JAL-1260 refactored GenBank (and EMBL) flat file parser
authorgmungoc <g.m.carstairs@dundee.ac.uk>
Tue, 18 Aug 2020 12:05:24 +0000 (13:05 +0100)
committergmungoc <g.m.carstairs@dundee.ac.uk>
Tue, 18 Aug 2020 12:05:24 +0000 (13:05 +0100)
src/jalview/io/EmblFlatFile.java
src/jalview/io/FlatFile.java [new file with mode: 0644]
src/jalview/io/GenBankFile.java [new file with mode: 0644]
src/jalview/util/DnaUtils.java
test/jalview/io/EmblFlatFileTest.java
test/jalview/io/GenBankFileTest.java [new file with mode: 0644]
test/jalview/io/J03321.embl.txt
test/jalview/io/J03321.gb [new file with mode: 0644]

index 900aef8..19496ef 100644 (file)
@@ -1,28 +1,10 @@
 package jalview.io;
 
 import java.io.IOException;
-import java.text.ParseException;
-import java.util.ArrayList;
-import java.util.Arrays;
-import java.util.HashMap;
-import java.util.Hashtable;
-import java.util.List;
-import java.util.Map;
-import java.util.Map.Entry;
-import java.util.TreeMap;
 
 import jalview.bin.Cache;
 import jalview.datamodel.DBRefEntry;
-import jalview.datamodel.DBRefSource;
-import jalview.datamodel.FeatureProperties;
-import jalview.datamodel.Mapping;
-import jalview.datamodel.Sequence;
-import jalview.datamodel.SequenceFeature;
-import jalview.datamodel.SequenceI;
 import jalview.util.DBRefUtils;
-import jalview.util.DnaUtils;
-import jalview.util.MapList;
-import jalview.util.MappingUtils;
 
 /**
  * A class that provides selective parsing of the EMBL flatfile format.
@@ -43,58 +25,10 @@ import jalview.util.MappingUtils;
  * @see ftp://ftp.ebi.ac.uk/pub/databases/ena/sequence/release/doc/usrman.txt
  * @see ftp://ftp.ebi.ac.uk/pub/databases/embl/doc/FT_current.html
  */
-public class EmblFlatFile extends AlignFile // FileParse
+public class EmblFlatFile extends FlatFile
 {
-  private static final String QUOTE = "\"";
-
-  private static final String DOUBLED_QUOTE = QUOTE + QUOTE;
-
   /**
-   * A data bean class to hold values parsed from one CDS Feature (FT)
-   */
-  class CdsData
-  {
-    String translation; // from CDS feature /translation
-
-    String cdsLocation; // CDS /location raw value
-
-    int codonStart = 1; // from CDS /codon_start
-
-    String proteinName; // from CDS /product; used for protein description
-
-    String proteinId; // from CDS /protein_id
-
-    List<DBRefEntry> xrefs = new ArrayList<>(); // from CDS /db_xref qualifiers
-
-    Map<String, String> cdsProps = new Hashtable<>(); // CDS other qualifiers
-  }
-
-  private static final String WHITESPACE = "\\s+";
-
-  private String sourceDb;
-
-  /*
-   * values parsed from the EMBL flatfile record
-   */
-  private String accession; // from ID (first token)
-
-  private String version; // from ID (second token)
-
-  private String description; // from (first) DE line
-
-  private int length = 128; // from ID (7th token), with usable default
-
-  private List<DBRefEntry> dbrefs; // from DR
-
-  private String sequenceString; // from SQ lines
-
-  /*
-   * parsed CDS data fields, keyed by protein_id
-   */
-  private Map<String, CdsData> cds;
-
-  /**
-   * Constructor
+   * Constructor given a data source and the id of the source database
    * 
    * @param fp
    * @param sourceId
@@ -102,14 +36,7 @@ public class EmblFlatFile extends AlignFile // FileParse
    */
   public EmblFlatFile(FileParse fp, String sourceId) throws IOException
   {
-    super(false, fp); // don't parse immediately
-    this.sourceDb = sourceId;
-    dbrefs = new ArrayList<>();
-
-    /*
-     * using TreeMap gives CDS sequences in alphabetical, so readable, order
-     */
-    cds = new TreeMap<>(String.CASE_INSENSITIVE_ORDER);
+    super(fp, sourceId);
   }
 
   /**
@@ -118,6 +45,7 @@ public class EmblFlatFile extends AlignFile // FileParse
    * 
    * @throws IOException
    */
+  @Override
   public void parse() throws IOException
   {
     String line = nextLine();
@@ -137,11 +65,11 @@ public class EmblFlatFile extends AlignFile // FileParse
       }
       else if (line.startsWith("SQ"))
       {
-        line = parseSQ();
+        line = parseSequence();
       }
       else if (line.startsWith("FT"))
       {
-        line = parseFT(line);
+        line = parseFeature(line.substring(2));
       }
       else
       {
@@ -273,623 +201,9 @@ public class EmblFlatFile extends AlignFile // FileParse
     return nextLine();
   }
 
-  /**
-   * Reads and saves the sequence, read from the lines following the SQ line.
-   * Whitespace and position counters are discarded. Returns the next line
-   * following the sequence data (the next line that doesn't start with
-   * whitespace).
-   * 
-   * @throws IOException
-   */
-  String parseSQ() throws IOException
-  {
-    StringBuilder sb = new StringBuilder(this.length);
-    String line = nextLine();
-    while (line != null && line.startsWith(" "))
-    {
-      line = line.trim();
-      String[] blocks = line.split(WHITESPACE);
-
-      /*
-       * omit the last block (position counter) on each line
-       */
-      for (int i = 0; i < blocks.length - 1; i++)
-      {
-        sb.append(blocks[i]);
-      }
-      line = nextLine();
-    }
-    this.sequenceString = sb.toString();
-
-    return line;
-  }
-
-  /**
-   * Processes an FT line. If it declares a feature type of interest (currently,
-   * only CDS is processed), processes all of the associated lines (feature
-   * qualifiers), and returns the next line after that, otherwise simply returns
-   * the next line.
-   * 
-   * @param line
-   * @return
-   * @throws IOException
-   */
-  String parseFT(String line) throws IOException
-  {
-    String[] tokens = line.split(WHITESPACE);
-    if (tokens.length < 3 || !"CDS".equals(tokens[1]))
-    {
-      return nextLine();
-    }
-
-    CdsData data = new CdsData();
-    data.cdsLocation = tokens[2];
-    // TODO location can be over >1 line e.g. EAW51554
-
-    line = nextLine();
-    while (line != null)
-    {
-      if (!line.startsWith("FT    ")) // 4 spaces
-      {
-        // e.g. start of next feature "FT source..."
-        break;
-      }
-
-      /*
-       * extract qualifier, e.g. FT    /protein_id="CAA37824.1"
-       * - the value may extend over more than one line
-       * - if the value has enclosing quotes, these are removed
-       * - escaped double quotes ("") are reduced to a single character
-       */
-      int slashPos = line.indexOf('/');
-      if (slashPos == -1)
-      {
-        Cache.log.error("Unexpected EMBL line ignored: " + line);
-        line = nextLine();
-        continue;
-      }
-      int eqPos = line.indexOf('=', slashPos + 1);
-      if (eqPos == -1)
-      {
-        // can happen, e.g. /ribosomal_slippage
-        // Cache.log.error("Unexpected EMBL line ignored: " + line);
-        line = nextLine();
-        continue;
-      }
-      String qualifier = line.substring(slashPos + 1, eqPos);
-      String value = line.substring(eqPos + 1);
-      value = removeQuotes(value);
-      StringBuilder sb = new StringBuilder().append(value);
-      line = parseFeatureQualifier(sb, qualifier);
-      String featureValue = sb.toString();
-
-      if ("protein_id".equals(qualifier))
-      {
-        data.proteinId = featureValue;
-      }
-      else if ("codon_start".equals(qualifier))
-      {
-        try
-        {
-          data.codonStart = Integer.parseInt(featureValue.trim());
-        } catch (NumberFormatException e)
-        {
-          Cache.log.error("Invalid codon_start in XML for " + this.accession
-                  + ": " + e.getMessage());
-        }
-      }
-      else if ("db_xref".equals(qualifier))
-      {
-        String[] parts = featureValue.split(":");
-        if (parts.length == 2)
-        {
-          String db = parts[0].trim();
-          db = DBRefUtils.getCanonicalName(db);
-          DBRefEntry dbref = new DBRefEntry(db, "0", parts[1].trim());
-          data.xrefs.add(dbref);
-        }
-      }
-      else if ("product".equals(qualifier))
-      {
-        data.proteinName = featureValue;
-      }
-      else if ("translation".equals(qualifier))
-      {
-        data.translation = featureValue;
-      }
-      else if (!"".equals(featureValue))
-      {
-        // throw anything else into the additional properties hash
-        data.cdsProps.put(qualifier, featureValue);
-      }
-    }
-
-    if (data.proteinId != null)
-    {
-      this.cds.put(data.proteinId, data);
-    }
-    else
-    {
-      Cache.log.error("Ignoring CDS feature with no protein_id for "
-              + sourceDb + ":" + accession);
-    }
-
-    return line;
-  }
-
-  /**
-   * Removes leading or trailing double quotes (") unless doubled, and changes
-   * any 'escaped' (doubled) double quotes to single characters. As per the
-   * Feature Table specification for Qualifiers, Free Text.
-   * 
-   * @param value
-   * @return
-   */
-  static String removeQuotes(String value)
-  {
-    if (value == null) 
-    {
-      return null;
-    }
-    if (value.startsWith(QUOTE) && !value.startsWith(DOUBLED_QUOTE))
-    {
-      value = value.substring(1);
-    }
-    if (value.endsWith(QUOTE) && !value.endsWith(DOUBLED_QUOTE))
-    {
-      value = value.substring(0, value.length() - 1);
-    }
-    value = value.replace(DOUBLED_QUOTE, QUOTE);
-    return value;
-  }
-
-  /**
-   * Reads the value of a feature (FT) qualifier from one or more lines of the
-   * file, and returns the next line after that. Values are appended to the
-   * string buffer, which should be already primed with the value read from the
-   * first line for the qualifier (with any leading double quote removed).
-   * Enclosing double quotes are removed, and escaped (repeated) double quotes
-   * reduced to one only. For example for
-   * 
-   * <pre>
-   * FT      /note="gene_id=hCG28070.3 
-   * FT      ""foobar"" isoform=CRA_b"
-   * the returned value is
-   * gene_id=hCG28070.3 "foobar" isoform=CRA_b
-   * </pre>
-   * 
-   * Note the side-effect of this method, to advance data reading to the next
-   * line after the feature qualifier.
