoaded(
- simpleGff3file, FormatAdapter.FILE);
- assertTrue(
- "Didn't read the alignment into an alignframe from Gff3 File",
- af != null);
- checkDatasetfromSimpleGff3(af.getViewport().getAlignment().getDataset());
- }
-
- @Test(groups = { "Functional" })
- public void simpleGff3RelaxedIdMatching() throws IOException
- {
- AlignmentI dataset = new Alignment(new SequenceI[] {});
- FeaturesFile ffile = new FeaturesFile(simpleGff3file,
- FormatAdapter.FILE);
-
- boolean parseResult = ffile.parse(dataset, null, null, false, true);
- assertTrue("return result (relaxedID matching) should be true",
- parseResult);
- checkDatasetfromSimpleGff3(dataset);
- }
-
- @Test(groups = { "Functional" })
- public void readGff3File() throws IOException
- {
- Gff3File gff3reader = new Gff3File(simpleGff3file, FormatAdapter.FILE);
- Alignment dataset = new Alignment(gff3reader.getSeqsAsArray());
- gff3reader.addProperties(dataset);
- checkDatasetfromSimpleGff3(dataset);
-
- }
-
- private void checkDatasetfromSimpleGff3(AlignmentI dataset)
- {
- assertEquals("no sequences extracted from GFF3 file", 2,
- dataset.getHeight());
-
- SequenceI seq1 = dataset.findName("seq1"), seq2 = dataset
- .findName("seq2");
- assertNotNull(seq1);
- assertNotNull(seq2);
- assertFalse(
- "Failed to replace dummy seq1 with real sequence",
- seq1 instanceof SequenceDummy
- && ((SequenceDummy) seq1).isDummy());
- assertFalse(
- "Failed to replace dummy seq2 with real sequence",
- seq2 instanceof SequenceDummy
- && ((SequenceDummy) seq2).isDummy());
- String placeholderseq = new SequenceDummy("foo").getSequenceAsString();
- assertFalse("dummy replacement buggy for seq1",
- placeholderseq.equals(seq1.getSequenceAsString()));
- assertFalse("dummy replacement buggy for seq2",
- placeholderseq.equals(seq2.getSequenceAsString()));
- assertNotNull("No features added to seq1", seq1.getSequenceFeatures());// !=
- // null);
- assertEquals("Wrong number of features", 3,
- seq1.getSequenceFeatures().length);
- assertNull(seq2.getSequenceFeatures());
- assertEquals(
- "Wrong number of features",
- 0,
- seq2.getSequenceFeatures() == null ? 0 : seq2
- .getSequenceFeatures().length);
- assertTrue(
- "Expected at least one CDNA/Protein mapping for seq1",
- dataset.getCodonFrame(seq1) != null
- && dataset.getCodonFrame(seq1).size() > 0);
-
- }
- // @Test(groups ={ "Functional" })
- // public final void testPrintGFFFormatSequenceIArrayMapOfStringObject()
- // {
- // fail("Not yet implemented");
- // }
- //
- // @Test(groups ={ "Functional" })
- // public final void testAlignFileBooleanStringString()
- // {
- // fail("Not yet implemented");
- // }
-
-}
*/
package jalview.io;
-import static org.junit.Assert.fail;
-
import org.testng.annotations.Test;
public class HtmlFileTest
@Test(groups = { "Functional" }, enabled = false)
public void test()
{
- fail("Not yet implemented");
+ org.testng.AssertJUnit.fail("Not yet implemented");
}
}
*/
package jalview.io;
+import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertTrue;
+
import org.testng.Assert;
import org.testng.annotations.DataProvider;
import org.testng.annotations.Test;
{
@Test(groups = { "Functional" }, dataProvider = "identifyFiles")
- public void Identify(String data, String expectedFileType)
+ public void testIdentify(String data, String expectedFileType)
{
String protocol = AppletFormatAdapter.FILE;
IdentifyFile ider = new IdentifyFile();
- String actualFiletype = ider.Identify(data, protocol);
+ String actualFiletype = ider.identify(data, protocol);
Assert.assertEquals(actualFiletype, expectedFileType,
"File identification Failed!");
}
+ /**
+ * Additional tests for (a) Jalview features file with no colour
+ * specifications (old style 'groups' file) and (b) Jalview features file with
+ * embedded GFF
+ */
+ @Test(groups = "Functional")
+ public void testIdentify_featureFile()
+ {
+ IdentifyFile ider = new IdentifyFile();
+
+ // Jalview format with features only, no feature colours
+ String data = "Iron-sulfur (2Fe-2S)\tFER_CAPAA\t-1\t39\t39\tMETAL\n"
+ + "Iron-phosphorus (2Fe-P)\tID_NOT_SPECIFIED\t2\t86\t87\tMETALLIC\n";
+ Assert.assertEquals(IdentifyFile.FeaturesFile, ider.identify(data, AppletFormatAdapter.PASTE));
+
+ // Jalview feature colour followed by GFF format feature data
+ data = "METAL\tcc9900\n" + "GFF\n"
+ + "FER_CAPAA\tuniprot\tMETAL\t44\t45\t4.0\t.\t.\n";
+ Assert.assertEquals(IdentifyFile.FeaturesFile,
+ ider.identify(data, AppletFormatAdapter.PASTE));
+ }
+
@DataProvider(name = "identifyFiles")
public Object[][] IdentifyFileDP()
{
{ "examples/testdata/test.html", "HTML" },
{ "examples/testdata/test.pileup", "PileUp" },
{ "examples/testdata/test.blc", "BLC" },
- { "examples/testdata/simplegff3.gff", "GFF v2 or v3" },
+ { "examples/exampleFeatures.txt", IdentifyFile.FeaturesFile },
+ { "examples/testdata/simpleGff3.gff", IdentifyFile.FeaturesFile },
{ "examples/testdata/test.jvp", "Jalview" },
{
"examples/testdata/cullpdb_pc25_res3.0_R0.3_d150729_chains9361.fasta.15316",
};
}
+ @Test(groups = "Functional")
+ public void testLooksLikeFeatureData()
+ {
+ IdentifyFile id = new IdentifyFile();
+ assertFalse(id.looksLikeFeatureData(null));
+ assertFalse(id.looksLikeFeatureData(""));
+ // too few columns:
+ assertFalse(id.looksLikeFeatureData("1 \t 2 \t 3 \t 4 \t 5"));
+ // GFF format:
+ assertTrue(id
+ .looksLikeFeatureData("Seq1\tlocal\tHelix\t2456\t2462\tss"));
+ // Jalview format:
+ assertTrue(id.looksLikeFeatureData("Helix\tSeq1\t-1\t2456\t2462\tss"));
+ // non-numeric start column:
+ assertFalse(id.looksLikeFeatureData("Helix\tSeq1\t-1\t.\t2462\tss"));
+ // non-numeric start column:
+ assertFalse(id.looksLikeFeatureData("Helix\tSeq1\t-1\t2456\t.\tss"));
+ }
}
{
AppletFormatAdapter af = new AppletFormatAdapter();
AlignmentI al = af.readFile(PfamFile, af.FILE,
- new IdentifyFile().Identify(PfamFile, af.FILE));
+ new IdentifyFile().identify(PfamFile, af.FILE));
int numpdb = 0;
for (SequenceI sq : al.getSequences())
{
AppletFormatAdapter rf = new AppletFormatAdapter();
AlignmentI al = rf.readFile(ff, AppletFormatAdapter.FILE,
- new IdentifyFile().Identify(ff, AppletFormatAdapter.FILE));
+ new IdentifyFile().identify(ff, AppletFormatAdapter.FILE));
assertNotNull("Couldn't read supplied alignment data.", al);
AppletFormatAdapter.PASTE, ioformat);
assertNotNull("Couldn't parse reimported alignment data.", al_input);
- String identifyoutput = new IdentifyFile().Identify(outputfile,
+ String identifyoutput = new IdentifyFile().identify(outputfile,
AppletFormatAdapter.PASTE);
assertNotNull("Identify routine failed for outputformat " + ioformat,
identifyoutput);
--- /dev/null
+package jalview.io.gff;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertNull;
+import static org.testng.AssertJUnit.assertSame;
+import static org.testng.AssertJUnit.assertTrue;
+import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
+
+import jalview.datamodel.AlignedCodonFrame;
+import jalview.datamodel.Alignment;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.Mapping;
+import jalview.datamodel.MappingType;
+import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceI;
+import jalview.gui.AlignFrame;
+import jalview.io.FileLoader;
+import jalview.io.FormatAdapter;
+
+import java.io.IOException;
+import java.util.ArrayList;
+import java.util.Iterator;
+import java.util.List;
+import java.util.Map;
+
+import org.testng.annotations.Test;
+
+public class ExonerateHelperTest
+{
+ @Test(groups = "Functional")
+ public void testGetMappingType()
+ {
+ // protein-to-dna:
+ assertSame(MappingType.PeptideToNucleotide,
+ ExonerateHelper
+ .getMappingType("exonerate:protein2genome:local"));
+ assertSame(MappingType.PeptideToNucleotide,
+ ExonerateHelper.getMappingType("exonerate:protein2dna:local"));
+
+ // dna-to-dna:
+ assertSame(MappingType.NucleotideToNucleotide,
+ ExonerateHelper.getMappingType("coding2coding"));
+ assertSame(MappingType.NucleotideToNucleotide,
+ ExonerateHelper.getMappingType("coding2genome"));
+ assertSame(MappingType.NucleotideToNucleotide,
+ ExonerateHelper.getMappingType("cdna2genome"));
+ assertSame(MappingType.NucleotideToNucleotide,
+ ExonerateHelper.getMappingType("genome2genome"));
+ assertNull(ExonerateHelper.getMappingType("affine:local"));
+ }
+
+ /**
+ * Test processing one exonerate GFF line for the case where the mapping is
+ * protein2dna, similarity feature is on the query (the protein), match to the
+ * forward strand, target sequence is in neither the alignment nor the 'new
+ * sequences'
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Functional")
+ public void testProcessGffSimilarity_protein2dna_forward_querygff()
+ throws IOException
+ {
+ ExonerateHelper testee = new ExonerateHelper();
+ List<SequenceI> newseqs = new ArrayList<SequenceI>();
+ String[] gff = "Seq\texonerate:protein2dna:local\tsimilarity\t3\t10\t.\t+\t.\talignment_id 0 ; Target dna1 ; Align 3 400 8"
+ .split("\\t");
+ SequenceI seq = new Sequence("Seq", "PQRASTGKEEDVMIWCHQN");
+ seq.createDatasetSequence();
+ AlignmentI align = new Alignment(new SequenceI[] {});
+ Map<String, List<String>> set = Gff2Helper.parseNameValuePairs(gff[8]);
+
+ /*
+ * this should create a mapping from Seq2/3-10 to virtual sequence
+ * dna1 (added to newseqs) positions 400-423
+ */
+ testee.processGffSimilarity(set, seq, gff, align, newseqs, false);
+ assertEquals(1, newseqs.size());
+ assertTrue(newseqs.get(0) instanceof SequenceDummy);
+ assertEquals("dna1", newseqs.get(0).getName());
+ assertEquals(1, align.getCodonFrames().size());
+ AlignedCodonFrame mapping = align.getCodonFrames().iterator().next();
+ assertEquals(1, mapping.getAaSeqs().length);
+ assertSame(seq.getDatasetSequence(), mapping.getAaSeqs()[0]);
+ assertEquals(1, mapping.getdnaSeqs().length);
+ assertSame(newseqs.get(0), mapping.getdnaSeqs()[0]);
+ assertEquals(1, mapping.getdnaToProt().length);
+ assertEquals(1, mapping.getdnaToProt()[0].getFromRanges().size());
+ assertArrayEquals(new int[] { 400, 423 }, mapping.getdnaToProt()[0]
+ .getFromRanges().get(0));
+ assertEquals(1, mapping.getdnaToProt()[0].getToRanges().size());
+ assertArrayEquals(new int[] { 3, 10 }, mapping.getdnaToProt()[0]
+ .getToRanges().get(0));
+ }
+
+ /**
+ * Test processing one exonerate GFF line for the case where the mapping is
+ * protein2dna, similarity feature is on the query (the protein), match to the
+ * reverse strand
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Functional")
+ public void testProcessGffSimilarity_protein2dna_reverse_querygff()
+ throws IOException
+ {
+ ExonerateHelper testee = new ExonerateHelper();
+ List<SequenceI> newseqs = new ArrayList<SequenceI>();
+ String[] gff = "Seq\texonerate:protein2dna:local\tsimilarity\t3\t10\t0\t-\t.\talignment_id 0 ; Target dna1 ; Align 3 400 8"
+ .split("\\t");
+ SequenceI seq = new Sequence("Seq", "PQRASTGKEEDVMIWCHQN");
+ seq.createDatasetSequence();
+ AlignmentI align = new Alignment(new SequenceI[] {});
+ Map<String, List<String>> set = Gff2Helper.parseNameValuePairs(gff[8]);
+
+ /*
+ * this should create a mapping from Seq2/3-10 to virtual sequence
+ * dna1 (added to newseqs) positions 400-377 (reverse)
+ */
+ testee.processGffSimilarity(set, seq, gff, align, newseqs, false);
+ assertEquals(1, newseqs.size());
+ assertTrue(newseqs.get(0) instanceof SequenceDummy);
+ assertEquals("dna1", newseqs.get(0).getName());
+ assertEquals(1, align.getCodonFrames().size());
+ AlignedCodonFrame mapping = align.getCodonFrames().iterator().next();
+ assertEquals(1, mapping.getAaSeqs().length);
+ assertSame(seq.getDatasetSequence(), mapping.getAaSeqs()[0]);
+ assertEquals(1, mapping.getdnaSeqs().length);
+ assertSame(newseqs.get(0), mapping.getdnaSeqs()[0]);
+ assertEquals(1, mapping.getdnaToProt().length);
+ assertEquals(1, mapping.getdnaToProt()[0].getFromRanges().size());
+ assertArrayEquals(new int[] { 400, 377 }, mapping.getdnaToProt()[0]
+ .getFromRanges().get(0));
+ assertEquals(1, mapping.getdnaToProt()[0].getToRanges().size());
+ assertArrayEquals(new int[] { 3, 10 }, mapping.getdnaToProt()[0]
+ .getToRanges().get(0));
+ }
+
+ /**
+ * Test processing one exonerate GFF line for the case where the mapping is
+ * protein2dna, similarity feature is on the target (the dna), match to the
+ * forward strand
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Functional")
+ public void testProcessGffSimilarity_protein2dna_forward_targetgff()
+ throws IOException
+ {
+ ExonerateHelper testee = new ExonerateHelper();
+ List<SequenceI> newseqs = new ArrayList<SequenceI>();
+ String[] gff = "dna1\texonerate:protein2dna:local\tsimilarity\t400\t423\t0\t+\t.\talignment_id 0 ; Query Prot1 ; Align 400 3 24"
+ .split("\\t");
+ SequenceI seq = new Sequence("dna1/391-430",
+ "CGATCCGATCCGATCCGATCCGATCCGATCCGATCCGATC");
+ seq.createDatasetSequence();
+ AlignmentI align = new Alignment(new SequenceI[] { seq });
+ // GFF feature on the target describes mapping from base 400 for
+ // count 24 to position 3
+ Map<String, List<String>> set = Gff2Helper.parseNameValuePairs(gff[8]);
+
+ /*
+ * this should create a mapping from virtual sequence dna1 (added to
+ * newseqs) positions 400-423 to Prot1/3-10
+ */
+ testee.processGffSimilarity(set, seq, gff, align, newseqs, false);
+ assertEquals(1, newseqs.size());
+ assertTrue(newseqs.get(0) instanceof SequenceDummy);
+ assertEquals("Prot1", newseqs.get(0).getName());
+ assertEquals(1, align.getCodonFrames().size());
+ AlignedCodonFrame mapping = align.getCodonFrames().iterator().next();
+ assertEquals(1, mapping.getAaSeqs().length);
+ assertSame(newseqs.get(0), mapping.getAaSeqs()[0]);
+ assertSame(seq.getDatasetSequence(), mapping.getdnaSeqs()[0]);
+ assertEquals(1, mapping.getdnaSeqs().length);
+ assertEquals(1, mapping.getdnaToProt().length);
+ assertEquals(1, mapping.getdnaToProt()[0].getFromRanges().size());
+ assertArrayEquals(new int[] { 400, 423 }, mapping.getdnaToProt()[0]
+ .getFromRanges().get(0));
+ assertEquals(1, mapping.getdnaToProt()[0].getToRanges().size());
+ assertArrayEquals(new int[] { 3, 10 }, mapping.getdnaToProt()[0]
+ .getToRanges().get(0));
+ }
+
+ /**
+ * Test processing one exonerate GFF line for the case where the mapping is
+ * protein2dna, similarity feature is on the target (the dna), match to the
+ * reverse strand
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Functional")
+ public void testProcessGffSimilarity_protein2dna_reverse_targetgff()
+ throws IOException
+ {
+ ExonerateHelper testee = new ExonerateHelper();
+ List<SequenceI> newseqs = new ArrayList<SequenceI>();
+ String[] gff = "dna1\texonerate:protein2dna:local\tsimilarity\t377\t400\t0\t-\t.\talignment_id 0 ; Query Prot1 ; Align 400 3 24"
+ .split("\\t");
+ SequenceI seq = new Sequence("dna1/371-410",
+ "CGATCCGATCCGATCCGATCCGATCCGATCCGATCCGATC");
+ seq.createDatasetSequence();
+ AlignmentI align = new Alignment(new SequenceI[] { seq });
+ // GFF feature on the target describes mapping from base 400 for
+ // count 24 to position 3
+ Map<String, List<String>> set = Gff2Helper.parseNameValuePairs(gff[8]);
+
+ /*
+ * this should create a mapping from virtual sequence dna1 (added to
+ * newseqs) positions 400-377 (reverse) to Prot1/3-10
+ */
+ testee.processGffSimilarity(set, seq, gff, align, newseqs, false);
+ assertEquals(1, newseqs.size());
+ assertTrue(newseqs.get(0) instanceof SequenceDummy);
+ assertEquals("Prot1", newseqs.get(0).getName());
+ assertEquals(1, align.getCodonFrames().size());
+ AlignedCodonFrame mapping = align.getCodonFrames().iterator().next();
+ assertEquals(1, mapping.getAaSeqs().length);
+ assertSame(newseqs.get(0), mapping.getAaSeqs()[0]);
+ assertSame(seq.getDatasetSequence(), mapping.getdnaSeqs()[0]);
+ assertEquals(1, mapping.getdnaSeqs().length);
+ assertEquals(1, mapping.getdnaToProt().length);
+ assertEquals(1, mapping.getdnaToProt()[0].getFromRanges().size());
+ assertArrayEquals(new int[] { 400, 377 }, mapping.getdnaToProt()[0]
+ .getFromRanges().get(0));
+ assertEquals(1, mapping.getdnaToProt()[0].getToRanges().size());
+ assertArrayEquals(new int[] { 3, 10 }, mapping.getdnaToProt()[0]
+ .getToRanges().get(0));
+ }
+
+ /**
+ * Tests loading exonerate GFF2 output, including 'similarity' alignment
+ * feature, on to sequences
+ */
+ @Test(groups = { "Functional" })
+ public void testAddExonerateGffToAlignment()
+ {
+ FileLoader loader = new FileLoader(false);
+ AlignFrame af = loader.LoadFileWaitTillLoaded(
+ "examples/testdata/exonerateseqs.fa",
+ FormatAdapter.FILE);
+
+ af.loadJalviewDataFile("examples/testdata/exonerateoutput.gff",
+ FormatAdapter.FILE, null, null);
+
+ /*
+ * verify one mapping to a dummy sequence, one to a real one
+ */
+ List<AlignedCodonFrame> mappings = af
+ .getViewport().getAlignment().getDataset().getCodonFrames();
+ assertEquals(2, mappings.size());
+ Iterator<AlignedCodonFrame> iter = mappings.iterator();
+
+ // first mapping is to dummy sequence
+ AlignedCodonFrame mapping = iter.next();
+ Mapping[] mapList = mapping.getProtMappings();
+ assertEquals(1, mapList.length);
+ assertTrue(mapList[0].getTo() instanceof SequenceDummy);
+ assertEquals("DDB_G0269124", mapList[0].getTo().getName());
+
+ // 143 in protein should map to codon [11270, 11269, 11268] in dna
+ int[] mappedRegion = mapList[0].getMap().locateInFrom(143, 143);
+ assertArrayEquals(new int[] { 11270, 11268 }, mappedRegion);
+
+ // second mapping is to a sequence in the alignment
+ mapping = iter.next();
+ mapList = mapping.getProtMappings();
+ assertEquals(1, mapList.length);
+ SequenceI proteinSeq = af.getViewport().getAlignment()
+ .findName("DDB_G0280897");
+ assertSame(proteinSeq.getDatasetSequence(), mapList[0].getTo());
+ assertEquals(1, mapping.getdnaToProt().length);
+
+ // 143 in protein should map to codon [11270, 11269, 11268] in dna
+ mappedRegion = mapList[0].getMap().locateInFrom(143, 143);
+ assertArrayEquals(new int[] { 11270, 11268 }, mappedRegion);
+
+ // 182 in protein should map to codon [11153, 11152, 11151] in dna
+ mappedRegion = mapList[0].getMap().locateInFrom(182, 182);
+ assertArrayEquals(new int[] { 11153, 11151 }, mappedRegion);
+
+ // and the reverse mapping:
+ mappedRegion = mapList[0].getMap().locateInTo(11151, 11153);
+ assertArrayEquals(new int[] { 182, 182 }, mappedRegion);
+
+ // 11150 in dna should _not_ map to protein
+ mappedRegion = mapList[0].getMap().locateInTo(11150, 11150);
+ assertNull(mappedRegion);
+
+ // similarly 183 in protein should _not_ map to dna
+ mappedRegion = mapList[0].getMap().locateInFrom(183, 183);
+ assertNull(mappedRegion);
+ }
+}
--- /dev/null
+package jalview.io.gff;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertNull;
+import static org.testng.AssertJUnit.assertSame;
+import static org.testng.AssertJUnit.assertTrue;
+import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
+
+import jalview.datamodel.AlignedCodonFrame;
+import jalview.datamodel.Alignment;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+
+import java.io.IOException;
+import java.util.ArrayList;
+import java.util.List;
+
+import org.testng.annotations.Test;
+
+public class Gff3HelperTest
+{
+
+ /**
+ * Test processing one PASA GFF line giving a match from forward strand to
+ * forward strand
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Functional")
+ public void testProcessCdnaMatch_forwardToForward() throws IOException
+ {
+ GffHelperBase testee = new Gff3Helper();
+ List<SequenceI> newseqs = new ArrayList<SequenceI>();
+ String[] gff = "gi|68711\tblat-pasa\tcDNA_match\t12923\t13060\t98.55\t+\t.\tID=align_68;Target=gi|N37351 1 138 +"
+ .split("\\t");
+ SequenceI seq = new Sequence("gi|68711",
+ "GAATTCGTTCATGTAGGTTGATTTTTATT");
+ seq.createDatasetSequence();
+ AlignmentI align = new Alignment(new SequenceI[] {});
+
+ /*
+ * this should create a mapping from gi|68711/12923-13060
+ * to virtual sequence gi|N37351 (added to newseqs) positions 1-138
+ */
+ testee.processGff(seq, gff, align, newseqs, false);
+ assertEquals(1, newseqs.size());
+ assertTrue(newseqs.get(0) instanceof SequenceDummy);
+ assertEquals("gi|N37351", newseqs.get(0).getName());
+ assertEquals(1, align.getCodonFrames().size());
+ AlignedCodonFrame mapping = align.getCodonFrames().iterator().next();
+
+ /*
+ * 'dnaseqs' (map from) is here [gi|68711]
+ * 'aaseqs' (map to) is here [gi|N37351]
+ */
+ // TODO use more suitable naming in AlignedCodonFrame
+ assertEquals(1, mapping.getAaSeqs().length);
+ assertSame(seq.getDatasetSequence(), mapping.getdnaSeqs()[0]);
+ assertEquals(1, mapping.getdnaSeqs().length);
+ assertSame(newseqs.get(0), mapping.getAaSeqs()[0]);
+ assertEquals(1, mapping.getdnaToProt().length);
+ assertEquals(1, mapping.getdnaToProt()[0].getFromRanges().size());
+ assertArrayEquals(new int[] { 12923, 13060 }, mapping.getdnaToProt()[0]
+ .getFromRanges().get(0));
+ assertEquals(1, mapping.getdnaToProt()[0].getToRanges().size());