-   * 
-   * @param sb
-   *          a string buffer primed with the first line of the value
-   * @param qualifierName
-   * @return
-   * @throws IOException
-   */
-  String parseFeatureQualifier(StringBuilder sb, String qualifierName)
-          throws IOException
-  {
-    String line;
-    while ((line = nextLine()) != null)
-    {
-      if (!line.startsWith("FT    "))
-      {
-        break; // reached next feature or other input line
-      }
-      String[] tokens = line.split(WHITESPACE);
-      if (tokens.length < 2)
-      {
-        Cache.log.error("Ignoring bad EMBL line for " + this.accession
-                + ": " + line);
-        break;
-      }
-      if (tokens[1].startsWith("/"))
-      {
-        break; // next feature qualifier
-      }
-
-      /*
-       * heuristic rule: most multi-line value (e.g. /product) are text,
-       * so add a space for word boundary at a new line; not for translation
-       */
-      if (!"translation".equals(qualifierName))
-      {
-        sb.append(" ");
-      }
-
-      /*
-       * remove trailing " and unescape doubled ""
-       */
-      String data = removeQuotes(tokens[1]);
-      sb.append(data);
-    }
-
-    return line;
-  }
-
-  /**
-   * Constructs and saves the sequence from parsed components
-   */
-  void buildSequence()
-  {
-    if (this.accession == null || this.sequenceString == null)
-    {
-      Cache.log.error("Failed to parse data from EMBL");
-      return;
-    }
-
-    String name = this.accession;
-    if (this.sourceDb != null)
-    {
-      name = this.sourceDb + "|" + name;
-    }
-    SequenceI seq = new Sequence(name, this.sequenceString);
-    seq.setDescription(this.description);
-
-    /*
-     * add a DBRef to itself
-     */
-    DBRefEntry selfRef = new DBRefEntry(sourceDb, version, accession);
-    int[] startEnd = new int[] { 1, seq.getLength() };
-    selfRef.setMap(new Mapping(null, startEnd, startEnd, 1, 1));
-    seq.addDBRef(selfRef);
-
-    for (DBRefEntry dbref : this.dbrefs)
-    {
-      seq.addDBRef(dbref);
-    }
-
-    processCDSFeatures(seq);
-
-    seq.deriveSequence();
-
-    addSequence(seq);
-  }
-
-  /**
-   * Process the CDS features, including generation of cross-references and
-   * mappings to the protein products (translation)
-   * 
-   * @param seq
-   */
-  protected void processCDSFeatures(SequenceI seq)
-  {
-    /*
-     * record protein products found to avoid duplication i.e. >1 CDS with 
-     * the same /protein_id [though not sure I can find an example of this]
-     */
-    Map<String, SequenceI> proteins = new HashMap<>();
-    for (CdsData data : cds.values())
-    {
-      processCDSFeature(seq, data, proteins);
-    }
-  }
-
-  /**
-   * Processes data for one parsed CDS feature to
-   * <ul>
-   * <li>create a protein product sequence for the translation</li>
-   * <li>create a cross-reference to protein with mapping from dna</li>
-   * <li>add a CDS feature to the sequence for each CDS start-end range</li>
-   * <li>add any CDS dbrefs to the sequence and to the protein product</li>
-   * </ul>
-   * 
-   * @param SequenceI
-   *          dna
-   * @param proteins
-   *          map of protein products so far derived from CDS data
-   */
-  void processCDSFeature(SequenceI dna, CdsData data,
-          Map<String, SequenceI> proteins)
-  {
-    /*
-     * parse location into a list of [start, end, start, end] positions
-     */
-    int[] exons = getCdsRanges(this.accession, data.cdsLocation);
-
-    MapList maplist = buildMappingToProtein(dna, exons, data);
-
-    int exonNumber = 0;
-
-    for (int xint = 0; exons != null && xint < exons.length - 1; xint += 2)
-    {
-      int exonStart = exons[xint];
-      int exonEnd = exons[xint + 1];
-      int begin = Math.min(exonStart, exonEnd);
-      int end = Math.max(exonStart, exonEnd);
-      exonNumber++;
-      String desc = String.format("Exon %d for protein EMBLCDS:%s",
-              exonNumber, data.proteinId);
-
-      SequenceFeature sf = new SequenceFeature("CDS", desc, begin, end,
-              this.sourceDb);
-      for (Entry<String, String> val : data.cdsProps.entrySet())
-      {
-        sf.setValue(val.getKey(), val.getValue());
-      }
-
-      sf.setEnaLocation(data.cdsLocation);
-      boolean forwardStrand = exonStart <= exonEnd;
-      sf.setStrand(forwardStrand ? "+" : "-");
-      sf.setPhase(String.valueOf(data.codonStart - 1));
-      sf.setValue(FeatureProperties.EXONPOS, exonNumber);
-      sf.setValue(FeatureProperties.EXONPRODUCT, data.proteinName);
-
-      dna.addSequenceFeature(sf);
-    }
-
-    boolean hasUniprotDbref = false;
-    for (DBRefEntry xref : data.xrefs)
-    {
-      dna.addDBRef(xref);
-      if (xref.getSource().equals(DBRefSource.UNIPROT))
-      {
-        /*
-         * construct (or find) the sequence for (data.protein_id, data.translation)
-         */
-        SequenceI protein = buildProteinProduct(dna, xref, data, proteins);
-        Mapping map = new Mapping(protein, maplist);
-        map.setMappedFromId(data.proteinId);
-        xref.setMap(map);
-
-        /*
-         * add DBRefs with mappings from dna to protein and the inverse
-         */
-        DBRefEntry db1 = new DBRefEntry(sourceDb, version, accession);
-        db1.setMap(new Mapping(dna, maplist.getInverse()));
-        protein.addDBRef(db1);
-
-        hasUniprotDbref = true;
-      }
-    }
-
-    /*
-     * if we have a product (translation) but no explicit Uniprot dbref
-     * (example: EMBL M19487 protein_id AAB02592.1)
-     * then construct mappings to an assumed EMBLCDSPROTEIN accession
-     */
-    if (!hasUniprotDbref)
-    {
-      SequenceI protein = proteins.get(data.proteinId);
-      if (protein == null)
-      {
-        protein = new Sequence(data.proteinId, data.translation);
-        protein.setDescription(data.proteinName);
-        proteins.put(data.proteinId, protein);
-      }
-      // assuming CDSPROTEIN sequence version = dna version (?!)
-      DBRefEntry db1 = new DBRefEntry(DBRefSource.EMBLCDSProduct,
-              this.version, data.proteinId);
-      protein.addDBRef(db1);
-
-      DBRefEntry dnaToEmblProteinRef = new DBRefEntry(
-              DBRefSource.EMBLCDSProduct, this.version, data.proteinId);
-      Mapping map = new Mapping(protein, maplist);
-      map.setMappedFromId(data.proteinId);
-      dnaToEmblProteinRef.setMap(map);
-      dna.addDBRef(dnaToEmblProteinRef);
-    }
-
-    /*
-     * comment brought forward from EmblXmlSource, lines 447-451:
-     * TODO: if retrieved from EMBLCDS, add a DBRef back to the parent EMBL
-     * sequence with the exon  map; if given a dataset reference, search
-     * dataset for parent EMBL sequence if it exists and set its map;
-     * make a new feature annotating the coding contig
-     */
-  }
-
-  /**
-   * Computes a mapping from CDS positions in DNA sequence to protein product
-   * positions, with allowance for stop codon or incomplete start codon
-   * 
-   * @param dna
-   * @param exons
-   * @param data
-   * @return
-   */
-  MapList buildMappingToProtein(final SequenceI dna, final int[] exons,
-          final CdsData data)
-  {
-    MapList dnaToProteinMapping = null;
-    int peptideLength = data.translation.length();
-
-    int[] proteinRange = new int[] { 1, peptideLength };
-    if (exons != null && exons.length > 0)
-    {
-      /*
-       * We were able to parse 'location'; do a final 
-       * product length truncation check
-       */
-      int[] cdsRanges = adjustForProteinLength(peptideLength, exons);
-      dnaToProteinMapping = new MapList(cdsRanges, proteinRange, 3, 1);
-    }
-    else
-    {
-      /*
-       * workaround until we handle all 'location' formats fully
-       * e.g. X53828.1:60..1058 or <123..>289
-       */
-      Cache.log.error(String.format(
-              "Implementation Notice: EMBLCDS location '%s'not properly supported yet"
-                      + " - Making up the CDNA region of (%s:%s)... may be incorrect",
-              data.cdsLocation, sourceDb, this.accession));
-
-      int completeCodonsLength = 1 - data.codonStart + dna.getLength();
-      int mappedDnaEnd = dna.getEnd();
-      if (peptideLength * 3 == completeCodonsLength)
-      {
-        // this might occur for CDS sequences where no features are marked
-        Cache.log.warn("Assuming no stop codon at end of cDNA fragment");
-        mappedDnaEnd = dna.getEnd();
-      }
-      else if ((peptideLength + 1) * 3 == completeCodonsLength)
-      {
-        Cache.log.warn("Assuming stop codon at end of cDNA fragment");
-        mappedDnaEnd = dna.getEnd() - 3;
-      }
-
-      if (mappedDnaEnd != -1)
-      {
-        int[] cdsRanges = new int[] {
-            dna.getStart() + (data.codonStart - 1), mappedDnaEnd };
-        dnaToProteinMapping = new MapList(cdsRanges, proteinRange, 3, 1);
-      }
-    }
-
-    return dnaToProteinMapping;
-  }
-
-  /**
-   * Constructs a sequence for the protein product for the CDS data (if there is
-   * one), and dbrefs with mappings from CDS to protein and the reverse
-   * 
-   * @param dna
-   * @param xref
-   * @param data
-   * @param proteins
-   * @return
-   */
-  SequenceI buildProteinProduct(SequenceI dna, DBRefEntry xref,
-          CdsData data, Map<String, SequenceI> proteins)
-  {
-    /*
-     * check we have some data to work with
-     */
-    if (data.proteinId == null || data.translation == null)
-    {
-      return null;
-    }
-
-    /*
-     * Construct the protein sequence (if not already seen)
-     */
-    String proteinSeqName = xref.getSource() + "|" + xref.getAccessionId();
-    SequenceI protein = proteins.get(proteinSeqName);
-    if (protein == null)
-    {
-      protein = new Sequence(proteinSeqName, data.translation, 1,
-              data.translation.length());
-      protein.setDescription(data.proteinName != null ? data.proteinName
-              : "Protein Product from " + sourceDb);
-      proteins.put(proteinSeqName, protein);
-    }
-
-    return protein;
-  }
-
-  /**
-   * Returns the CDS location as a single array of [start, end, start, end...]