+ assertArrayEquals(new int[] { 1, 138 }, mapping.getdnaToProt()[0]
+ .getToRanges().get(0));
+ }
+
+ /**
+ * Test processing one PASA GFF line giving a match from forward strand to
+ * reverse strand
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Functional")
+ public void testProcessCdnaMatch_forwardToReverse() throws IOException
+ {
+ GffHelperBase testee = new Gff3Helper();
+ List<SequenceI> newseqs = new ArrayList<SequenceI>();
+ String[] gff = "gi|68711\tblat-pasa\tcDNA_match\t12923\t13060\t98.55\t+\t.\tID=align_68;Target=gi|N37351 1 138 -"
+ .split("\\t");
+ SequenceI seq = new Sequence("gi|68711",
+ "GAATTCGTTCATGTAGGTTGATTTTTATT");
+ seq.createDatasetSequence();
+ AlignmentI align = new Alignment(new SequenceI[] {});
+
+ /*
+ * this should create a mapping from gi|68711/12923-13060
+ * to virtual sequence gi|N37351 (added to newseqs) positions 138-1
+ */
+ testee.processGff(seq, gff, align, newseqs, false);
+ assertEquals(1, newseqs.size());
+ assertTrue(newseqs.get(0) instanceof SequenceDummy);
+ assertEquals("gi|N37351", newseqs.get(0).getName());
+ assertEquals(1, align.getCodonFrames().size());
+ AlignedCodonFrame mapping = align.getCodonFrames().iterator().next();
+
+ /*
+ * 'dnaseqs' (map from) is here [gi|68711]
+ * 'aaseqs' (map to) is here [gi|N37351]
+ */
+ // TODO use more suitable naming in AlignedCodonFrame
+ assertEquals(1, mapping.getAaSeqs().length);
+ assertSame(seq.getDatasetSequence(), mapping.getdnaSeqs()[0]);
+ assertEquals(1, mapping.getdnaSeqs().length);
+ assertSame(newseqs.get(0), mapping.getAaSeqs()[0]);
+ assertEquals(1, mapping.getdnaToProt().length);
+ assertEquals(1, mapping.getdnaToProt()[0].getFromRanges().size());
+ assertArrayEquals(new int[] { 12923, 13060 }, mapping.getdnaToProt()[0]
+ .getFromRanges().get(0));
+ assertEquals(1, mapping.getdnaToProt()[0].getToRanges().size());
+ assertArrayEquals(new int[] { 138, 1 }, mapping.getdnaToProt()[0]
+ .getToRanges().get(0));
+ }
+
+ /**
+ * Test processing one PASA GFF line giving a match from reverse complement
+ * strand to forward strand
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Functional")
+ public void testProcessCdnaMatch_reverseToForward() throws IOException
+ {
+ GffHelperBase testee = new Gff3Helper();
+ List<SequenceI> newseqs = new ArrayList<SequenceI>();
+ String[] gff = "gi|68711\tblat-pasa\tcDNA_match\t12923\t13060\t98.55\t-\t.\tID=align_68;Target=gi|N37351 1 138 +"
+ .split("\\t");
+ SequenceI seq = new Sequence("gi|68711",
+ "GAATTCGTTCATGTAGGTTGATTTTTATT");
+ seq.createDatasetSequence();
+ AlignmentI align = new Alignment(new SequenceI[] {});
+
+ /*
+ * (For now) we don't process reverse complement mappings; to do this
+ * would require (a) creating a virtual sequence placeholder for the
+ * reverse complement (b) resolving the sequence by its id from some
+ * source (GFF ##FASTA or other) (c) creating the reverse complement
+ * sequence (d) updating the mapping to be to the reverse complement
+ */
+ SequenceFeature sf = testee.processGff(seq, gff, align, newseqs, false);
+ assertNull(sf);
+ assertTrue(newseqs.isEmpty());
+ }
+
+ /**
+ * Test processing two PASA GFF lines representing a spliced mapping
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Functional")
+ public void testProcessCdnaMatch_spliced() throws IOException
+ {
+ GffHelperBase testee = new Gff3Helper();
+ List<SequenceI> newseqs = new ArrayList<SequenceI>();
+ SequenceI seq = new Sequence("gi|68711",
+ "GAATTCGTTCATGTAGGTTGATTTTTATT");
+ seq.createDatasetSequence();
+ AlignmentI align = new Alignment(new SequenceI[] {});
+
+ // mapping from gi|68711 12923-13060 to gi|N37351 1-138
+ String[] gff = "gi|68711\tblat-pasa\tcDNA_match\t12923\t13060\t98.55\t+\t.\tID=align_68;Target=gi|N37351 1 138 +"
+ .split("\\t");
+ testee.processGff(seq, gff, align, newseqs, false);
+ // mapping from gi|68711 13411-13550 to gi|N37351 139-278
+ gff = "gi|68711\tblat-pasa\tcDNA_match\t13411\t13550\t98.55\t+\t.\tID=align_68;Target=gi|N37351 139 278 +"
+ .split("\\t");
+ testee.processGff(seq, gff, align, newseqs, false);
+
+ assertEquals(1, newseqs.size());
+ assertTrue(newseqs.get(0) instanceof SequenceDummy);
+ assertEquals("gi|N37351", newseqs.get(0).getName());
+
+ // only 1 AlignedCodonFrame added to the alignment with both mappings!
+ // (this is important for 'align cdna to genome' to work correctly)
+ assertEquals(1, align.getCodonFrames().size());
+ AlignedCodonFrame mapping = align.getCodonFrames().get(0);
+
+ /*
+ * 'dnaseqs' (map from) is here [gi|68711]
+ * 'aaseqs' (map to) is here [gi|N37351]
+ */
+ // TODO use more suitable naming in AlignedCodonFrame
+ assertEquals(1, mapping.getAaSeqs().length);
+ assertSame(seq.getDatasetSequence(), mapping.getdnaSeqs()[0]);
+ assertEquals(1, mapping.getdnaSeqs().length);
+ assertSame(newseqs.get(0), mapping.getAaSeqs()[0]);
+ assertEquals(1, mapping.getdnaToProt().length);
+ assertEquals(2, mapping.getdnaToProt()[0].getFromRanges().size());
+ // the two spliced dna ranges are combined in one MapList
+ assertArrayEquals(new int[] { 12923, 13060 },
+ mapping.getdnaToProt()[0]
+ .getFromRanges().get(0));
+ assertArrayEquals(new int[] { 13411, 13550 }, mapping.getdnaToProt()[0]
+ .getFromRanges().get(1));
+ assertEquals(1, mapping.getdnaToProt()[0].getToRanges().size());
+ // the two cdna ranges are merged into one contiguous region
+ assertArrayEquals(new int[] { 1, 278 }, mapping.getdnaToProt()[0]
+ .getToRanges().get(0));
+ }
+
+}
--- /dev/null
+package jalview.io.gff;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertTrue;
+
+import java.util.Arrays;
+import java.util.List;
+import java.util.Map;
+
+import org.testng.annotations.Test;
+
+public class GffHelperBaseTest
+{
+
+ /**
+ * Test the method that parses lines like <br>
+ * ID=2345;Name=Something,Another thing;Notes=Hello;Notes=World
+ */
+ @Test(groups = { "Functional" })
+ public void testParseNameValuePairs()
+ {
+ assertTrue(GffHelperBase.parseNameValuePairs(null, ";", ' ', ",")
+ .isEmpty());
+ assertTrue(GffHelperBase.parseNameValuePairs("", ";", ' ', ",")
+ .isEmpty());
+ assertTrue(GffHelperBase.parseNameValuePairs("hello=world", ";", ' ',
+ ",").isEmpty());
+
+ Map<String, List<String>> map = GffHelperBase.parseNameValuePairs(
+ "hello world", ";", ' ', ", ");
+ assertEquals(1, map.size());
+ assertEquals(1, map.get("hello").size());
+ assertEquals("world", map.get("hello").get(0));
+
+ map = GffHelperBase
+ .parseNameValuePairs(
+ "Method= manual curation ;nothing; Notes=F2 S ; Notes=Metal,Shiny; Type=",
+ ";", '=', ",");
+
+ // Type is ignored as no value was supplied
+ assertEquals(2, map.size());
+
+ assertEquals(1, map.get("Method").size());
+ assertEquals("manual curation", map.get("Method").get(0)); // trimmed
+
+ assertEquals(3, map.get("Notes").size());
+ assertEquals("F2 S", map.get("Notes").get(0));
+ assertEquals("Metal", map.get("Notes").get(1));
+ assertEquals("Shiny", map.get("Notes").get(2));
+ }
+
+ /**
+ * Test for the method that tries to trim mappings to equivalent lengths
+ */
+ @Test(groups = "Functional")
+ public void testTrimMapping()
+ {
+ int[] from = { 1, 12 };
+ int[] to = { 20, 31 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 1));
+ assertEquals("[1, 12]", Arrays.toString(from)); // unchanged
+ assertEquals("[20, 31]", Arrays.toString(to)); // unchanged
+
+ // from too long:
+ from = new int[] { 1, 13 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 1));
+ assertEquals("[1, 12]", Arrays.toString(from)); // trimmed
+ assertEquals("[20, 31]", Arrays.toString(to)); // unchanged
+
+ // to too long:
+ to = new int[] { 20, 33 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 1));
+ assertEquals("[1, 12]", Arrays.toString(from)); // unchanged
+ assertEquals("[20, 31]", Arrays.toString(to)); // trimmed
+
+ // from reversed:
+ from = new int[] { 12, 1 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 1));
+ assertEquals("[12, 1]", Arrays.toString(from)); // unchanged
+ assertEquals("[20, 31]", Arrays.toString(to)); // unchanged
+
+ // to reversed:
+ to = new int[] { 31, 20 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 1));
+ assertEquals("[12, 1]", Arrays.toString(from)); // unchanged
+ assertEquals("[31, 20]", Arrays.toString(to)); // unchanged
+
+ // from reversed and too long:
+ from = new int[] { 14, 1 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 1));
+ assertEquals("[14, 3]", Arrays.toString(from)); // end trimmed
+ assertEquals("[31, 20]", Arrays.toString(to)); // unchanged
+
+ // to reversed and too long:
+ to = new int[] { 31, 10 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 1));
+ assertEquals("[14, 3]", Arrays.toString(from)); // unchanged
+ assertEquals("[31, 20]", Arrays.toString(to)); // end trimmed
+
+ // cdna to peptide (matching)
+ from = new int[] { 1, 18 };
+ to = new int[] { 4, 9 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 3, 1));
+ assertEquals("[1, 18]", Arrays.toString(from)); // unchanged
+ assertEquals("[4, 9]", Arrays.toString(to)); // unchanged
+
+ // overlong cdna to peptide
+ from = new int[] { 1, 20 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 3, 1));
+ assertEquals("[1, 18]", Arrays.toString(from)); // end trimmed
+ assertEquals("[4, 9]", Arrays.toString(to)); // unchanged
+
+ // overlong cdna (reversed) to peptide
+ from = new int[] { 20, 1 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 3, 1));
+ assertEquals("[20, 3]", Arrays.toString(from)); // end trimmed
+ assertEquals("[4, 9]", Arrays.toString(to)); // unchanged
+
+ // overlong cdna (reversed) to peptide (reversed)
+ from = new int[] { 20, 1 };
+ to = new int[] { 9, 4 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 3, 1));
+ assertEquals("[20, 3]", Arrays.toString(from)); // end trimmed
+ assertEquals("[9, 4]", Arrays.toString(to)); // unchanged
+
+ // peptide to cdna (matching)
+ from = new int[] { 4, 9 };
+ to = new int[] { 1, 18 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 3));
+ assertEquals("[4, 9]", Arrays.toString(from)); // unchanged
+ assertEquals("[1, 18]", Arrays.toString(to)); // unchanged
+
+ // peptide to overlong cdna
+ to = new int[] { 1, 20 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 3));
+ assertEquals("[4, 9]", Arrays.toString(from)); // unchanged
+ assertEquals("[1, 18]", Arrays.toString(to)); // end trimmed
+
+ // peptide to overlong cdna (reversed)
+ to = new int[] { 20, 1 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 3));
+ assertEquals("[4, 9]", Arrays.toString(from)); // unchanged
+ assertEquals("[20, 3]", Arrays.toString(to)); // end trimmed
+
+ // peptide (reversed) to overlong cdna (reversed)
+ from = new int[] { 9, 4 };
+ to = new int[] { 20, 1 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 3));
+ assertEquals("[9, 4]", Arrays.toString(from)); // unchanged
+ assertEquals("[20, 3]", Arrays.toString(to)); // end trimmed
+
+ // overlong peptide to word-length cdna
+ from = new int[] { 4, 10 };
+ to = new int[] { 1, 18 };
+ assertTrue(GffHelperBase.trimMapping(from, to, 1, 3));
+ assertEquals("[4, 9]", Arrays.toString(from)); // end trimmed
+ assertEquals("[1, 18]", Arrays.toString(to)); // unchanged
+
+ // overlong peptide to non-word-length cdna
+ from = new int[] { 4, 10 };
+ to = new int[] { 1, 19 };
+ assertFalse(GffHelperBase.trimMapping(from, to, 1, 3));
+ assertEquals("[4, 10]", Arrays.toString(from)); // unchanged
+ assertEquals("[1, 19]", Arrays.toString(to)); // unchanged
+
+ }
+}
--- /dev/null
+package jalview.io.gff;
+
+import static org.testng.AssertJUnit.assertNull;
+import static org.testng.AssertJUnit.assertSame;
+import static org.testng.AssertJUnit.assertTrue;
+
+import org.testng.annotations.Test;
+
+public class GffHelperFactoryTest
+{
+
+ @Test(groups = "Functional")
+ public void testGetHelper()
+ {
+ assertNull(GffHelperFactory.getHelper(null));
+
+ String tabRegex = "\\t";
+
+ /*
+ * column 3 = 'similarity' indicates exonerate GFF alignment data
+ */
+ String gff = "submitted\taffine:local\tsimilarity\t20\t30\t99\t+\t.\t";
+ // no attributes (column 9 data):
+ assertTrue(GffHelperFactory.getHelper(gff.split(tabRegex)) instanceof Gff2Helper);
+
+ // attributes set but unhandled featureGroup - get generic handler
+ gff = "submitted\taffine:local\tsimilarity\t20\t30\t99\t+\t.\tID=$1";
+ assertSame(GffHelperFactory.getHelper(gff.split(tabRegex)).getClass(),
+ Gff3Helper.class);
+
+ // handled featureGroup (exonerate model) values
+ gff = "submitted\texonerate:protein2dna:local\tsimilarity\t20\t30\t99\t+\t.\tID=$1";
+ assertTrue(GffHelperFactory.getHelper(gff.split(tabRegex)) instanceof ExonerateHelper);
+
+ gff = "submitted\tprotein2genome\tsimilarity\t20\t30\t99\t+\t.\tID=$1";
+ assertTrue(GffHelperFactory.getHelper(gff.split(tabRegex)) instanceof ExonerateHelper);
+
+ gff = "submitted\tcoding2coding\tsimilarity\t20\t30\t99\t+\t.\tID=$1";
+ assertTrue(GffHelperFactory.getHelper(gff.split(tabRegex)) instanceof ExonerateHelper);
+
+ gff = "submitted\tcoding2genome\tsimilarity\t20\t30\t99\t+\t.\tID=$1";
+ assertTrue(GffHelperFactory.getHelper(gff.split(tabRegex)) instanceof ExonerateHelper);
+
+ gff = "submitted\tcdna2genome\tsimilarity\t20\t30\t99\t+\t.\tID=$1";
+ assertTrue(GffHelperFactory.getHelper(gff.split(tabRegex)) instanceof ExonerateHelper);
+
+ gff = "submitted\tgenome2genome\tsimilarity\t20\t30\t99\t+\t.\tID=$1";
+ assertTrue(GffHelperFactory.getHelper(gff.split(tabRegex)) instanceof ExonerateHelper);
+
+ // not case-sensitive:
+ gff = "submitted\tgenome2genome\tSIMILARITY\t20\t30\t99\t+\t.\tID=$1";
+ assertTrue(GffHelperFactory.getHelper(gff.split(tabRegex)) instanceof ExonerateHelper);
+
+ /*
+ * InterProScan has 'protein_match' in column 3
+ */
+ gff = "Submitted\tPANTHER\tprotein_match\t1\t1174\t0.0\t+\t.\tName=PTHR32154";
+ assertTrue(GffHelperFactory.getHelper(gff.split(tabRegex)) instanceof InterProScanHelper);
+
+ /*
+ * nothing specific - return the generic GFF3 class if Name=Value is present in col9
+ */
+ gff = "nothing\tinteresting\there\t20\t30\t99\t+\t.\tID=1";
+ GffHelperI helper = GffHelperFactory.getHelper(gff.split(tabRegex));
+ assertSame(helper.getClass(), Gff3Helper.class);
+
+ // return the generic GFF2 class if "Name Value" is present in col9
+ gff = "nothing\tinteresting\there\t20\t30\t99\t+\t.\tID 1";
+ helper = GffHelperFactory.getHelper(gff.split(tabRegex));
+ assertSame(helper.getClass(), Gff2Helper.class);
+ }
+}
--- /dev/null
+package jalview.io.gff;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertSame;
+import static org.testng.AssertJUnit.assertTrue;
+import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
+
+import jalview.datamodel.AlignedCodonFrame;
+import jalview.datamodel.Alignment;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.Mapping;
+import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceI;
+import jalview.gui.AlignFrame;
+import jalview.io.FileLoader;
+import jalview.io.FormatAdapter;
+
+import java.util.List;
+
+import org.testng.annotations.Test;
+
+/**
+ * Tests of use cases that include parsing GFF (version 2 or 3) features that
+ * describe mappings between protein and cDNA. The format of the GFF varies
+ * depending on which tool generated it.
+ */
+public class GffTests
+{
+ /**
+ * Test the case where we load a protein ('query') sequence, then exonerateGff
+ * describing its mapping to cDNA, and then a DNA sequence including the
+ * mapped region
+ */
+ @Test(groups = "Functional")
+ public void testResolveExonerateGff()
+ {
+ String proteinSeq = ">prot1/10-16\nYCWRSGA";
+ AlignFrame af = new FileLoader(false).LoadFileWaitTillLoaded(
+ proteinSeq, FormatAdapter.PASTE);
+
+ /*
+ * exonerate GFF output mapping residues 11-15 (CWRSG)
+ * to bases 24-10 in sequence 'dna1' (reverse strand)
+ */
+ String exonerateGff = "##gff-version 2\n"
+ + "prot1\tprotein2genome\tsimilarity\t11\t15\t99\t-\t.\talignment_id 0 ; Target dna1 ; Align 11 24 5";
+ af.loadJalviewDataFile(exonerateGff, FormatAdapter.PASTE, null, null);
+
+ /*
+ * check we have a mapping from prot1 to SequenceDummy 'dna1'
+ */
+ AlignmentI dataset = af.getViewport().getAlignment().getDataset();
+ assertEquals(1, dataset.getSequences().size());
+ assertEquals("prot1", dataset.getSequenceAt(0).getName());
+ assertEquals("YCWRSGA", dataset.getSequenceAt(0).getSequenceAsString());
+ List<AlignedCodonFrame> mappings = dataset.getCodonFrames();
+ assertEquals(1, mappings.size());
+ AlignedCodonFrame mapping = mappings.iterator().next();
+ SequenceI mappedDna = mapping.getDnaForAaSeq(dataset.getSequenceAt(0));
+ assertTrue(mappedDna instanceof SequenceDummy);
+ assertEquals("dna1", mappedDna.getName());
+ Mapping[] mapList = mapping.getProtMappings();
+ assertEquals(1, mapList.length);
+ // 11 in protein should map to codon [24, 23, 22] in dna
+ int[] mappedRegion = mapList[0].getMap().locateInFrom(11, 11);
+ assertArrayEquals(new int[] { 24, 22 }, mappedRegion);
+ // 15 in protein should map to codon [12, 11, 10] in dna
+ mappedRegion = mapList[0].getMap().locateInFrom(15, 15);
+ assertArrayEquals(new int[] { 12, 10 }, mappedRegion);
+
+ SequenceI dna1 = new Sequence("dna1", "AAACCCGGGTTTAAACCCGGGTTT");
+ AlignmentI al = new Alignment(new SequenceI[] { dna1 });
+ al.setDataset(null);
+
+ /*
+ * Now 'realise' the virtual mapping to the real DNA sequence;
+ * interactively this could be by a drag or fetch of the sequence data
+ * on to the alignment
+ */
+ mapping.realiseWith(dna1);
+ // verify the mapping is now from the real, not the dummy sequence
+ assertSame(dna1.getDatasetSequence(),
+ mapping.getDnaForAaSeq(dataset.getSequenceAt(0)));
+ }
+}
--- /dev/null
+package jalview.io.gff;
+
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertSame;
+import static org.testng.AssertJUnit.assertTrue;
+import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
+
+import jalview.datamodel.AlignedCodonFrame;
+import jalview.datamodel.Alignment;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceI;
+
+import java.io.IOException;
+import java.util.ArrayList;
+import java.util.List;
+import java.util.Map;
+
+import org.testng.annotations.Test;
+
+public class InterProScanHelperTest
+{
+
+ /**
+ * Test processing one InterProScan GFF line
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Functional")
+ public void testProcessProteinMatch() throws IOException
+ {
+ InterProScanHelper testee = new InterProScanHelper();
+ List<SequenceI> newseqs = new ArrayList<SequenceI>();
+ String[] gff = "Submitted\tPfam\tprotein_match\t5\t30\t0\t+\t.\tName=PF12838;Target=Submitted 5 30;signature_desc=4Fe-4S dicluster domain;ID=match$17_5_30"
+ .split("\\t");
+ SequenceI seq = new Sequence("Prot1", "PQRASTGKEEDVMIWCHQN");
+ seq.createDatasetSequence();
+ AlignmentI align = new Alignment(new SequenceI[] {});
+ Map<String, List<String>> set = Gff3Helper.parseNameValuePairs(gff[8]);
+
+ /*
+ * this should create a mapping from Prot1/5-30 to virtual sequence
+ * match$17_5_30 (added to newseqs) positions 1-26
+ */
+ testee.processProteinMatch(set, seq, gff, align, newseqs, false);
+ assertEquals(1, newseqs.size());
+ assertTrue(newseqs.get(0) instanceof SequenceDummy);
+ assertEquals("match$17_5_30", newseqs.get(0).getName());
+ assertEquals(1, align.getCodonFrames().size());
+ AlignedCodonFrame mapping = align.getCodonFrames().iterator().next();
+
+ /*
+ * 'dnaseqs' (map from) is here [Prot1]
+ * 'aaseqs' (map to) is here [match$17_5_30]
+ */
+ // TODO use more suitable naming in AlignedCodonFrame
+ assertEquals(1, mapping.getAaSeqs().length);
+ assertSame(seq.getDatasetSequence(), mapping.getdnaSeqs()[0]);
+ assertEquals(1, mapping.getdnaSeqs().length);
+ assertSame(newseqs.get(0), mapping.getAaSeqs()[0]);
+ assertEquals(1, mapping.getdnaToProt().length);
+ assertEquals(1, mapping.getdnaToProt()[0].getFromRanges().size());
+ assertArrayEquals(new int[] { 5, 30 }, mapping.getdnaToProt()[0]
+ .getFromRanges().get(0));
+ assertEquals(1, mapping.getdnaToProt()[0].getToRanges().size());
+ assertArrayEquals(new int[] { 1, 26 }, mapping.getdnaToProt()[0]
+ .getToRanges().get(0));
+ }
+
+}
--- /dev/null
+package jalview.io.gff;
+
+import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertTrue;
+
+import org.testng.annotations.AfterClass;
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.Test;
+
+public class SequenceOntologyTest
+{
+ private SequenceOntologyI so;
+
+ @BeforeClass
+ public void setUp() {
+ long now = System.currentTimeMillis();
+ SequenceOntologyFactory.setInstance(new SequenceOntology());
+ long elapsed = System.currentTimeMillis() - now;
+ System.out.println("Load and cache of Sequence Ontology took "
+ + elapsed + "ms");
+ so = SequenceOntologyFactory.getInstance();
+ }
+
+ @AfterClass
+ public void tearDown()
+ {
+ SequenceOntologyFactory.setInstance(null);
+ }
+
+ @Test(groups = "Functional")