-   * positions. If on the reverse strand, these will be in descending order.
-   * 
-   * @param accession
-   * @param location
-   * @return
-   */
-  protected int[] getCdsRanges(String accession, String location)
-  {
-    if (location == null)
-    {
-      return new int[] {};
-    }
-
-    try
-    {
-      List<int[]> ranges = DnaUtils.parseLocation(location);
-      return MappingUtils.listToArray(ranges);
-    } catch (ParseException e)
-    {
-      Cache.log.warn(
-              String.format("Not parsing inexact CDS location %s in ENA %s",
-                      location, accession));
-      return new int[] {};
-    }
-  }
-
-  /**
-   * Output (print) is not implemented for EMBL flat file format
-   */
   @Override
-  public String print(SequenceI[] seqs, boolean jvsuffix)
-  {
-    return null;
-  }
-
-  /**
-   * Truncates (if necessary) the exon intervals to match 3 times the length of
-   * the protein; also accepts 3 bases longer (for stop codon not included in
-   * protein)
-   * 
-   * @param proteinLength
-   * @param exon
-   *          an array of [start, end, start, end...] intervals
-   * @return the same array (if unchanged) or a truncated copy
-   */
-  static int[] adjustForProteinLength(int proteinLength, int[] exon)
+  protected boolean isFeatureContinuationLine(String line)
   {
-    if (proteinLength <= 0 || exon == null)
-    {
-      return exon;
-    }
-    int expectedCdsLength = proteinLength * 3;
-    int exonLength = MappingUtils.getLength(Arrays.asList(exon));
-
-    /*
-     * if exon length matches protein, or is shorter, or longer by the 
-     * length of a stop codon (3 bases), then leave it unchanged
-     */
-    if (expectedCdsLength >= exonLength
-            || expectedCdsLength == exonLength - 3)
-    {
-      return exon;
-    }
-
-    int origxon[];
-    int sxpos = -1;
-    int endxon = 0;
-    origxon = new int[exon.length];
-    System.arraycopy(exon, 0, origxon, 0, exon.length);
-    int cdspos = 0;
-    for (int x = 0; x < exon.length; x += 2)
-    {
-      cdspos += Math.abs(exon[x + 1] - exon[x]) + 1;
-      if (expectedCdsLength <= cdspos)
-      {
-        // advanced beyond last codon.
-        sxpos = x;
-        if (expectedCdsLength != cdspos)
-        {
-          // System.err
-          // .println("Truncating final exon interval on region by "
-          // + (cdspos - cdslength));
-        }
-
-        /*
-         * shrink the final exon - reduce end position if forward
-         * strand, increase it if reverse
-         */
-        if (exon[x + 1] >= exon[x])
-        {
-          endxon = exon[x + 1] - cdspos + expectedCdsLength;
-        }
-        else
-        {
-          endxon = exon[x + 1] + cdspos - expectedCdsLength;
-        }
-        break;
-      }
-    }
-
-    if (sxpos != -1)
-    {
-      // and trim the exon interval set if necessary
-      int[] nxon = new int[sxpos + 2];
-      System.arraycopy(exon, 0, nxon, 0, sxpos + 2);
-      nxon[sxpos + 1] = endxon; // update the end boundary for the new exon
-                                // set
-      exon = nxon;
-    }
-    return exon;
+    return line.startsWith("FT    "); // 4 spaces
   }
 }
diff --git a/src/jalview/io/FlatFile.java b/src/jalview/io/FlatFile.java
new file mode 100644 (file)
index 0000000..c25991b
--- /dev/null
@@ -0,0 +1,766 @@
+package jalview.io;
+
+import java.io.IOException;
+import java.text.ParseException;
+import java.util.ArrayList;
+import java.util.Arrays;
+import java.util.HashMap;
+import java.util.Hashtable;
+import java.util.List;
+import java.util.Map;
+import java.util.Map.Entry;
+import java.util.TreeMap;
+
+import jalview.bin.Cache;
+import jalview.datamodel.DBRefEntry;
+import jalview.datamodel.DBRefSource;
+import jalview.datamodel.FeatureProperties;
+import jalview.datamodel.Mapping;
+import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.util.DBRefUtils;
+import jalview.util.DnaUtils;
+import jalview.util.MapList;
+import jalview.util.MappingUtils;
+
+/**
+ * A base class to support parsing of GenBank, EMBL or DDBJ flat file format
+ * data. Example files (rather than formal specifications) are provided at
+ * 
+ * <pre>
+ * https://ena-docs.readthedocs.io/en/latest/submit/fileprep/flat-file-example.html
+ * https://www.ncbi.nlm.nih.gov/Sitemap/samplerecord.html
+ * </pre>
+ * 
+ * or to compare the same entry, see
+ * 
+ * <pre>
+ * https://www.ebi.ac.uk/ena/browser/api/embl/X81322.1
+ * https://www.ncbi.nlm.nih.gov/nuccore/X81322.1
+ * </pre>
+ * 
+ * The feature table part of the file has a common definition, only the start of
+ * each line is formatted differently in GenBank and EMBL. See
+ * http://www.insdc.org/files/feature_table.html#7.1.
+ */
+public abstract class FlatFile extends AlignFile
+{
+  protected static final String LOCATION = "location";
+
+  protected static final String QUOTE = "\"";
+
+  protected static final String DOUBLED_QUOTE = QUOTE + QUOTE;
+
+  protected static final String WHITESPACE = "\\s+";
+
+  /**
+   * Removes leading or trailing double quotes (") unless doubled, and changes
+   * any 'escaped' (doubled) double quotes to single characters. As per the
+   * Feature Table specification for Qualifiers, Free Text.
+   * 
+   * @param value
+   * @return
+   */
+  protected static String removeQuotes(String value)
+  {
+    if (value == null)
+    {
+      return null;
+    }
+    if (value.startsWith(QUOTE) && !value.startsWith(DOUBLED_QUOTE))
+    {
+      value = value.substring(1);
+    }
+    if (value.endsWith(QUOTE) && !value.endsWith(DOUBLED_QUOTE))
+    {
+      value = value.substring(0, value.length() - 1);
+    }
+    value = value.replace(DOUBLED_QUOTE, QUOTE);
+    return value;
+  }
+
+  /**
+   * Truncates (if necessary) the exon intervals to match 3 times the length of
+   * the protein; also accepts 3 bases longer (for stop codon not included in
+   * protein)
+   * 
+   * @param proteinLength
+   * @param exon
+   *          an array of [start, end, start, end...] intervals
+   * @return the same array (if unchanged) or a truncated copy
+   */
+  protected static int[] adjustForProteinLength(int proteinLength,
+          int[] exon)
+  {
+    if (proteinLength <= 0 || exon == null)
+    {
+      return exon;
+    }
+    int expectedCdsLength = proteinLength * 3;
+    int exonLength = MappingUtils.getLength(Arrays.asList(exon));
+
+    /*
+     * if exon length matches protein, or is shorter, or longer by the 
+     * length of a stop codon (3 bases), then leave it unchanged
+     */
+    if (expectedCdsLength >= exonLength
+            || expectedCdsLength == exonLength - 3)
+    {
+      return exon;
+    }
+
+    int origxon[];
+    int sxpos = -1;
+    int endxon = 0;
+    origxon = new int[exon.length];
+    System.arraycopy(exon, 0, origxon, 0, exon.length);
+    int cdspos = 0;
+    for (int x = 0; x < exon.length; x += 2)
+    {
+      cdspos += Math.abs(exon[x + 1] - exon[x]) + 1;
+      if (expectedCdsLength <= cdspos)
+      {
+        // advanced beyond last codon.
+        sxpos = x;
+        if (expectedCdsLength != cdspos)
+        {
+          // System.err
+          // .println("Truncating final exon interval on region by "
+          // + (cdspos - cdslength));
+        }
+
+        /*
+         * shrink the final exon - reduce end position if forward
+         * strand, increase it if reverse
+         */
+        if (exon[x + 1] >= exon[x])
+        {
+          endxon = exon[x + 1] - cdspos + expectedCdsLength;
+        }
+        else
+        {
+          endxon = exon[x + 1] + cdspos - expectedCdsLength;
+        }
+        break;
+      }
+    }
+
+    if (sxpos != -1)
+    {
+      // and trim the exon interval set if necessary
+      int[] nxon = new int[sxpos + 2];
+      System.arraycopy(exon, 0, nxon, 0, sxpos + 2);
+      nxon[sxpos + 1] = endxon; // update the end boundary for the new exon
+                                // set
+      exon = nxon;
+    }
+    return exon;
+  }
+
+  /*
+   * values parsed from the data file
+   */
+  protected String sourceDb;
+
+  protected String accession;
+
+  protected String version;
+
+  protected String description;
+
+  protected int length = 128;
+
+  protected List<DBRefEntry> dbrefs;
+
+  protected String sequenceString;
+
+  protected Map<String, CdsData> cds;
+
+  /**
+   * Constructor
+   * 
+   * @param fp
+   * @param sourceId
+   * @throws IOException
+   */
+  public FlatFile(FileParse fp, String sourceId) throws IOException
+  {
+    super(false, fp); // don't parse immediately
+    this.sourceDb = sourceId;
+    dbrefs = new ArrayList<>();
+
+    /*
+     * using TreeMap gives CDS sequences in alphabetical, so readable, order
+     */
+    cds = new TreeMap<>(String.CASE_INSENSITIVE_ORDER);
+  }
+
+  /**
+   * Parses one (GenBank or EMBL format) CDS feature, saves the parsed data, and
+   * returns the next line
+   * 
+   * @param location
+   * @return
+   * @throws IOException
+   */
+  protected String parseCDSFeature(String location) throws IOException
+  {
+    String line;
+
+    /*
+     * parse location, which can be over >1 line e.g. EAW51554
+     */
+    CdsData data = new CdsData();
+    StringBuilder sb = new StringBuilder().append(location);
+    line = parseFeatureQualifier(sb, LOCATION);
+    data.cdsLocation = sb.toString();
+
+    while (line != null)
+    {
+      if (!isFeatureContinuationLine(line))
+      {
+        // e.g. start of next feature "FT source..."
+        break;
+      }
+
+      /*
+       * extract qualifier, e.g. FT    /protein_id="CAA37824.1"
+       * - the value may extend over more than one line
+       * - if the value has enclosing quotes, these are removed
+       * - escaped double quotes ("") are reduced to a single character
+       */
+      int slashPos = line.indexOf('/');
+      if (slashPos == -1)
+      {
+        Cache.log.error("Unexpected EMBL line ignored: " + line);
+        line = nextLine();
+        continue;
+      }
+      int eqPos = line.indexOf('=', slashPos + 1);
+      if (eqPos == -1)
+      {
+        // can happen, e.g. /ribosomal_slippage
+        line = nextLine();
+        continue;
+      }
+      String qualifier = line.substring(slashPos + 1, eqPos);
+      String value = line.substring(eqPos + 1);
+      value = removeQuotes(value);
+      sb = new StringBuilder().append(value);
+      line = parseFeatureQualifier(sb, qualifier);
+      String featureValue = sb.toString();
+
+      if ("protein_id".equals(qualifier))
+      {
+        data.proteinId = featureValue;
+      }
+      else if ("codon_start".equals(qualifier))
+      {
+        try
+        {
+          data.codonStart = Integer.parseInt(featureValue.trim());
+        } catch (NumberFormatException e)
+        {
+          Cache.log.error("Invalid codon_start in XML for " + this.accession
+                  + ": " + e.getMessage());
+        }
+      }
+      else if ("db_xref".equals(qualifier))
+      {
+        String[] parts = featureValue.split(":");
+        if (parts.length == 2)
+        {
+          String db = parts[0].trim();
+          db = DBRefUtils.getCanonicalName(db);
+          DBRefEntry dbref = new DBRefEntry(db, "0", parts[1].trim());
+          data.xrefs.add(dbref);
+        }
+      }
+      else if ("product".equals(qualifier))
+      {
+        data.proteinName = featureValue;
+      }
+      else if ("translation".equals(qualifier))
+      {
+        data.translation = featureValue;
+      }
+      else if (!"".equals(featureValue))
+      {
+        // throw anything else into the additional properties hash
+        data.cdsProps.put(qualifier, featureValue);
+      }
+    }
+
+    if (data.proteinId != null)
+    {
+      this.cds.put(data.proteinId, data);
+    }
+    else
+    {
+      Cache.log.error("Ignoring CDS feature with no protein_id for "
+              + sourceDb + ":" + accession);
+    }
+
+    return line;
+  }
+
+  protected abstract boolean isFeatureContinuationLine(String line);
+
+  /**
+   * Output (print) is not (yet) implemented for flat file format
+   */
+  @Override
+  public String print(SequenceI[] seqs, boolean jvsuffix)
+  {
+    return null;
+  }
+
+  /**
+   * Constructs and saves the sequence from parsed components
+   */
+  protected void buildSequence()
+  {
+    if (this.accession == null || this.sequenceString == null)
+    {
+      Cache.log.error("Failed to parse data from EMBL");
+      return;
+    }
+
+    String name = this.accession;
+    if (this.sourceDb != null)
+    {
+      name = this.sourceDb + "|" + name;
+    }
+    SequenceI seq = new Sequence(name, this.sequenceString);
+    seq.setDescription(this.description);
+
+    /*
+     * add a DBRef to itself
+     */
+    DBRefEntry selfRef = new DBRefEntry(sourceDb, version, accession);
+    int[] startEnd = new int[] { 1, seq.getLength() };
+    selfRef.setMap(new Mapping(null, startEnd, startEnd, 1, 1));
+    seq.addDBRef(selfRef);
+
+    for (DBRefEntry dbref : this.dbrefs)
+    {
+      seq.addDBRef(dbref);
+    }
+
+    processCDSFeatures(seq);
+
+    seq.deriveSequence();
+
+    addSequence(seq);
+  }
+
+  /**
+   * Process the CDS features, including generation of cross-references and
+   * mappings to the protein products (translation)
+   * 
+   * @param seq
+   */
+  protected void processCDSFeatures(SequenceI seq)
+  {
+    /*
+     * record protein products found to avoid duplication i.e. >1 CDS with 
+     * the same /protein_id [though not sure I can find an example of this]
+     */
+    Map<String, SequenceI> proteins = new HashMap<>();
+    for (CdsData data : cds.values())
+    {
+      processCDSFeature(seq, data, proteins);
+    }
+  }
+
+  /**
+   * Processes data for one parsed CDS feature to
+   * <ul>
+   * <li>create a protein product sequence for the translation</li>
+   * <li>create a cross-reference to protein with mapping from dna</li>
+   * <li>add a CDS feature to the sequence for each CDS start-end range</li>
+   * <li>add any CDS dbrefs to the sequence and to the protein product</li>
+   * </ul>
+   * 
+   * @param SequenceI
+   *          dna
+   * @param proteins
+   *          map of protein products so far derived from CDS data
+   */
+  void processCDSFeature(SequenceI dna, CdsData data,
+          Map<String, SequenceI> proteins)
+  {
+    /*
+     * parse location into a list of [start, end, start, end] positions
+     */
+    int[] exons = getCdsRanges(this.accession, data.cdsLocation);
+
+    MapList maplist = buildMappingToProtein(dna, exons, data);
+
+    int exonNumber = 0;
+
+    for (int xint = 0; exons != null && xint < exons.length - 1; xint += 2)
+    {
+      int exonStart = exons[xint];
+      int exonEnd = exons[xint + 1];
+      int begin = Math.min(exonStart, exonEnd);
+      int end = Math.max(exonStart, exonEnd);
+      exonNumber++;
+      String desc = String.format("Exon %d for protein EMBLCDS:%s",
+              exonNumber, data.proteinId);
+
+      SequenceFeature sf = new SequenceFeature("CDS", desc, begin, end,
+              this.sourceDb);
+      for (Entry<String, String> val : data.cdsProps.entrySet())
+      {
+        sf.setValue(val.getKey(), val.getValue());
+      }
+
+      sf.setEnaLocation(data.cdsLocation);
+      boolean forwardStrand = exonStart <= exonEnd;
+      sf.setStrand(forwardStrand ? "+" : "-");
+      sf.setPhase(String.valueOf(data.codonStart - 1));
+      sf.setValue(FeatureProperties.EXONPOS, exonNumber);
+      sf.setValue(FeatureProperties.EXONPRODUCT, data.proteinName);
+
+      dna.addSequenceFeature(sf);
+    }
+
+    boolean hasUniprotDbref = false;
+    for (DBRefEntry xref : data.xrefs)
+    {
+      dna.addDBRef(xref);
+      if (xref.getSource().equals(DBRefSource.UNIPROT))
+      {
+        /*
+         * construct (or find) the sequence for (data.protein_id, data.translation)
+         */
+        SequenceI protein = buildProteinProduct(dna, xref, data, proteins);
+        Mapping map = new Mapping(protein, maplist);
+        map.setMappedFromId(data.proteinId);
+        xref.setMap(map);
+
+        /*
+         * add DBRefs with mappings from dna to protein and the inverse
+         */
+        DBRefEntry db1 = new DBRefEntry(sourceDb, version, accession);
+        db1.setMap(new Mapping(dna, maplist.getInverse()));
+        protein.addDBRef(db1);
+
+        hasUniprotDbref = true;
+      }
+    }
+
+    /*
+     * if we have a product (translation) but no explicit Uniprot dbref
+     * (example: EMBL M19487 protein_id AAB02592.1)
+     * then construct mappings to an assumed EMBLCDSPROTEIN accession
+     */
+    if (!hasUniprotDbref)
+    {
+      SequenceI protein = proteins.get(data.proteinId);
+      if (protein == null)
+      {
+        protein = new Sequence(data.proteinId, data.translation);
+        protein.setDescription(data.proteinName);
+        proteins.put(data.proteinId, protein);
+      }
+      // assuming CDSPROTEIN sequence version = dna version (?!)
+      DBRefEntry db1 = new DBRefEntry(DBRefSource.EMBLCDSProduct,
+              this.version, data.proteinId);
+      protein.addDBRef(db1);
+
+      DBRefEntry dnaToEmblProteinRef = new DBRefEntry(
+              DBRefSource.EMBLCDSProduct, this.version, data.proteinId);
+      Mapping map = new Mapping(protein, maplist);
+      map.setMappedFromId(data.proteinId);
+      dnaToEmblProteinRef.setMap(map);
+      dna.addDBRef(dnaToEmblProteinRef);
+    }
+
+    /*
+     * comment brought forward from EmblXmlSource, lines 447-451:
+     * TODO: if retrieved from EMBLCDS, add a DBRef back to the parent EMBL
+     * sequence with the exon  map; if given a dataset reference, search
+     * dataset for parent EMBL sequence if it exists and set its map;
+     * make a new feature annotating the coding contig
+     */
+  }
+
+  /**
+   * Computes a mapping from CDS positions in DNA sequence to protein product
+   * positions, with allowance for stop codon or incomplete start codon
+   * 
+   * @param dna
+   * @param exons
+   * @param data
+   * @return
+   */
+  MapList buildMappingToProtein(final SequenceI dna, final int[] exons,
+          final CdsData data)
+  {
+    MapList dnaToProteinMapping = null;
+    int peptideLength = data.translation.length();
+
+    int[] proteinRange = new int[] { 1, peptideLength };
+    if (exons != null && exons.length > 0)
+    {
+      /*
+       * We were able to parse 'location'; do a final 
+       * product length truncation check
+       */
+      int[] cdsRanges = adjustForProteinLength(peptideLength, exons);
+      dnaToProteinMapping = new MapList(cdsRanges, proteinRange, 3, 1);
+    }
+    else
+    {
+      /*
+       * workaround until we handle all 'location' formats fully
+       * e.g. X53828.1:60..1058 or <123..>289
+       */
+      Cache.log.error(String.format(
+              "Implementation Notice: EMBLCDS location '%s'not properly supported yet"
+                      + " - Making up the CDNA region of (%s:%s)... may be incorrect",
+              data.cdsLocation, sourceDb, this.accession));
+
+      int completeCodonsLength = 1 - data.codonStart + dna.getLength();
+      int mappedDnaEnd = dna.getEnd();
+      if (peptideLength * 3 == completeCodonsLength)
+      {
+        // this might occur for CDS sequences where no features are marked
+        Cache.log.warn("Assuming no stop codon at end of cDNA fragment");
+        mappedDnaEnd = dna.getEnd();
+      }
+      else if ((peptideLength + 1) * 3 == completeCodonsLength)
+      {
+        Cache.log.warn("Assuming stop codon at end of cDNA fragment");
+        mappedDnaEnd = dna.getEnd() - 3;
+      }
+
+      if (mappedDnaEnd != -1)
+      {
+        int[] cdsRanges = new int[] {
+            dna.getStart() + (data.codonStart - 1), mappedDnaEnd };
+        dnaToProteinMapping = new MapList(cdsRanges, proteinRange, 3, 1);
+      }
+    }
+
+    return dnaToProteinMapping;
+  }
+
+  /**
+   * Constructs a sequence for the protein product for the CDS data (if there is
+   * one), and dbrefs with mappings from CDS to protein and the reverse
+   * 
+   * @param dna
+   * @param xref
+   * @param data
+   * @param proteins
+   * @return
+   */
+  SequenceI buildProteinProduct(SequenceI dna, DBRefEntry xref,
+          CdsData data, Map<String, SequenceI> proteins)
+  {
+    /*
+     * check we have some data to work with
+     */
+    if (data.proteinId == null || data.translation == null)
+    {
+      return null;
+    }
+
+    /*
+     * Construct the protein sequence (if not already seen)
+     */
+    String proteinSeqName = xref.getSource() + "|" + xref.getAccessionId();
+    SequenceI protein = proteins.get(proteinSeqName);
+    if (protein == null)
+    {
+      protein = new Sequence(proteinSeqName, data.translation, 1,
+              data.translation.length());
+      protein.setDescription(data.proteinName != null ? data.proteinName
+              : "Protein Product from " + sourceDb);
+      proteins.put(proteinSeqName, protein);
+    }
+
+    return protein;
+  }
+
+  /**
+   * Returns the CDS location as a single array of [start, end, start, end...]