+ public void testIsA()
+ {
+ assertFalse(so.isA(null, null));
+ assertFalse(so.isA(null, "SO:0000087"));
+ assertFalse(so.isA("SO:0000087", null));
+ assertFalse(so.isA("complete", "garbage"));
+
+ assertTrue(so.isA("SO:0000087", "SO:0000704"));
+ assertFalse(so.isA("SO:0000704", "SO:0000087"));
+ assertTrue(so.isA("SO:0000736", "SO:0000735"));
+
+ // same thing:
+ assertTrue(so.isA("micronuclear_sequence", "micronuclear_sequence"));
+ // direct parent:
+ assertTrue(so.isA("micronuclear_sequence", "organelle_sequence"));
+ // grandparent:
+ assertTrue(so.isA("micronuclear_sequence", "sequence_location"));
+ // great-grandparent:
+ assertTrue(so.isA("micronuclear_sequence", "sequence_attribute"));
+
+ // same thing by name / description:
+ assertTrue(so.isA("micronuclear_sequence", "SO:0000084"));
+ assertTrue(so.isA("SO:0000084", "micronuclear_sequence"));
+ assertTrue(so.isA("SO:0000084", "SO:0000084"));
+
+ // SO name to description:
+ assertTrue(so.isA("SO:0000084", "organelle_sequence"));
+ assertTrue(so.isA("SO:0000084", "sequence_location"));
+ assertTrue(so.isA("SO:0000084", "sequence_attribute"));
+
+ // description to SO name:
+ assertTrue(so.isA("micronuclear_sequence", "SO:0000736"));
+ assertTrue(so.isA("micronuclear_sequence", "SO:0000735"));
+ assertTrue(so.isA("micronuclear_sequence", "SO:0000400"));
+ }
+
+ @Test(groups = "Functional")
+ public void testIsCDS()
+ {
+ assertTrue(so.isA("CDS", "CDS"));
+ assertTrue(so.isA("CDS_predicted", "CDS"));
+ assertTrue(so.isA("transposable_element_CDS", "CDS"));
+ assertTrue(so.isA("edited_CDS", "CDS"));
+ assertTrue(so.isA("CDS_independently_known", "CDS"));
+ assertTrue(so.isA("CDS_fragment", "CDS"));
+ assertFalse(so.isA("CDS_region", "CDS"));// part_of
+ assertFalse(so.isA("polypeptide", "CDS")); // derives_from
+ }
+}
import jalview.datamodel.SequenceI;
import jalview.io.FormatAdapter;
-import java.util.HashSet;
-import java.util.Set;
+import java.util.ArrayList;
+import java.util.List;
import org.testng.annotations.BeforeMethod;
import org.testng.annotations.Test;
AlignedCodonFrame acf2 = new AlignedCodonFrame();
ssm.registerMapping(acf1);
- assertEquals(1, ssm.seqmappings.size());
- assertTrue(ssm.seqmappings.contains(acf1));
+ assertEquals(1, ssm.getSequenceMappings().size());
+ assertTrue(ssm.getSequenceMappings().contains(acf1));
ssm.registerMapping(acf2);
- assertEquals(2, ssm.seqmappings.size());
- assertTrue(ssm.seqmappings.contains(acf1));
- assertTrue(ssm.seqmappings.contains(acf2));
+ assertEquals(2, ssm.getSequenceMappings().size());
+ assertTrue(ssm.getSequenceMappings().contains(acf1));
+ assertTrue(ssm.getSequenceMappings().contains(acf2));
/*
* Re-adding the first mapping does nothing
*/
ssm.registerMapping(acf1);
- assertEquals(2, ssm.seqmappings.size());
- assertTrue(ssm.seqmappings.contains(acf1));
- assertTrue(ssm.seqmappings.contains(acf2));
+ assertEquals(2, ssm.getSequenceMappings().size());
+ assertTrue(ssm.getSequenceMappings().contains(acf1));
+ assertTrue(ssm.getSequenceMappings().contains(acf2));
}
@Test(groups = { "Functional" })
AlignedCodonFrame acf2 = new AlignedCodonFrame();
AlignedCodonFrame acf3 = new AlignedCodonFrame();
- Set<AlignedCodonFrame> set1 = new HashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> set1 = new ArrayList<AlignedCodonFrame>();
set1.add(acf1);
set1.add(acf2);
- Set<AlignedCodonFrame> set2 = new HashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> set2 = new ArrayList<AlignedCodonFrame>();
set2.add(acf2);
set2.add(acf3);
ssm.registerMappings(set2);
ssm.registerMappings(set2);
- assertEquals(3, ssm.seqmappings.size());
- assertTrue(ssm.seqmappings.contains(acf1));
- assertTrue(ssm.seqmappings.contains(acf2));
- assertTrue(ssm.seqmappings.contains(acf3));
+ assertEquals(3, ssm.getSequenceMappings().size());
+ assertTrue(ssm.getSequenceMappings().contains(acf1));
+ assertTrue(ssm.getSequenceMappings().contains(acf2));
+ assertTrue(ssm.getSequenceMappings().contains(acf3));
}
/**
assertEquals("UNIPROT", DBRefUtils.getCanonicalName("UNIPROTKB/TREMBL"));
assertEquals("UNIPROTKB/SWISS-CHEESE",
DBRefUtils.getCanonicalName("UNIPROTKB/SWISS-CHEESE"));
+ assertEquals("ENSEMBL", DBRefUtils.getCanonicalName("Ensembl"));
}
@Test(groups = { "Functional" })
assertSame(ref1, matches[0]);
assertSame(ref2, matches[1]);
}
+
+ /**
+ * Test the method that searches for matching references based on accession id
+ * only
+ */
+ @Test(groups = { "Functional" })
+ public void testSearchRefs_accessionid()
+ {
+
+ DBRefEntry ref1 = new DBRefEntry("Uniprot", "1", "A1234"); // matches
+ DBRefEntry ref2 = new DBRefEntry("embl", "1", "A1234"); // matches
+ // constructor does not upper-case accession id
+ DBRefEntry ref3 = new DBRefEntry("EMBL", "1", "a1234"); // no match
+ DBRefEntry ref4 = new DBRefEntry("EMBLCDS", "1", "A1235"); // no match
+ // ref5 matches although it has a mapping - ignored
+ DBRefEntry ref5 = new DBRefEntry("EMBL", "1", "A1234");
+ ref5.setMap(new Mapping(new MapList(new int[] { 1, 1 }, new int[] { 1,
+ 1 }, 1, 1)));
+
+ DBRefEntry[] matches = DBRefUtils.searchRefs(new DBRefEntry[] { ref1,
+ ref2, ref3, ref4, ref5 }, "A1234");
+ assertEquals(3, matches.length);
+ assertSame(ref1, matches[0]);
+ assertSame(ref2, matches[1]);
+ assertSame(ref5, matches[2]);
+ }
}
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
import static org.testng.AssertJUnit.assertNull;
+import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
+import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
import java.util.ArrayList;
import java.util.Arrays;
assertEquals("{[2, 3], [5, 7], [9, 10], [12, 12], [14, 14], [16, 18]}",
prettyPrint(ml2.getFromRanges()));
assertEquals("{[1, 1], [3, 4], [6, 6]}", prettyPrint(ml2.getToRanges()));
+
+ /*
+ * reverse direction
+ */
+ codons = new int[] { 9, 6 };
+ protein = new int[] { 100, 91, 80, 79 };
+ ml = new MapList(codons, protein, 3, 1);
+ assertEquals(6, ml.getFromLowest());
+ assertEquals(9, ml.getFromHighest());
+ assertEquals(79, ml.getToLowest());
+ assertEquals(100, ml.getToHighest());
+ }
+
+ /**
+ * Test constructor can merge consecutive ranges
+ */
+ @Test(groups = { "Functional" })
+ public void testConstructor_mergeRanges()
+ {
+ int[] codons = { 2, 3, 3, 7, 9, 10, 12, 12, 14, 14, 16, 17 };
+ int[] protein = { 1, 1, 1, 3, 6, 6 };
+ MapList ml = new MapList(codons, protein, 3, 1);
+ assertEquals(3, ml.getFromRatio());
+ assertEquals(2, ml.getFromLowest());
+ assertEquals(17, ml.getFromHighest());
+ assertEquals(1, ml.getToLowest());
+ assertEquals(6, ml.getToHighest());
+ assertEquals("{[2, 7], [9, 10], [12, 12], [14, 14], [16, 17]}",
+ prettyPrint(ml.getFromRanges()));
+ assertEquals("{[1, 3], [6, 6]}", prettyPrint(ml.getToRanges()));
}
/**
MapList ml = new MapList(new int[] { 1, 5, 10, 15, 25, 20 }, new int[] {
51, 1 }, 1, 3);
String s = ml.toString();
- assertEquals("From (1:3) [ [1, 5] [10, 15] [25, 20] ] To [ [51, 1] ]",
+ assertEquals("[ [1, 5] [10, 15] [25, 20] ] To [ [51, 1] ]",
+ s);
+ }
+
+ @Test(groups = { "Functional" })
+ public void testAddMapList()
+ {
+ MapList ml = new MapList(new int[] { 11, 15, 20, 25, 35, 30 },
+ new int[] { 72, 22 }, 1, 3);
+ assertEquals(11, ml.getFromLowest());
+ assertEquals(35, ml.getFromHighest());
+ assertEquals(22, ml.getToLowest());
+ assertEquals(72, ml.getToHighest());
+
+ MapList ml2 = new MapList(new int[] { 2, 4, 37, 40 }, new int[] { 12,
+ 17, 78, 83, 88, 96 }, 1, 3);
+ ml.addMapList(ml2);
+ assertEquals(2, ml.getFromLowest());
+ assertEquals(40, ml.getFromHighest());
+ assertEquals(12, ml.getToLowest());
+ assertEquals(96, ml.getToHighest());
+
+ String s = ml.toString();
+ assertEquals(
+ "[ [11, 15] [20, 25] [35, 30] [2, 4] [37, 40] ] To [ [72, 22] [12, 17] [78, 83] [88, 96] ]",
s);
}
+
+ @Test(groups = { "Functional" })
+ public void testAddMapList_contiguous()
+ {
+ MapList ml = new MapList(new int[] { 11, 15 }, new int[] { 72, 58 }, 1,
+ 3);
+
+ MapList ml2 = new MapList(new int[] { 15, 16 }, new int[] { 58, 53 },
+ 1, 3);
+ ml.addMapList(ml2);
+ assertEquals("[ [11, 16] ] To [ [72, 53] ]", ml.toString());
+ }
+
+ @Test(groups = "Functional")
+ public void testAddRange()
+ {
+ int[] range = { 1, 5 };
+ List<int[]> ranges = new ArrayList<int[]>();
+
+ // add to empty list:
+ MapList.addRange(range, ranges);
+ assertEquals(1, ranges.size());
+ assertSame(range, ranges.get(0));
+
+ // extend contiguous (same position):
+ MapList.addRange(new int[] { 5, 10 }, ranges);
+ assertEquals(1, ranges.size());
+ assertEquals(1, ranges.get(0)[0]);
+ assertEquals(10, ranges.get(0)[1]);
+
+ // extend contiguous (next position):
+ MapList.addRange(new int[] { 11, 15 }, ranges);
+ assertEquals(1, ranges.size());
+ assertEquals(1, ranges.get(0)[0]);
+ assertEquals(15, ranges.get(0)[1]);
+
+ // change direction: range is not merged:
+ MapList.addRange(new int[] { 16, 10 }, ranges);
+ assertEquals(2, ranges.size());
+ assertEquals(16, ranges.get(1)[0]);
+ assertEquals(10, ranges.get(1)[1]);
+
+ // extend reverse contiguous (same position):
+ MapList.addRange(new int[] { 10, 8 }, ranges);
+ assertEquals(2, ranges.size());
+ assertEquals(16, ranges.get(1)[0]);
+ assertEquals(8, ranges.get(1)[1]);
+
+ // extend reverse contiguous (next position):
+ MapList.addRange(new int[] { 7, 6 }, ranges);
+ assertEquals(2, ranges.size());
+ assertEquals(16, ranges.get(1)[0]);
+ assertEquals(6, ranges.get(1)[1]);
+
+ // change direction: range is not merged:
+ MapList.addRange(new int[] { 6, 9 }, ranges);
+ assertEquals(3, ranges.size());
+ assertEquals(6, ranges.get(2)[0]);
+ assertEquals(9, ranges.get(2)[1]);
+
+ // not contiguous: not merged
+ MapList.addRange(new int[] { 11, 12 }, ranges);
+ assertEquals(4, ranges.size());
+ assertEquals(11, ranges.get(3)[0]);
+ assertEquals(12, ranges.get(3)[1]);
+ }
+
+ /**
+ * Check state after construction
+ */
+ @Test(groups = { "Functional" })
+ public void testConstructor_withLists()
+ {
+ /*
+ * reverse direction
+ */
+ int[][] codons = new int[][] { { 9, 6 } };
+ int[][] protein = new int[][] { { 100, 91 }, { 80, 79 } };
+ MapList ml = new MapList(Arrays.asList(codons), Arrays.asList(protein),
+ 3, 1);
+ assertEquals(6, ml.getFromLowest());
+ assertEquals(9, ml.getFromHighest());
+ assertEquals(79, ml.getToLowest());
+ assertEquals(100, ml.getToHighest());
+ }
+
+ /**
+ * Test that method that inspects for the (first) forward or reverse from
+ * range. Single position ranges are ignored.