+   * positions. If on the reverse strand, these will be in descending order.
+   * 
+   * @param accession
+   * @param location
+   * @return
+   */
+  protected int[] getCdsRanges(String accession, String location)
+  {
+    if (location == null)
+    {
+      return new int[] {};
+    }
+
+    try
+    {
+      List<int[]> ranges = DnaUtils.parseLocation(location);
+      return MappingUtils.listToArray(ranges);
+    } catch (ParseException e)
+    {
+      Cache.log.warn(
+              String.format("Not parsing inexact CDS location %s in ENA %s",
+                      location, accession));
+      return new int[] {};
+    }
+  }
+
+  /**
+   * Reads the value of a feature (FT) qualifier from one or more lines of the
+   * file, and returns the next line after that. Values are appended to the
+   * string buffer, which should be already primed with the value read from the
+   * first line for the qualifier (with any leading double quote removed).
+   * Enclosing double quotes are removed, and escaped (repeated) double quotes
+   * reduced to one only. For example for
+   * 
+   * <pre>
+   * FT      /note="gene_id=hCG28070.3 
+   * FT      ""foobar"" isoform=CRA_b"
+   * the returned value is
+   * gene_id=hCG28070.3 "foobar" isoform=CRA_b
+   * </pre>
+   * 
+   * Note the side-effect of this method, to advance data reading to the next
+   * line after the feature qualifier (which could be another qualifier, a
+   * different feature, a non-feature line, or null at end of file).
+   * 
+   * @param sb
+   *          a string buffer primed with the first line of the value
+   * @param qualifierName
+   * @return
+   * @throws IOException
+   */
+  String parseFeatureQualifier(StringBuilder sb, String qualifierName)
+          throws IOException
+  {
+    String line;
+    while ((line = nextLine()) != null)
+    {
+      if (!isFeatureContinuationLine(line))
+      {
+        break; // reached next feature or other input line
+      }
+      String[] tokens = line.split(WHITESPACE);
+      if (tokens.length < 2)
+      {
+        Cache.log.error("Ignoring bad EMBL line for " + this.accession
+                + ": " + line);
+        break;
+      }
+      if (tokens[1].startsWith("/"))
+      {
+        break; // next feature qualifier
+      }
+
+      /*
+       * heuristic rule: most multi-line value (e.g. /product) are text,
+       * so add a space for word boundary at a new line; not for translation
+       */
+      if (!"translation".equals(qualifierName)
+              && !LOCATION.equals(qualifierName))
+      {
+        sb.append(" ");
+      }
+
+      /*
+       * remove trailing " and unescape doubled ""
+       */
+      String data = removeQuotes(tokens[1]);
+      sb.append(data);
+    }
+
+    return line;
+  }
+
+  /**
+   * Reads and saves the sequence, read from the lines following the ORIGIN
+   * (GenBank) or SQ (EMBL) line. Whitespace and position counters are
+   * discarded. Returns the next line following the sequence data (the next line
+   * that doesn't start with whitespace).
+   * 
+   * @throws IOException
+   */
+  protected String parseSequence() throws IOException
+  {
+    StringBuilder sb = new StringBuilder(this.length);
+    String line = nextLine();
+    while (line != null && line.startsWith(" "))
+    {
+      line = line.trim();
+      String[] blocks = line.split(WHITESPACE);
+
+      /*
+       * the first or last block on each line might be a position count - omit
+       */
+      for (int i = 0; i < blocks.length; i++)
+      {
+        try
+        {
+          Long.parseLong(blocks[i]);
+          // position counter - ignore it
+        } catch (NumberFormatException e)
+        {
+          // sequence data - append it
+          sb.append(blocks[i]);
+        }
+      }
+      line = nextLine();
+    }
+    this.sequenceString = sb.toString();
+
+    return line;
+  }
+
+  /**
+   * Processes a feature line. If it declares a feature type of interest
+   * (currently, only CDS is processed), processes all of the associated lines
+   * (feature qualifiers), and returns the next line after that, otherwise
+   * simply returns the next line.
+   * 
+   * @param line
+   *          the first line for the feature (with initial FT omitted for EMBL
+   *          format)
+   * @return
+   * @throws IOException
+   */
+  protected String parseFeature(String line) throws IOException
+  {
+    String[] tokens = line.trim().split(WHITESPACE);
+    if (tokens.length < 2 || !"CDS".equals(tokens[0]))
+    {
+      return nextLine();
+    }
+
+    return parseCDSFeature(tokens[1]);
+  }
+}
+
+/**
+ * A data bean class to hold values parsed from one CDS Feature
+ */
+class CdsData
+{
+  String translation; // from /translation qualifier
+
+  String cdsLocation; // the raw value e.g. join(1..1234,2012..2837)
+
+  int codonStart = 1; // from /codon_start qualifier
+
+  String proteinName; // from /product qualifier; used for protein description
+
+  String proteinId; // from /protein_id qualifier
+
+  List<DBRefEntry> xrefs = new ArrayList<>(); // from /db_xref qualifiers
+
+  Map<String, String> cdsProps = new Hashtable<>(); // other qualifiers
+}
diff --git a/src/jalview/io/GenBankFile.java b/src/jalview/io/GenBankFile.java
new file mode 100644 (file)
index 0000000..7988764
--- /dev/null
@@ -0,0 +1,207 @@
+package jalview.io;
+
+import java.io.IOException;
+
+import jalview.bin.Cache;
+
+/**
+ * A class that provides selective parsing of the GenBank flatfile format.
+ * <p>
+ * The initial implementation is limited to extracting fields used by Jalview
+ * after fetching an EMBL or EMBLCDS entry:
+ * 
+ * <pre>
+ * accession, version, sequence, xref
+ * and (for CDS feature) location, protein_id, product, codon_start, translation
+ * </pre>
+ * 
+ * @author gmcarstairs
+ * @see https://www.ncbi.nlm.nih.gov/Sitemap/samplerecord.html
+ */
+public class GenBankFile extends FlatFile
+{
+  private static final String DEFINITION = "DEFINITION";
+
+  /**
+   * Constructor given a data source and the id of the source database
+   * 
+   * @param fp
+   * @param sourceId
+   * @throws IOException
+   */
+  public GenBankFile(FileParse fp, String sourceId) throws IOException
+  {
+    super(fp, sourceId);
+  }
+
+  /**
+   * Parses the flatfile, and if successful, saves as an annotated sequence
+   * which may be retrieved by calling {@code getSequence()}
+   * 
+   * @throws IOException
+   * @see https://www.ncbi.nlm.nih.gov/Sitemap/samplerecord.html
+   */
+  @Override
+  public void parse() throws IOException
+  {
+    String line = nextLine();
+    while (line != null)
+    {
+      if (line.startsWith(DEFINITION))
+      {
+        line = parseDefinition(line);
+      }
+      else if (line.startsWith("ACCESSION"))
+      {
+        this.accession = line.split(WHITESPACE)[1];
+        line = nextLine();
+      }
+      else if (line.startsWith("VERSION"))
+      {
+        line = parseVersion(line);
+      }
+      else if (line.startsWith("ORIGIN"))
+      {
+        line = parseSequence();
+      }
+      else if (line.startsWith("FEATURES"))
+      {
+        line = nextLine();
+        while (line.startsWith(" "))
+        {
+          line = parseFeature(line);
+        }
+      }
+      else
+      {
+        line = nextLine();
+      }
+    }
+    buildSequence();
+  }
+
+  /**
+   * Extracts and saves the primary accession and version (SV value) from an ID
+   * line, or null if not found. Returns the next line after the one processed.
+   * 
+   * @param line
+   * @throws IOException
+   */
+  String parseLocus(String line) throws IOException
+  {
+    String[] tokens = line.substring(2).split(";");
+
+    /*
+     * first is primary accession
+     */
+    String token = tokens[0].trim();
+    if (!token.isEmpty())
+    {
+      this.accession = token;
+    }
+
+    /*
+     * second token is 'SV versionNo'
+     */
+    if (tokens.length > 1)
+    {
+      token = tokens[1].trim();
+      if (token.startsWith("SV"))
+      {
+        String[] bits = token.trim().split(WHITESPACE);
+        this.version = bits[bits.length - 1];
+      }
+    }
+
+    /*
+     * seventh token is 'length BP'
+     */
+    if (tokens.length > 6)
+    {
+      token = tokens[6].trim();
+      String[] bits = token.trim().split(WHITESPACE);
+      try
+      {
+        this.length = Integer.valueOf(bits[0]);
+      } catch (NumberFormatException e)
+      {
+        Cache.log.error("bad length read in flatfile, line: " + line);
+      }
+    }
+
+    return nextLine();
+  }
+
+  /**
+   * Reads sequence description from DEFINITION lines. Any trailing period is
+   * discarded. Returns the next line after the definition line(s).
+   * 
+   * @param line
+   * @return
+   * @throws IOException
+   */
+  String parseDefinition(String line) throws IOException
+  {
+    String desc = line.substring(DEFINITION.length()).trim();
+    if (desc.endsWith("."))
+    {
+      desc = desc.substring(0, desc.length() - 1);
+    }
+
+    /*
+     * pass over any additional DE lines
+     */
+    while ((line = nextLine()) != null)
+    {
+      if (line.startsWith(" "))
+      {
+        // definition continuation line
+        desc += line.trim();
+      }
+      else
+      {
+        break;
+      }
+    }
+    this.description = desc;
+
+    return line;
+  }
+
+  /**
+   * Parses the VERSION line e.g.
+   * 
+   * <pre>
+   * VERSION     X81322.1
+   * </pre>
+   * 
+   * and returns the next line
+   * 
+   * @param line
+   * @throws IOException
+   */
+  String parseVersion(String line) throws IOException
+  {
+    /*
+     * extract version part of <accession>.<version>
+     * https://www.ncbi.nlm.nih.gov/Sitemap/samplerecord.html#VersionB
+     */
+    String[] tokens = line.split(WHITESPACE);
+    if (tokens.length > 1)
+    {
+      tokens = tokens[1].split("\\.");
+      if (tokens.length > 1)
+      {
+        this.version = tokens[1];
+      }
+    }
+
+    return nextLine();
+  }
+
+  @Override
+  protected boolean isFeatureContinuationLine(String line)
+  {
+    return line.startsWith("      "); // 6 spaces
+  }
+}
index 284ec10..654b03a 100644 (file)
@@ -47,6 +47,7 @@ public class DnaUtils
   public static List<int[]> parseLocation(String location)
           throws ParseException
   {
+    location = location.trim(); // failsafe for untidy input data
     if (location.startsWith("join("))
     {
       return parseJoin(location);
index 2898a06..5d8ef21 100644 (file)
@@ -3,9 +3,9 @@ package jalview.io;
 import static org.testng.Assert.assertEquals;
 import static org.testng.Assert.assertTrue;
 import static org.testng.AssertJUnit.assertNotNull;
+import static org.testng.AssertJUnit.assertNull;
 import static org.testng.AssertJUnit.assertSame;
 import static org.testng.AssertJUnit.fail;
-import static org.testng.AssertJUnit.assertNull;
 
 import java.io.File;
 import java.io.IOException;
@@ -14,8 +14,10 @@ import java.util.Arrays;
 import java.util.List;
 import java.util.Set;
 
+import org.testng.annotations.BeforeClass;
 import org.testng.annotations.Test;
 
+import jalview.bin.Cache;
 import jalview.datamodel.DBRefEntry;
 import jalview.datamodel.Mapping;
 import jalview.datamodel.SequenceFeature;
@@ -25,6 +27,12 @@ import jalview.util.MapList;
 
 public class EmblFlatFileTest
 {
+  @BeforeClass(alwaysRun = true)
+  public void setUp()
+  {
+    Cache.initLogger();
+  }
+
   /**
    * A fairly tough test, using J03321 (circular DNA), which has 8 CDS features,
    * one of them reverse strand
diff --git a/test/jalview/io/GenBankFileTest.java b/test/jalview/io/GenBankFileTest.java
new file mode 100644 (file)
index 0000000..d800b1d
--- /dev/null
@@ -0,0 +1,204 @@
+package jalview.io;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertTrue;
+import static org.testng.AssertJUnit.assertNull;
+
+import java.io.File;
+import java.io.IOException;
+import java.net.MalformedURLException;
+import java.util.Arrays;
+import java.util.List;
+import java.util.Set;
+
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.Test;
+
+import jalview.bin.Cache;
+import jalview.datamodel.DBRefEntry;
+import jalview.datamodel.Mapping;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
+import jalview.util.MapList;
+
+public class GenBankFileTest
+{
+  @BeforeClass(alwaysRun = true)
+  public void setUp()
+  {
+    Cache.initLogger();
+  }
+
+  /**
+   * A fairly tough test, using J03321 (circular DNA), which has 8 CDS features,
+   * one of them reverse strand
+   * 
+   * @throws MalformedURLException
+   * @throws IOException
+   */
+  @Test(groups = "Functional")
+  public void testParse() throws MalformedURLException, IOException
+  {
+    File dataFile = new File("test/jalview/io/J03321.gb");
+    FileParse fp = new FileParse(dataFile.getAbsolutePath(),
+            DataSourceType.FILE);
+    FlatFile parser = new GenBankFile(fp, "GenBankTest");
+    parser.parse();
+    List<SequenceI> seqs = parser.getSeqs();
+
+    assertEquals(seqs.size(), 1);
+    SequenceI seq = seqs.get(0);
+    assertEquals(seq.getName(), "GenBankTest|J03321");
+    assertEquals(seq.getLength(), 7502);
+    assertEquals(seq.getDescription(),
+            "Chlamydia trachomatis plasmid pCHL1, complete sequence");
+
+    /*
+     * should be 9 CDS features (one is a 'join' of two exons)
+     */
+    Set<String> featureTypes = seq.getFeatures().getFeatureTypes();
+    assertEquals(featureTypes.size(), 1);
+    assertTrue(featureTypes.contains("CDS"));
+
+    /*
+     * inspect some features (sorted just for convenience of test assertions)
+     */
+    List<SequenceFeature> features = seq.getFeatures()
+            .getAllFeatures("CDS");
+    SequenceFeatures.sortFeatures(features, true);
+    assertEquals(features.size(), 9);
+
+    SequenceFeature sf = features.get(0);
+    assertEquals(sf.getBegin(), 1);
+    assertEquals(sf.getEnd(), 437);
+    assertEquals(sf.getDescription(),
+            "Exon 2 for protein EMBLCDS:AAA91567.1");
+    assertEquals(sf.getFeatureGroup(), "GenBankTest");
+    assertEquals(sf.getEnaLocation(), "join(7022..7502,1..437)");
+    assertEquals(sf.getPhase(), "0");
+    assertEquals(sf.getStrand(), 1);
+    assertEquals(sf.getValue("note"), "pGP7-D");
+    // this is the second exon of circular CDS!
+    assertEquals(sf.getValue("exon number"), 2);
+    assertEquals(sf.getValue("product"), "hypothetical protein");
+    assertEquals(sf.getValue("transl_table"), "11");
+
+    sf = features.get(1);
+    assertEquals(sf.getBegin(), 488);
+    assertEquals(sf.getEnd(), 1480);
+    assertEquals(sf.getDescription(),
+            "Exon 1 for protein EMBLCDS:AAA91568.1");
+    assertEquals(sf.getFeatureGroup(), "GenBankTest");
+    assertEquals(sf.getEnaLocation(), "complement(488..1480)");
+    assertEquals(sf.getPhase(), "0");
+    assertEquals(sf.getStrand(), -1); // reverse strand!
+    assertEquals(sf.getValue("note"), "pGP8-D");
+    assertEquals(sf.getValue("exon number"), 1);
+    assertEquals(sf.getValue("product"), "hypothetical protein");
+
+    sf = features.get(7);
+    assertEquals(sf.getBegin(), 6045);
+    assertEquals(sf.getEnd(), 6788);
+    assertEquals(sf.getDescription(),
+            "Exon 1 for protein EMBLCDS:AAA91574.1");
+    assertEquals(sf.getFeatureGroup(), "GenBankTest");
+    assertEquals(sf.getEnaLocation(), "6045..6788");
+    assertEquals(sf.getPhase(), "0");
+    assertEquals(sf.getStrand(), 1);
+    assertEquals(sf.getValue("note"), "pGP6-D (gtg start codon)");
+    assertEquals(sf.getValue("exon number"), 1);
+    assertEquals(sf.getValue("product"), "hypothetical protein");
+
+    /*
+     * CDS at 7022-7502 is the first exon of the circular CDS
+     */
+    sf = features.get(8);
+    assertEquals(sf.getBegin(), 7022);
+    assertEquals(sf.getEnd(), 7502);
+    assertEquals(sf.getDescription(),
+            "Exon 1 for protein EMBLCDS:AAA91567.1");
+    assertEquals(sf.getFeatureGroup(), "GenBankTest");
+    assertEquals(sf.getEnaLocation(), "join(7022..7502,1..437)");
+    assertEquals(sf.getPhase(), "0");
+    assertEquals(sf.getStrand(), 1);
+    assertEquals(sf.getValue("note"), "pGP7-D");
+    assertEquals(sf.getValue("exon number"), 1);
+    assertEquals(sf.getValue("product"), "hypothetical protein");
+
+    /*
+     * GenBank doesn't declare accession or CDS xrefs;
+     * dbrefs are added by Jalview for 
+     * xref to self : 1
+     * protein products: 8
+     */
+    List<DBRefEntry> dbrefs = Arrays.asList(seq.getDBRefs());
+
+    assertEquals(dbrefs.size(), 9);
+    // xref to 'self':
+    DBRefEntry selfRef = new DBRefEntry("GENBANKTEST", "1", "J03321");
+    int[] range = new int[] { 1, seq.getLength() };
+    selfRef.setMap(new Mapping(null, range, range, 1, 1));
+    assertTrue(dbrefs.contains(selfRef));
+
+    /*
+     * dna should have dbref to itself, and to EMBLCDSPROTEIN
+     * for each /protein_id (synthesized as no UNIPROT xref)
+     */
+    // TODO check if we should synthesize EMBLCDSPROTEIN dbrefs
+    DBRefEntry dbref = dbrefs.get(0);
+    assertEquals(dbref.getSource(), "GENBANKTEST");
+    assertEquals(dbref.getAccessionId(), "J03321");
+    Mapping mapping = dbref.getMap();
+    assertNull(mapping.getTo());
+    MapList map = mapping.getMap();
+    assertEquals(map.getFromLowest(), 1);
+    assertEquals(map.getFromHighest(), 7502);
+    assertEquals(map.getToLowest(), 1);
+    assertEquals(map.getToHighest(), 7502);
+    assertEquals(map.getFromRatio(), 1);
+    assertEquals(map.getToRatio(), 1);
+
+    // dbref to inferred EMBLCDSPROTEIN for first CDS
+    dbref = dbrefs.get(1);
+    assertEquals(dbref.getSource(), "EMBLCDSPROTEIN");
+    assertEquals(dbref.getAccessionId(), "AAA91567.1");
+    mapping = dbref.getMap();
+    SequenceI mapTo = mapping.getTo();
+    assertEquals(mapTo.getName(), "AAA91567.1");
+    // the /product qualifier transfers to protein product description
+    assertEquals(mapTo.getDescription(), "hypothetical protein");
+    String seqString = mapTo.getSequenceAsString();
+    assertEquals(seqString.length(), 305);
+    assertTrue(seqString.startsWith("MGSMAF"));
+    assertTrue(seqString.endsWith("QTPTIL"));
+    map = mapping.getMap();
+    assertEquals(map.getFromLowest(), 1);
+    assertEquals(map.getFromHighest(), 7502);
+    assertEquals(map.getToLowest(), 1);
+    assertEquals(map.getToHighest(), 305);
+    assertEquals(map.getFromRatio(), 3);
+    assertEquals(map.getToRatio(), 1);
+
+    // dbref to inferred EMBLCDSPROTEIN for last CDS
+    dbref = dbrefs.get(8);
+    assertEquals(dbref.getSource(), "EMBLCDSPROTEIN");
+    assertEquals(dbref.getAccessionId(), "AAA91574.1");
+    mapping = dbref.getMap();
+     mapTo = mapping.getTo();
+    assertEquals(mapTo.getName(), "AAA91574.1");
+    // the /product qualifier transfers to protein product description
+    assertEquals(mapTo.getDescription(), "hypothetical protein");
+    seqString = mapTo.getSequenceAsString();
+    assertEquals(seqString.length(), 247);
+    assertTrue(seqString.startsWith("MNKLK"));
+    assertTrue(seqString.endsWith("FKQKS"));
+    map = mapping.getMap();
+    assertEquals(map.getFromLowest(), 6045);
+    assertEquals(map.getFromHighest(), 6788);
+    assertEquals(map.getToLowest(), 1);
+    assertEquals(map.getToHighest(), 247);
+    assertEquals(map.getFromRatio(), 3);
+    assertEquals(map.getToRatio(), 1);
+  }
+}
index 92065b9..555c2b5 100644 (file)
@@ -48,7 +48,9 @@ FT                   /serotype="D"
 FT                   /mol_type="genomic DNA"
 FT                   /isolation_source="trachoma"
 FT                   /db_xref="taxon:813"
-FT   CDS             join(7022..7502,1..437)
+XX   next line artificially split for test purposes!