+ */
+ @Test(groups = { "Functional" })
+ public void testIsFromForwardStrand()
+ {
+ MapList ml = new MapList(new int[] { 2, 2, 3, 9, 12, 11 },
+ new int[] { 20, 11 }, 1, 1);
+ assertTrue(ml.isFromForwardStrand());
+
+ ml = new MapList(new int[] { 2, 2, 11, 5, 13, 14 },
+ new int[] { 20, 11 }, 1, 1);
+ assertFalse(ml.isFromForwardStrand());
+
+ ml = new MapList(new int[] { 2, 2, 4, 4, 6, 6 }, new int[] { 3, 1 }, 1,
+ 1);
+ assertTrue(ml.isFromForwardStrand());
+ }
+
+ /**
+ * Test the method that merges a list of ranges where possible
+ */
+ @Test(groups = { "Functional" })
+ public void testCoalesceRanges()
+ {
+ assertNull(MapList.coalesceRanges(null));
+ List<int[]> ranges = new ArrayList<int[]>();
+ assertSame(ranges, MapList.coalesceRanges(ranges));
+ ranges.add(new int[] { 1, 3 });
+ assertSame(ranges, MapList.coalesceRanges(ranges));
+
+ // add non-contiguous range:
+ ranges.add(new int[] { 5, 6 });
+ assertSame(ranges, MapList.coalesceRanges(ranges));
+
+ // 'contiguous' range in opposite direction is not merged:
+ ranges.add(new int[] { 7, 6 });
+ assertSame(ranges, MapList.coalesceRanges(ranges));
+
+ // merging in forward direction:
+ ranges.clear();
+ ranges.add(new int[] { 1, 3 });
+ ranges.add(new int[] { 4, 5 });
+ ranges.add(new int[] { 5, 5 });
+ ranges.add(new int[] { 5, 7 });
+ List<int[]> merged = MapList.coalesceRanges(ranges);
+ assertEquals(1, merged.size());
+ assertArrayEquals(new int[] { 1, 7 }, merged.get(0));
+ // verify input list is unchanged
+ assertEquals(4, ranges.size());
+ assertArrayEquals(new int[] { 1, 3 }, ranges.get(0));
+ assertArrayEquals(new int[] { 4, 5 }, ranges.get(1));
+ assertArrayEquals(new int[] { 5, 5 }, ranges.get(2));
+ assertArrayEquals(new int[] { 5, 7 }, ranges.get(3));
+
+ // merging in reverse direction:
+ ranges.clear();
+ ranges.add(new int[] { 7, 5 });
+ ranges.add(new int[] { 5, 4 });
+ ranges.add(new int[] { 4, 4 });
+ ranges.add(new int[] { 3, 1 });
+ merged = MapList.coalesceRanges(ranges);
+ assertEquals(1, merged.size());
+ assertArrayEquals(new int[] { 7, 1 }, merged.get(0));
+
+ // merging with switches of direction:
+ ranges.clear();
+ ranges.add(new int[] { 1, 3 });
+ ranges.add(new int[] { 4, 5 });
+ ranges.add(new int[] { 5, 5 });
+ ranges.add(new int[] { 6, 6 });
+ ranges.add(new int[] { 12, 10 });
+ ranges.add(new int[] { 9, 8 });
+ ranges.add(new int[] { 8, 8 });
+ ranges.add(new int[] { 7, 7 });
+ merged = MapList.coalesceRanges(ranges);
+ assertEquals(2, merged.size());
+ assertArrayEquals(new int[] { 1, 6 }, merged.get(0));
+ assertArrayEquals(new int[] { 12, 7 }, merged.get(1));
+ }
+
+ /**
+ * Test the method that merges a list of ranges where possible
+ */
+ @Test(groups = { "Functional" })
+ public void testCoalesceRanges_withOverlap()
+ {
+ List<int[]> ranges = new ArrayList<int[]>();
+ ranges.add(new int[] { 1, 3 });
+ ranges.add(new int[] { 2, 5 });
+
+ /*
+ * [2, 5] should extend [1, 3]
+ */
+ List<int[]> merged = MapList.coalesceRanges(ranges);
+ assertEquals(1, merged.size());
+ assertArrayEquals(new int[] { 1, 5 }, merged.get(0));
+
+ /*
+ * a subsumed interval should be dropped
+ */
+ ranges.clear();
+ ranges.add(new int[] { 1, 6 });
+ ranges.add(new int[] { 2, 4 });
+ merged = MapList.coalesceRanges(ranges);
+ assertEquals(1, merged.size());
+ assertArrayEquals(new int[] { 1, 6 }, merged.get(0));
+
+ ranges.clear();
+ ranges.add(new int[] { 1, 5 });
+ ranges.add(new int[] { 1, 6 });
+ merged = MapList.coalesceRanges(ranges);
+ assertEquals(1, merged.size());
+ assertArrayEquals(new int[] { 1, 6 }, merged.get(0));
+
+ /*
+ * merge duplicate ranges
+ */
+ ranges.clear();
+ ranges.add(new int[] { 1, 3 });
+ ranges.add(new int[] { 1, 3 });
+ merged = MapList.coalesceRanges(ranges);
+ assertEquals(1, merged.size());
+ assertArrayEquals(new int[] { 1, 3 }, merged.get(0));
+
+ /*
+ * reverse direction
+ */
+ ranges.clear();
+ ranges.add(new int[] { 9, 5 });
+ ranges.add(new int[] { 9, 4 });
+ ranges.add(new int[] { 8, 3 });
+ ranges.add(new int[] { 3, 2 });
+ ranges.add(new int[] { 1, 0 });
+ merged = MapList.coalesceRanges(ranges);
+ assertEquals(1, merged.size());
+ assertArrayEquals(new int[] { 9, 0 }, merged.get(0));
+ }
}
package jalview.util;
import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
+import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
import jalview.api.AlignViewportI;
import jalview.commands.EditCommand;
import java.awt.Color;
import java.io.IOException;
+import java.util.ArrayList;
import java.util.Arrays;
-import java.util.Collections;
-import java.util.HashSet;
-import java.util.LinkedHashSet;
import java.util.List;
-import java.util.Set;
import org.testng.annotations.Test;
MapList map = new MapList(new int[] { 5, 10 }, new int[] { 12, 13 }, 3,
1);
acf.addMap(seq1.getDatasetSequence(), aseq1.getDatasetSequence(), map);
- Set<AlignedCodonFrame> acfList = Collections.singleton(acf);
+ List<AlignedCodonFrame> acfList = Arrays.asList(new AlignedCodonFrame[]
+ { acf });
/*
* Check protein residue 12 maps to codon 5-7, 13 to codon 8-10
MapList map = new MapList(new int[] { 6, 6, 8, 9, 11, 11, 13, 13, 15,
15 }, new int[] { 8, 9 }, 3, 1);
acf.addMap(seq1.getDatasetSequence(), aseq1.getDatasetSequence(), map);
- Set<AlignedCodonFrame> acfList = Collections.singleton(acf);
+ List<AlignedCodonFrame> acfList = Arrays.asList(new AlignedCodonFrame[]
+ { acf });
/*
* Check protein residue 8 maps to [6, 8, 9]
acf.addMap(cdna.getSequenceAt(seq).getDatasetSequence(), protein
.getSequenceAt(seq).getDatasetSequence(), map);
}
- Set<AlignedCodonFrame> acfList = Collections.singleton(acf);
+ List<AlignedCodonFrame> acfList = Arrays.asList(new AlignedCodonFrame[]
+ { acf });
AlignViewportI dnaView = new AlignViewport(cdna);
AlignViewportI proteinView = new AlignViewport(protein);
protected void setupMappedAlignments() throws IOException
{
/*
- * Set up dna and protein Seq1/2/3 with mappings (held on the protein
- * viewport). Lower case for introns.
+ * Map (upper-case = coding):
+ * Seq1/10-18 AC-GctGtC-T to Seq1/40 -K-P
+ * Seq2/20-27 Tc-GA-G-T-T to Seq2/20-27 L--Q
+ * Seq3/30-38 TtTT-AaCGg- to Seq3/60-61\nG--S
*/
AlignmentI cdna = loadAlignment(">Seq1/10-18\nAC-GctGtC-T\n"
+ ">Seq2/20-27\nTc-GA-G-T-Tc\n" + ">Seq3/30-38\nTtTT-AaCGg-\n",
61 }, 3, 1);
acf.addMap(cdna.getSequenceAt(2).getDatasetSequence(), protein
.getSequenceAt(2).getDatasetSequence(), map);
- Set<AlignedCodonFrame> acfList = Collections.singleton(acf);
+ List<AlignedCodonFrame> acfList = Arrays.asList(new AlignedCodonFrame[]
+ { acf });
dnaView = new AlignViewport(cdna);
proteinView = new AlignViewport(protein);
"[1, 2, 3, 4, 7, 8, 9, 12]",
Arrays.toString(MappingUtils.flattenRanges(new int[] { 1, 4, 7,
9, 12, 12 })));
- // unpaired start position is ignored:
+ // trailing unpaired start position is ignored:
assertEquals(
"[1, 2, 3, 4, 7, 8, 9, 12]",
Arrays.toString(MappingUtils.flattenRanges(new int[] { 1, 4, 7,
acf.addMap(cdna.getSequenceAt(seq).getDatasetSequence(), protein
.getSequenceAt(seq).getDatasetSequence(), map);
}
- Set<AlignedCodonFrame> acfList = Collections.singleton(acf);
+ List<AlignedCodonFrame> acfList = Arrays.asList(new AlignedCodonFrame[]
+ { acf });
AlignViewportI dnaView = new AlignViewport(cdna);
AlignViewportI proteinView = new AlignViewport(protein);
acf.addMap(cdna.getSequenceAt(seq).getDatasetSequence(), protein
.getSequenceAt(seq).getDatasetSequence(), map);
}
- Set<AlignedCodonFrame> acfList = Collections.singleton(acf);
+ List<AlignedCodonFrame> acfList = Arrays.asList(new AlignedCodonFrame[]
+ { acf });
AlignViewportI dnaView = new AlignViewport(cdna);
AlignViewportI proteinView = new AlignViewport(protein);
AlignedCodonFrame acf3 = new AlignedCodonFrame();
acf3.addMap(seq3.getDatasetSequence(), seq1.getDatasetSequence(), map);
- Set<AlignedCodonFrame> mappings = new HashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> mappings = new ArrayList<AlignedCodonFrame>();
mappings.add(acf1);
mappings.add(acf2);
mappings.add(acf3);
AlignedCodonFrame acf = new AlignedCodonFrame();
MapList map = new MapList(new int[] { 8, 16 }, new int[] { 5, 7 }, 3, 1);
acf.addMap(dna.getDatasetSequence(), protein.getDatasetSequence(), map);
- Set<AlignedCodonFrame> mappings = new LinkedHashSet<AlignedCodonFrame>();
+ List<AlignedCodonFrame> mappings = new ArrayList<AlignedCodonFrame>();
mappings.add(acf);
AlignmentI prot = new Alignment(new SequenceI[] { protein });
}
/**
+ * Tests for the method that converts a series of [start, end] ranges to
+ * single positions, where the mapping is to a reverse strand i.e. start is
+ * greater than end point mapped to
+ */
+ @Test(groups = { "Functional" })
+ public void testFlattenRanges_reverseStrand()
+ {
+ assertEquals("[4, 3, 2, 1]",
+ Arrays.toString(MappingUtils.flattenRanges(new int[] { 4, 1 })));
+ assertEquals(
+ "[4, 3, 2, 1]",
+ Arrays.toString(MappingUtils.flattenRanges(new int[] { 4, 3, 2,
+ 1 })));
+ assertEquals(
+ "[4, 3, 2, 1]",
+ Arrays.toString(MappingUtils.flattenRanges(new int[] { 4, 4, 3,
+ 3, 2, 2, 1, 1 })));
+ assertEquals(
+ "[12, 9, 8, 7, 4, 3, 2, 1]",
+ Arrays.toString(MappingUtils.flattenRanges(new int[] { 12, 12,
+ 9, 7, 4, 1 })));
+ // forwards and backwards anyone?