+FT   CDS             join(7022..7502,
+FT                   1..437)
 FT                   /codon_start=1
 FT                   /transl_table=11
 FT                   /product="hypothetical protein"
diff --git a/test/jalview/io/J03321.gb b/test/jalview/io/J03321.gb
new file mode 100644 (file)
index 0000000..99729e4
--- /dev/null
@@ -0,0 +1,258 @@
+LOCUS       CH1L1CG                 7502 bp    DNA     circular BCT 06-APR-2020
+DEFINITION  Chlamydia trachomatis plasmid pCHL1, complete sequence.
+ACCESSION   J03321
+VERSION     J03321.1
+DBLINK      BioSample: SAMN14225621
+KEYWORDS    .
+SOURCE      Chlamydia trachomatis
+  ORGANISM  Chlamydia trachomatis
+            Bacteria; Chlamydiae; Chlamydiales; Chlamydiaceae;
+            Chlamydia/Chlamydophila group; Chlamydia.
+REFERENCE   1  (bases 1 to 7502)
+  AUTHORS   Comanducci,M., Ricci,S., Cevenini,R. and Ratti,G.
+  TITLE     Diversity of the Chlamydia trachomatis common plasmid in biovars
+            with different pathogenicity
+  JOURNAL   Plasmid 23 (2), 149-154 (1990)
+   PUBMED   2194229
+REFERENCE   2  (bases 1 to 7502)
+  AUTHORS   Comanducci,M., Ricci,S., Cevenini,R. and Ratti,G.
+  TITLE     Direct Submission
+  JOURNAL   Submitted (23-JUN-2010) Sclavo Research Centre, Siena, Italy
+COMMENT     Draft entry and computer-readable sequence kindly submitted by
+            G.Ratti, 28-MAR-1990.
+            ! CDS location split below (and this line added), for Jalview test purposes !
+FEATURES             Location/Qualifiers
+     source          1..7502
+                     /organism="Chlamydia trachomatis"
+                     /mol_type="genomic DNA"
+                     /serotype="D"
+                     /isolate="G0/86"
+                     /isolation_source="trachoma"
+                     /db_xref="taxon:813"
+                     /plasmid="pCHL1"
+     CDS             join(7022..7502,
+                     1..437)
+                     /note="pGP7-D"
+                     /codon_start=1
+                     /transl_table=11
+                     /product="hypothetical protein"
+                     /protein_id="AAA91567.1"
+                     /translation="MGSMAFHKSRLFLTFGDASEIWLSTLSYLTRKNYASGINFLVSL
+                     EILDLSETLIKAISLDHSESLFKIKSLDVFNGKVVSEASKQARAACYISFTKFLYRLT
+                     KGYIKPAIPLKDFGNTTFFKIRDKIKTESISKQEWTVFFEALRIVNYRDYLIGKLIVQ
+                     GIRKLDEILSLRTDDLFFASNQISFRIKKRQNKETKILITFPISLMEELQKYTCGRNG
+                     RVFVSKIGIPVTTSQVAHNFRLAEFHSAMKIKITPRVLRASALIHLKQIGLKDEEIMR
+                     ISCLSSRQSVCSYCSGEEVIPLVQTPTIL"
+     CDS             complement(488..1480)
+                     /note="pGP8-D"
+                     /codon_start=1
+                     /transl_table=11
+                     /product="hypothetical protein"
+                     /protein_id="AAA91568.1"
+                     /translation="MGKGILSLQQEMSLEYSEKSYQEVLKIRQESYWKRMKSFSLFEV
+                     IMHWTASLNKHTCRSYRGSFLSLEKIGLLSLDMNLQEFSLLNHNLILDAIKKVSSAKT
+                     SWTEGTKQVRAASYISLTRFLNRMTQGIVAIAQPSKQENSRTFFKTREIVKTDAMNSL
+                     QTASFLKELKKINARDWLIAQTMLQGGKRSSEVLSLEISQICFQQATISFSQLKNRQT
+                     EKRIIITYPQKFMHFLQEYIGQRRGFVFVTRSGKMVGLRQIARTFSQAGLQAAIPFKI
+                     TPHVLRATAVTEYKRLGCSDSDIMKVTGHATAKMIFAYDKSSREDNASKKMALI"
+     CDS             1579..2934
+                     /note="pGP1-D"
+                     /codon_start=1
+                     /transl_table=11
+                     /product="hypothetical protein"
+                     /protein_id="AAA91569.1"
+                     /translation="MKTRSEIENRMQDIEYALLGKALIFEDSTEYILRQLANYEFKCS
+                     HHKNIFIVFKHLKDNGLPITVDSAWEELLRRRIKDMDKSYLGLMLHDALSNDKLRSVS
+                     HTVFLDDLSVCSAEENLSNFIFRSFNEYNENPLRRSPFLLLERIKGRLDSAIAKTFSI
+                     RSARGRSIYDIFSQSEIGVLARIKKRRVAFSENQNSFFDGFPTGYKDIDDKGVILAKG
+                     NFVIIAARPSIGKTALAIDMAINLAVTQQRRVGFLSLEMSAGQIVERIIANLTGISGE
+                     KLQRGDLSKEELFRVEEAGETVRESHFYICSDSQYKLNLIANQIRLLRKEDRVDVIFI
+                     DYLQLINSSVGENRQNEIADISRTLRGLASELNIPIVCLSQLSRKVEDRANKVPMLSD
+                     LRDSGQIEQDADVILFINRKESSSNCEITVGKNRHGSVFSSVLHFDPKISKFSAIKKV
+                     W"
+     CDS             2928..3992
+                     /note="pGP2-D"
+                     /codon_start=1
+                     /transl_table=11
+                     /product="hypothetical protein"
+                     /protein_id="AAA91570.1"
+                     /translation="MVNYSNCHFIKSPIHLENQKFGRRPGQSIKISPKLAQNGMVEVI
+                     GLDFLSSHYHALAAIQRLLTATNYKGNTKGVVLSRESNSFQFEGWIPRIRFTKTEFLE
+                     AYGVKRYKTSRNKYEFSGKEAETALEALYHLGHQPFLIVATRTRWTNGTQIVDRYQTL
+                     SPIIRIYEGWEGLTDEENIDIDLTPFNSPPTRKHKGFVVEPCPILVDQIESYFVIKPA
+                     NVYQEIKMRFPNASKYAYTFIDWVITAAAKKRRKLTKDNSWPENLLLNVNVKSLAYIL
+                     RMNRYICTRNWKKIELAIDKCIEIAIQLGWLSRRKRIEFLDSSKLSKKEILYLNKERF
+                     EEITKKSKEQMEQLEQESIN"
+     CDS             4054..4848
+                     /note="pGP3-D"
+                     /codon_start=1
+                     /transl_table=11
+                     /product="hypothetical protein"
+                     /protein_id="AAA91571.1"
+                     /translation="MGNSGFYLYNTENCVFADNIKVGQMTEPLKDQQIILGTTSTPVA
+                     AKMTASDGISLTVSNNSSTNASITIGLDAEKAYQLILEKLGDQILDGIADTIVDSTVQ
+                     DILDKIKTDPSLGLLKAFNNFPITNKIQCNGLFTPSNIETLLGGTEIGKFTVTPKSSG
+                     SMFLVSADIIASRMEGGVVLALVREGDSKPCAISYGYSSGIPNLCSLRTSITNTGLTP
+                     TTYSLRVGGLESGVVWVNALSNGNDILGITNTSNVSFLEVIPQTNA"
+     CDS             4918..5226
+                     /note="pGP4-D"
+                     /codon_start=1
+                     /transl_table=11
+                     /product="hypothetical protein"
+                     /protein_id="AAA91572.1"
+                     /translation="MQNKRKVRDDFIKIVKDVKKDFPELDLKIRVNKEKVTFLNSPLE
+                     LYHKSVSLILGLLQQIENSLGLFPDSPVLEKLEDNSLKLKKALIMLILSRKDMFSKAE
+                     "
+     CDS             5317..6048
+                     /note="pGP5-D (gtg start codon)"
+                     /codon_start=1
+                     /transl_table=11
+                     /product="hypothetical protein"
+                     /protein_id="AAA91573.1"
+                     /translation="MGCNLAQFLGKKVLLADLDPQSNLSSGLGASVRSDQKGLHDIVY
+                     TSNDLKSIICETKKDSVDLIPASFSSEQFRELDIHRGPSNNLKLFLNEYCAPFYDICI
+                     IDTPPSLGGLTKEAFVAGDKLIACLTPEPFSILGLQKIREFLSSVGKPEEEHILGIAL
+                     SFWDDRNSTNQMYIDIIESIYKNKLFSTKIRRDISLSRSLLKEDSVANVYPNSRAAED
+                     ILKLTHEIANILHIEYERDYSQRTT"