+ assertEquals(
+ "[4, 5, 6, 3, 2, 1]",
+ Arrays.toString(MappingUtils.flattenRanges(new int[] { 4, 6, 3,
+ 1 })));
+ // backwards and forwards
+ assertEquals(
+ "[3, 2, 1, 4, 5, 6]",
+ Arrays.toString(MappingUtils.flattenRanges(new int[] { 3, 1, 4,
+ 6 })));
+ // trailing unpaired start position is ignored:
+ assertEquals(
+ "[12, 9, 8, 7, 4, 3, 2]",
+ Arrays.toString(MappingUtils.flattenRanges(new int[] { 12, 12,
+ 9, 7, 4, 2, 1 })));
+ }
+
+ /**
* Test mapping a column selection including hidden columns
*
* @throws IOException
{
setupMappedAlignments();
- ColumnSelection colsel = new ColumnSelection();
+ ColumnSelection proteinSelection = new ColumnSelection();
/*
* Column 0 in protein picks up Seq2/L, Seq3/G which map to cols 0-4 and 0-3
* in dna respectively, overall 0-4
*/
- colsel.hideColumns(0);
- ColumnSelection cs = MappingUtils.mapColumnSelection(colsel,
+ proteinSelection.hideColumns(0);
+ ColumnSelection dnaSelection = MappingUtils.mapColumnSelection(proteinSelection,
proteinView, dnaView);
- assertEquals("[]", cs.getSelected().toString());
- List<int[]> hidden = cs.getHiddenColumns();
+ assertEquals("[]", dnaSelection.getSelected().toString());
+ List<int[]> hidden = dnaSelection.getHiddenColumns();
assertEquals(1, hidden.size());
assertEquals("[0, 4]", Arrays.toString(hidden.get(0)));
/*
* Column 1 in protein picks up Seq1/K which maps to cols 0-3 in dna
*/
- colsel.revealAllHiddenColumns();
- colsel.hideColumns(1);
- cs = MappingUtils.mapColumnSelection(colsel, proteinView, dnaView);
- hidden = cs.getHiddenColumns();
+ proteinSelection.revealAllHiddenColumns();
+ // the unhidden columns are now marked selected!
+ assertEquals("[0]", proteinSelection.getSelected().toString());
+ // deselect these or hideColumns will be expanded to include 0
+ proteinSelection.clear();
+ proteinSelection.hideColumns(1);
+ dnaSelection = MappingUtils.mapColumnSelection(proteinSelection, proteinView, dnaView);
+ hidden = dnaSelection.getHiddenColumns();
assertEquals(1, hidden.size());
assertEquals("[0, 3]", Arrays.toString(hidden.get(0)));
/*
* Column 2 in protein picks up gaps only - no mapping
*/
- colsel.revealAllHiddenColumns();
- colsel.clear();
- colsel.hideColumns(2);
- cs = MappingUtils.mapColumnSelection(colsel, proteinView, dnaView);
- assertTrue(cs.getHiddenColumns().isEmpty());
+ proteinSelection.revealAllHiddenColumns();
+ proteinSelection.clear();
+ proteinSelection.hideColumns(2);
+ dnaSelection = MappingUtils.mapColumnSelection(proteinSelection, proteinView, dnaView);
+ assertTrue(dnaSelection.getHiddenColumns().isEmpty());
/*
* Column 3 in protein picks up Seq1/P, Seq2/Q, Seq3/S which map to columns
* 6-9, 6-10, 5-8 respectively, overall to 5-10
*/
- colsel.revealAllHiddenColumns();
- colsel.clear();
- colsel.hideColumns(3); // 5-10 hidden in dna
- colsel.addElement(1); // 0-3 selected in dna
- cs = MappingUtils.mapColumnSelection(colsel, proteinView, dnaView);
- assertEquals("[0, 1, 2, 3]", cs.getSelected().toString());
- hidden = cs.getHiddenColumns();
+ proteinSelection.revealAllHiddenColumns();
+ proteinSelection.clear();
+ proteinSelection.hideColumns(3); // 5-10 hidden in dna
+ proteinSelection.addElement(1); // 0-3 selected in dna
+ dnaSelection = MappingUtils.mapColumnSelection(proteinSelection, proteinView, dnaView);
+ assertEquals("[0, 1, 2, 3]", dnaSelection.getSelected().toString());
+ hidden = dnaSelection.getHiddenColumns();
assertEquals(1, hidden.size());
assertEquals("[5, 10]", Arrays.toString(hidden.get(0)));
/*
* Combine hiding columns 1 and 3 to get discontiguous hidden columns
*/
- colsel.revealAllHiddenColumns();
- colsel.clear();
- colsel.hideColumns(1);
- colsel.hideColumns(3);
- cs = MappingUtils.mapColumnSelection(colsel, proteinView, dnaView);
- hidden = cs.getHiddenColumns();
+ proteinSelection.revealAllHiddenColumns();
+ proteinSelection.clear();
+ proteinSelection.hideColumns(1);
+ proteinSelection.hideColumns(3);
+ dnaSelection = MappingUtils.mapColumnSelection(proteinSelection, proteinView, dnaView);
+ hidden = dnaSelection.getHiddenColumns();
assertEquals(2, hidden.size());
assertEquals("[0, 3]", Arrays.toString(hidden.get(0)));
assertEquals("[5, 10]", Arrays.toString(hidden.get(1)));
}
+
+ @Test(groups = { "Functional" })
+ public void testGetLength()
+ {
+ assertEquals(0, MappingUtils.getLength(null));
+ List<int[]> ranges = new ArrayList<int[]>();
+ assertEquals(0, MappingUtils.getLength(ranges));
+ ranges.add(new int[] { 1, 1 });
+ assertEquals(1, MappingUtils.getLength(ranges));
+ ranges.add(new int[] { 2, 10 });
+ assertEquals(10, MappingUtils.getLength(ranges));
+ ranges.add(new int[] { 20, 10 });
+ assertEquals(21, MappingUtils.getLength(ranges));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testContains()
+ {
+ assertFalse(MappingUtils.contains(null, 1));
+ List<int[]> ranges = new ArrayList<int[]>();
+ assertFalse(MappingUtils.contains(ranges, 1));
+
+ ranges.add(new int[] { 1, 4 });
+ ranges.add(new int[] { 6, 6 });
+ ranges.add(new int[] { 8, 10 });
+ ranges.add(new int[] { 30, 20 });
+ ranges.add(new int[] { -16, -44 });
+
+ assertFalse(MappingUtils.contains(ranges, 0));
+ assertTrue(MappingUtils.contains(ranges, 1));
+ assertTrue(MappingUtils.contains(ranges, 2));
+ assertTrue(MappingUtils.contains(ranges, 3));
+ assertTrue(MappingUtils.contains(ranges, 4));
+ assertFalse(MappingUtils.contains(ranges, 5));
+
+ assertTrue(MappingUtils.contains(ranges, 6));
+ assertFalse(MappingUtils.contains(ranges, 7));
+
+ assertTrue(MappingUtils.contains(ranges, 8));
+ assertTrue(MappingUtils.contains(ranges, 9));
+ assertTrue(MappingUtils.contains(ranges, 10));
+
+ assertFalse(MappingUtils.contains(ranges, 31));
+ assertTrue(MappingUtils.contains(ranges, 30));
+ assertTrue(MappingUtils.contains(ranges, 29));
+ assertTrue(MappingUtils.contains(ranges, 20));
+ assertFalse(MappingUtils.contains(ranges, 19));
+
+ assertFalse(MappingUtils.contains(ranges, -15));
+ assertTrue(MappingUtils.contains(ranges, -16));
+ assertTrue(MappingUtils.contains(ranges, -44));
+ assertFalse(MappingUtils.contains(ranges, -45));
+ }
+
}
import static org.testng.AssertJUnit.assertNull;
import static org.testng.AssertJUnit.assertTrue;
+import java.util.ArrayList;
import java.util.Arrays;
+import java.util.List;
import org.testng.annotations.Test;
assertEquals("a*b*c*cde", StringUtils.arrayToSeparatorList(new String[]
{ "a", "b*c", "cde" }, "*"));
}
+
+ @Test(groups = { "Functional" })
+ public void testListToDelimitedString()
+ {
+ assertEquals("", StringUtils.listToDelimitedString(null, ";"));
+ List<String> list = new ArrayList<String>();
+ assertEquals("", StringUtils.listToDelimitedString(list, ";"));
+ list.add("now");
+ assertEquals("now", StringUtils.listToDelimitedString(list, ";"));
+ list.add("is");
+ assertEquals("now;is", StringUtils.listToDelimitedString(list, ";"));
+ assertEquals("now ; is", StringUtils.listToDelimitedString(list, " ; "));
+ list.add("the");
+ list.add("winter");
+ list.add("of");
+ list.add("our");
+ list.add("discontent");
+ assertEquals("now is the winter of our discontent",
+ StringUtils.listToDelimitedString(list, " "));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testParseInt()
+ {
+ assertEquals(0, StringUtils.parseInt(null));
+ assertEquals(0, StringUtils.parseInt(""));
+ assertEquals(0, StringUtils.parseInt("x"));
+ assertEquals(0, StringUtils.parseInt("1.2"));
+ assertEquals(33, StringUtils.parseInt("33"));
+ assertEquals(33, StringUtils.parseInt("+33"));
+ assertEquals(-123, StringUtils.parseInt("-123"));
+ // too big for an int:
+ assertEquals(0,
+ StringUtils.parseInt(String.valueOf(Integer.MAX_VALUE) + "1"));
+ }
}
--- /dev/null
+package jalview.ws;
+
+import jalview.datamodel.Alignment;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.DBRefSource;
+import jalview.datamodel.SequenceI;
+import jalview.ws.seqfetcher.ASequenceFetcher;
+import jalview.ws.seqfetcher.DbSourceProxy;
+
+import java.util.ArrayList;
+import java.util.Enumeration;
+import java.util.List;
+import java.util.Vector;
+
+public class SequenceFetcherTest
+{
+
+ /**
+ * simple run method to test dbsources.
+ *
+ * @param argv
+ */
+ public static void main(String[] argv)
+ {
+ // TODO: extracted from SequenceFetcher - convert to proper unit test with
+ // assertions
+
+ AlignmentI ds = null;
+ Vector noProds = new Vector();
+ String usage = "SequenceFetcher.main [-nodas] [<DBNAME> [<ACCNO>]]\n"
+ + "With no arguments, all DbSources will be queried with their test Accession number.\n"
+ + "With one argument, the argument will be resolved to one or more db sources and each will be queried with their test accession only.\n"
+ + "If given two arguments, SequenceFetcher will try to find the DbFetcher corresponding to <DBNAME> and retrieve <ACCNO> from it.\n"
+ + "The -nodas option will exclude DAS sources from the database fetchers Jalview will try to use.";
+ boolean withDas = true;
+ if (argv != null && argv.length > 0
+ && argv[0].toLowerCase().startsWith("-nodas"))
+ {
+ withDas = false;
+ String targs[] = new String[argv.length - 1];
+ System.arraycopy(argv, 1, targs, 0, targs.length);
+ argv = targs;
+ }
+ if (argv != null && argv.length > 0)
+ {
+ List<DbSourceProxy> sps = new SequenceFetcher(withDas)
+ .getSourceProxy(argv[0]);
+
+ if (sps != null)
+ {
+ for (DbSourceProxy sp : sps)
+ {
+ AlignmentI al = null;
+ try
+ {
+ al = sp.getSequenceRecords(argv.length > 1 ? argv[1] : sp
+ .getTestQuery());
+ } catch (Exception e)
+ {
+ e.printStackTrace();
+ System.err.println("Error when retrieving "
+ + (argv.length > 1 ? argv[1] : sp.getTestQuery())
+ + " from " + argv[0] + "\nUsage: " + usage);
+ }
+ SequenceI[] prod = al.getSequencesArray();
+ if (al != null)
+ {
+ for (int p = 0; p < prod.length; p++)
+ {
+ System.out.println("Prod " + p + ": "
+ + prod[p].getDisplayId(true) + " : "
+ + prod[p].getDescription());
+ }
+ }
+ }
+ return;
+ }
+ else
+ {
+ System.err.println("Can't resolve " + argv[0]
+ + " as a database name. Allowed values are :\n"
+ + new SequenceFetcher().getSupportedDb());
+ }
+ System.out.println(usage);
+ return;
+ }
+ ASequenceFetcher sfetcher = new SequenceFetcher(withDas);
+ String[] dbSources = sfetcher.getSupportedDb();
+ for (int dbsource = 0; dbsource < dbSources.length; dbsource++)
+ {
+ String db = dbSources[dbsource];
+ // skip me
+ if (db.equals(DBRefSource.PDB))
+ {
+ continue;
+ }
+ for (DbSourceProxy sp : sfetcher.getSourceProxy(db))
+ {
+ System.out.println("Source: " + sp.getDbName() + " (" + db
+ + "): retrieving test:" + sp.getTestQuery());
+ AlignmentI al = null;
+ try
+ {
+ al = sp.getSequenceRecords(sp.getTestQuery());
+ if (al != null && al.getHeight() > 0)
+ {
+ boolean dna = sp.isDnaCoding();
+ // try and find products
+ String types[] = jalview.analysis.CrossRef
+ .findSequenceXrefTypes(dna, al.getSequencesArray());
+ if (types != null)
+ {
+ System.out.println("Xref Types for: "
+ + (dna ? "dna" : "prot"));
+ for (int t = 0; t < types.length; t++)
+ {
+ System.out.println("Type: " + types[t]);
+ SequenceI[] prod = jalview.analysis.CrossRef
+ .findXrefSequences(al.getSequencesArray(), dna,
+ types[t], null, new ArrayList<SequenceI>())
+ .getSequencesArray();
+ System.out.println("Found "
+ + ((prod == null) ? "no" : "" + prod.length)
+ + " products");
+ if (prod != null)
+ {
+ for (int p = 0; p < prod.length; p++)
+ {
+ System.out.println("Prod " + p + ": "
+ + prod[p].getDisplayId(true));
+ }
+ }
+ }
+ }
+ else
+ {
+ noProds.addElement((dna ? new Object[] { al, al }
+ : new Object[] { al }));
+ }
+
+ }
+ } catch (Exception ex)
+ {
+ System.out.println("ERROR:Failed to retrieve test query.");
+ ex.printStackTrace(System.out);
+ }
+
+ if (al == null)
+ {
+ System.out.println("ERROR:No alignment retrieved.");
+ StringBuffer raw = sp.getRawRecords();
+ if (raw != null)
+ {
+ System.out.println(raw.toString());
+ }
+ else
+ {
+ System.out.println("ERROR:No Raw results.");
+ }
+ }
+ else
+ {
+ System.out.println("Retrieved " + al.getHeight() + " sequences.");
+ for (int s = 0; s < al.getHeight(); s++)
+ {
+ SequenceI sq = al.getSequenceAt(s);
+ while (sq.getDatasetSequence() != null)
+ {
+ sq = sq.getDatasetSequence();
+
+ }
+ if (ds == null)
+ {
+ ds = new Alignment(new SequenceI[] { sq });
+
+ }
+ else
+ {
+ ds.addSequence(sq);
+ }
+ }
+ }
+ System.out.flush();
+ System.err.flush();
+
+ }
+ if (noProds.size() > 0)
+ {
+ Enumeration ts = noProds.elements();
+ while (ts.hasMoreElements())
+
+ {
+ Object[] typeSq = (Object[]) ts.nextElement();
+ boolean dna = (typeSq.length > 1);
+ AlignmentI al = (AlignmentI) typeSq[0];
+ System.out.println("Trying getProducts for "
+ + al.getSequenceAt(0).getDisplayId(true));
+ System.out.println("Search DS Xref for: "
+ + (dna ? "dna" : "prot"));
+ // have a bash at finding the products amongst all the retrieved
+ // sequences.
+ SequenceI[] seqs = al.getSequencesArray();
+ Alignment prodal = jalview.analysis.CrossRef.findXrefSequences(
+ seqs, dna, null, ds, new ArrayList<SequenceI>());
+ System.out.println("Found "
+ + ((prodal == null) ? "no" : "" + prodal.getHeight())
+ + " products");
+ if (prodal != null)
+ {
+ SequenceI[] prod = prodal.getSequencesArray(); // note
+ // should
+ // test
+ // rather
+ // than
+ // throw
+ // away
+ // codon
+ // mapping
+ // (if
+ // present)
+ for (int p = 0; p < prod.length; p++)
+ {
+ System.out.println("Prod " + p + ": "
+ + prod[p].getDisplayId(true));
+ }
+ }
+ }
+
+ }
+
+ }
+ }
+
+}
assertEquals("signal peptide", sf.getType());
assertNull(sf.getDescription());
assertNull(sf.getStatus());
- assertEquals(1, sf.getPosition()); // wrong - Castor bug??
+ assertEquals(1, sf.getPosition());
assertEquals(1, sf.getBegin());
assertEquals(18, sf.getEnd());
sf = features.get(1);
assertEquals("propeptide", sf.getType());
assertEquals("Activation peptide", sf.getDescription());
- assertEquals(19, sf.getPosition()); // wrong - Castor bug??
+ assertEquals(19, sf.getPosition());
assertEquals(19, sf.getBegin());
assertEquals(20, sf.getEnd());
sf = features.get(2);
assertEquals("chain", sf.getType());
assertEquals("Granzyme B", sf.getDescription());
- assertEquals(21, sf.getPosition()); // wrong - Castor bug??
+ assertEquals(21, sf.getPosition());
assertEquals(21, sf.getBegin());
assertEquals(247, sf.getEnd());
}
/**
- * Test the method that formats the sequence name in Fasta style
+ * Test the method that formats the sequence id
*/
@Test(groups = { "Functional" })
- public void testConstructSequenceFastaHeader()
+ public void testGetUniprotEntryId()
{
- Uniprot u = new Uniprot();
- Reader reader = new StringReader(UNIPROT_XML);
- Vector<UniprotEntry> entries = u.getUniprotEntries(reader);
- UniprotEntry entry = entries.get(0);
+ UniprotEntry entry = new Uniprot().getUniprotEntries(
+ new StringReader(UNIPROT_XML)).get(0);
- // source + accession ids + names
+ /*
+ * name formatted as source | accession ids | names
+ */
String expectedName = "UniProt/Swiss-Prot|A9CKP4|A9CKP5|A9CKP4_AGRT5|A9CKP4_AGRT6";
- // protein names
- String expectedDescription = "Mitogen-activated protein kinase 13 Henry ";
-
assertEquals(expectedName, Uniprot.getUniprotEntryId(entry));
+ }
+
+ /**
+ * Test the method that formats the sequence description
+ */
+ @Test(groups = { "Functional" })
+ public void testGetUniprotEntryDescription()
+ {
+ UniprotEntry entry = new Uniprot().getUniprotEntries(
+ new StringReader(UNIPROT_XML)).get(0);
+
+ /*
+ * recommended names concatenated with space separator
+ */
+ String expectedDescription = "Mitogen-activated protein kinase 13 Henry";
assertEquals(expectedDescription,
Uniprot.getUniprotEntryDescription(entry));
}
*/
package jalview.ws.jabaws;
-import static org.junit.Assert.assertTrue;
-import static org.junit.Assert.fail;
-
import jalview.ws.jws2.Jws2Discoverer;
import java.util.Vector;
+import org.testng.Assert;
import org.testng.annotations.AfterClass;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
@Test(groups = { "Functional" }, enabled = false)
public void testAnnotExport()
{
- fail("Not yet implemented");
+ Assert.fail("Not yet implemented");
}
public static jalview.ws.jws2.Jws2Discoverer getJabawsDiscoverer()
} catch (Exception e)
{
e.printStackTrace();
- fail("Aborting. Problem discovering services. Tried " + svcurls);
+ Assert.fail("Aborting. Problem discovering services. Tried "
+ + svcurls);
}
- assertTrue("Failed to discover any services at ", disc.getServices()
- .size() > 0);
+ Assert.assertTrue(disc.getServices().size() > 0,
+ "Failed to discover any services at ");
return disc;
}
import jalview.datamodel.SequenceI;
import jalview.util.DBRefUtils;
import jalview.ws.SequenceFetcher;
+import jalview.ws.dbsources.Pdb;
+import jalview.ws.dbsources.Uniprot;
import java.util.ArrayList;
import java.util.List;
/**
* Tests that standard protein database sources include Uniprot (as the first)
- * and also PDB. (Additional sources are dependent on available of DAS
+ * and also PDB. (Additional sources are dependent on availability of DAS
* services.)
*/
@Test(groups = { "Functional" })
{
String[] defdb = DBRefSource.PROTEINDBS;
List<DbSourceProxy> srces = new ArrayList<DbSourceProxy>();
+ SequenceFetcher sfetcher = new SequenceFetcher();
+ boolean pdbFound = false;
+
for (String ddb : defdb)
{
- SequenceFetcher sfetcher = new SequenceFetcher();
List<DbSourceProxy> srcesfordb = sfetcher.getSourceProxy(ddb);
if (srcesfordb != null)
{
+ // TODO is this right? get duplicate entries
srces.addAll(srcesfordb);
}
}
int i = 0;
int uniprotPos = -1;
- int pdbPos = -1;
- // append the selected sequence sources to the default dbs
for (DbSourceProxy s : srces)
{
- if (s instanceof jalview.ws.dbsources.Uniprot)
+ if (s instanceof Uniprot && uniprotPos == -1)
{
uniprotPos = i;
}
- if (s instanceof jalview.ws.dbsources.Pdb)
+ if (s instanceof Pdb)
{
- pdbPos = i;
+ pdbFound = true;
}
i++;
}
+ srces.size() + " sources (source was at position "
+ uniprotPos + ")", uniprotPos == 0);
assertTrue("Failed to find PDB source amongst " + srces.size()
- + " sources", pdbPos >= 0);
+ + " sources", pdbFound);
}
/**
sfs[0].getType()));
assertEquals(embl.getDbSource(), sfs[0].getFeatureGroup());
DBRefEntry[] dr = DBRefUtils.selectRefs(seq.getDBRefs(),
- DBRefSource.PROTEINSEQ);
+ new String[] { DBRefSource.UNIPROT, DBRefSource.UNIPROTKB,
+ DBRefSource.EMBLCDSProduct, DBRefSource.ENSEMBL });
assertNotNull(dr);
assertEquals("Expected a single Uniprot cross reference", 1, dr.length);
assertEquals("Expected cross reference map to be one amino acid", dr[0]
assertEquals("Expected local reference map to be 3 nucleotides", dr[0]
.getMap().getWidth(), 3);
AlignmentI sprods = CrossRef.findXrefSequences(
- alsq.getSequencesArray(), true, dr[0].getSource(),
- alsq.getDataset());
+ alsq.getSequencesArray(), true, dr[0].getSource(), alsq,
+ new ArrayList<SequenceI>());
assertNotNull(
"Couldn't recover cross reference sequence from dataset. Was it ever added ?",
sprods);
</property>
</object>
</method>
+ <method name="addElement">
+ <object class="com.zerog.ia.installer.actions.InstallZipfile" objectID="1000ddddfab93">
+ <property name="belongsToUninstallPhase">
+ <boolean>false</boolean>
+ </property>
+ <property name="rollbackEnabledCancel">
+ <boolean>true</boolean>
+ </property>
+ <property name="rollbackEnabledError">
+ <boolean>true</boolean>
+ </property>
+ <property name="ruleExpression">
+ <string><![CDATA[]]></string>
+ </property>
+ <property name="unixPermissions">
+ <string><![CDATA[664]]></string>
+ </property>
+ <property name="sourceName">
+ <string><![CDATA[htsjdk-1.133.jar]]></string>
+ </property>
+ <property name="overrideUnixPermissions">
+ <boolean>false</boolean>
+ </property>
+ <property name="sourcePath">
+ <string><![CDATA[/home/cruisecontrol/jalview/lib/]]></string>
+ </property>
+ <property name="shouldUninstall">
+ <boolean>true</boolean>
+ </property>
+ <property name="rollbackEnabledCancel">
+ <boolean>true</boolean>
+ </property>
+ <property name="rollbackEnabledError">
+ <boolean>true</boolean>
+ </property>
+ <property name="destinationName">
+ <string><![CDATA[htsjdk-1.133.jar]]></string>
+ </property>
+ <property name="fileSize">
+ <long>16046</long>
+ </property>
+ <property name="macBinary">
+ <boolean>false</boolean>
+ </property>
+ <property name="targetCheckKind">
+ <int>0</int>
+ </property>
+ <property name="ruleExpression">
+ <string><![CDATA[]]></string>
+ </property>
+ </object>
+ </method>
</object>
</property>
<property name="rulesFailedMessage">
<object refID="1f46cffffab93"/>
<object refID="1f46efeefab93"/>
<object refID="1936efeefab93"/>
+ <object refID="1000ddddfab93"/>
<object refID="10936efeefab93"/>
<object refID="11936efeefab93"/>
<object refID="12936efeefab93"/>
<object refID="1f46cffffab93"/>
<object refID="1f46efeefab93"/>
<object refID="1936efeefab93"/>
+ <object refID="1000ddddfab93"/>
<object refID="10936efeefab93"/>
<object refID="11936efeefab93"/>
<object refID="12936efeefab93"/>