+     CDS             6045..6788
+                     /note="pGP6-D (gtg start codon)"
+                     /codon_start=1
+                     /transl_table=11
+                     /product="hypothetical protein"
+                     /protein_id="AAA91574.1"
+                     /translation="MNKLKKEADVFFKKNQTAASLDFKKTLPSIELFSATLNSEESQS
+                     LDRLFLSESQNYSDEEFYQEDILAVKLLTGQIKSIQKQHVLLLGEKIYNARKILSKDH
+                     FSSTTFSSWIELVFRTKSSAYNALAYYELFINLPNQTLQKEFQSIPYKSAYILAARKG
+                     DLKTKVDVIGKVCGMSNSSAIRVLDQFLPSSRNKDVRETIDKSDSEKNRQLSDFLIEI
+                     LRIMCSGVSLSSYNENLLQQLFELFKQKS"
+     repeat_region   6857..6945
+                     /note="four tandem 22bp repeats"
+ORIGIN      
+        1 ggatccgtaa gttagacgaa attttgtctt tgcgcacaga cgatctattt tttgcatcca
+       61 atcagatttc ctttcgcatt aaaaaaagac agaataaaga aaccaaaatt ctaatcacat
+      121 ttcctatcag cttaatggaa gagttgcaaa aatacacttg tgggagaaat gggagagtat
+      181 ttgtttctaa aatagggatt cctgtaacaa caagtcaggt tgcgcataat tttaggcttg
+      241 cagagttcca tagtgctatg aaaataaaaa ttactcccag agtacttcgt gcaagcgctt
+      301 tgattcattt aaagcaaata ggattaaaag atgaggaaat catgcgtatt tcctgtcttt
+      361 catcgagaca aagtgtgtgt tcttattgtt ctggggaaga ggtaattcct ctagtacaaa
+      421 cacccacaat attgtgatat aattaaaatt atattcatat tctgttgcca gaaaaaacac
+      481 ctttaggcta tattagagcc atcttctttg aagcgttgtc ttctcgagaa gatttatcgt
+      541 acgcaaatat catctttgcg gttgcgtgtc ctgtgacctt cattatgtcg gagtctgagc
+      601 accctaggcg tttgtactcc gtcacagcgg ttgctcgaag cacgtgcggg gttattttaa
+      661 aagggattgc agcttgtagt cctgcttgag agaacgtgcg ggcgatttgc cttaacccca
+      721 ccatttttcc ggagcgagtt acgaagacaa aacctcttcg ttgaccgatg tactcttgta
+      781 gaaagtgcat aaacttctga ggataagtta taataatcct cttttctgtc tgacggttct
+      841 taagctggga gaaagaaatg gtagcttgtt ggaaacaaat ctgactaatc tccaagctta
+      901 agacttcaga ggagcgttta cctccttgga gcattgtctg ggcgatcaac caatcccggg
+      961 cattgatttt ttttagctct tttaggaagg atgctgtttg caaactgttc atcgcatccg
+     1021 tttttactat ttccctggtt ttaaaaaatg ttcgactatt ttcttgttta gaaggttgcg
+     1081 ctatagcgac tattccttga gtcatcctgt ttaggaatct tgttaaggaa atatagcttg
+     1141 ctgctcgaac ttgtttagta ccttcggtcc aagaagtctt ggcagaggaa acttttttaa
+     1201 tcgcatctag gattagatta tgatttaaaa gggaaaactc ttgcagattc atatccaagg
+     1261 acaatagacc aatcttttct aaagacaaaa aagatcctcg atatgatcta caagtatgtt
+     1321 tgttgagtga tgcggtccaa tgcataataa cttcgaataa ggagaagctt ttcatgcgtt
+     1381 tccaatagga ttcttggcga atttttaaaa cttcctgata agacttttca ctatattcta
+     1441 acgacatttc ttgctgcaaa gataaaatcc ctttacccat gaaatccctc gtgatataac
+     1501 ctatccgtaa aatgtcctga ttagtgaaat aatcaggttg ttaacaggat agcacgctcg
+     1561 gtattttttt atataaacat gaaaactcgt tccgaaatag aaaatcgcat gcaagatatc
+     1621 gagtatgcgt tgttaggtaa agctctgata tttgaagact ctactgagta tattctgagg
+     1681 cagcttgcta attatgagtt taagtgttct catcataaaa acatattcat agtatttaaa
+     1741 cacttaaaag acaatggatt acctataact gtagactcgg cttgggaaga gcttttgcgg
+     1801 cgtcgtatca aagatatgga caaatcgtat ctcgggttaa tgttgcatga tgctttatca
+     1861 aatgacaagc ttagatccgt ttctcatacg gttttcctcg atgatttgag cgtgtgtagc
+     1921 gctgaagaaa atttgagtaa tttcattttc cgctcgttta atgagtacaa tgaaaatcca
+     1981 ttgcgtagat ctccgtttct attgcttgag cgtataaagg gaaggcttga tagtgctata
+     2041 gcaaagactt tttctattcg cagcgctaga ggccggtcta tttatgatat attctcacag
+     2101 tcagaaattg gagtgctggc tcgtataaaa aaaagacgag tagcgttctc tgagaatcaa
+     2161 aattctttct ttgatggctt cccaacagga tacaaggata ttgatgataa aggagttatc
+     2221 ttagctaaag gtaatttcgt gattatagca gctagaccat ctatagggaa aacagcttta
+     2281 gctatagaca tggcgataaa tcttgcggtt actcaacagc gtagagttgg tttcctatct
+     2341 ctagaaatga gcgcaggtca aattgttgag cggattattg ctaatttaac aggaatatct
+     2401 ggtgaaaaat tacaaagagg ggatctctct aaagaagaat tattccgagt agaagaagct
+     2461 ggagaaacgg ttagagaatc acatttttat atctgcagtg atagtcagta taagcttaac
+     2521 ttaatcgcga atcagatccg gttgctgaga aaagaagatc gagtagacgt aatatttatc
+     2581 gattacttgc agttgatcaa ctcatcggtt ggagaaaatc gtcaaaatga aatagcagat
+     2641 atatctagaa ccttaagagg tttagcctca gagctaaaca ttcctatagt ttgtttatcc
+     2701 caactatcta gaaaagttga ggatagagca aataaagttc ccatgctttc agatttgcga
+     2761 gacagcggtc aaatagagca agacgcagat gtgattttgt ttatcaatag gaaggaatcg
+     2821 tcttctaatt gtgagataac tgttgggaaa aatagacatg gatcggtttt ctcttcggta
+     2881 ttacatttcg atccaaaaat tagtaaattc tccgctatta aaaaagtatg gtaaattata
+     2941 gtaactgcca cttcatcaaa agtcctatcc accttgaaaa tcagaagttt ggaagaagac
+     3001 ctggtcaatc tattaagata tctcccaaat tggctcaaaa tgggatggta gaagttatag
+     3061 gtcttgattt tctttcatct cattaccatg cattagcagc tatccaaaga ttactgaccg
+     3121 caacgaatta caaggggaac acaaaagggg ttgttttatc cagagaatca aatagttttc
+     3181 aatttgaagg atggatacca agaatccgtt ttacaaaaac tgaattctta gaggcttatg
+     3241 gagttaagcg gtataaaaca tccagaaata agtatgagtt tagtggaaaa gaagctgaaa
+     3301 ctgctttaga agccttatac catttaggac atcaaccgtt tttaatagtg gcaactagaa
+     3361 ctcgatggac taatggaaca caaatagtag accgttacca aactctttct ccgatcatta
+     3421 ggatttacga aggatgggaa ggtttaactg acgaagaaaa tatagatata gacttaacac
+     3481 cttttaattc accacctaca cggaaacata aagggttcgt tgtagagcca tgtcctatct
+     3541 tggtagatca aatagaatcc tactttgtaa tcaagcctgc aaatgtatac caagaaataa
+     3601 aaatgcgttt cccaaatgca tcaaagtatg cttacacatt tatcgactgg gtgattacag
+     3661 cagctgcgaa aaagagacga aaattaacta aggataattc ttggccagaa aacttgttat
+     3721 taaacgttaa cgttaaaagt cttgcatata ttttaaggat gaatcggtac atctgtacaa
+     3781 ggaactggaa aaaaatcgag ttagctatcg ataaatgtat agaaatcgcc attcagcttg
+     3841 gctggttatc tagaagaaaa cgcattgaat ttctggattc ttctaaactc tctaaaaaag
+     3901 aaattctata tctaaataaa gagcgctttg aagaaataac taagaaatct aaagaacaaa
+     3961 tggaacaatt agaacaagaa tctattaatt aatagcaagc ttgaaactaa aaacctaatt
+     4021 tatttaaagc tcaaaataaa aaagagtttt aaaatgggaa attctggttt ttatttgtat
+     4081 aacactgaaa actgcgtctt tgctgataat atcaaagttg ggcaaatgac agagccgctc
+     4141 aaggaccagc aaataatcct tgggacaaca tcaacacctg tcgcagccaa aatgacagct
+     4201 tctgatggaa tatctttaac agtctccaat aattcatcaa ccaatgcttc tattacaatt
+     4261 ggtttggatg cggaaaaagc ttaccagctt attctagaaa agttgggaga tcaaattctt
+     4321 gatggaattg ctgatactat tgttgatagt acagtccaag atattttaga caaaatcaaa
+     4381 acagaccctt ctctaggttt gttgaaagct tttaacaact ttccaatcac taataaaatt
+     4441 caatgcaacg ggttattcac tcccagtaac attgaaactt tattaggagg aactgaaata
+     4501 ggaaaattca cagtcacacc caaaagctct gggagcatgt tcttagtctc agcagatatt
+     4561 attgcatcaa gaatggaagg cggcgttgtt ctagctttgg tacgagaagg tgattctaag
+     4621 ccctgcgcga ttagttatgg atactcatca ggcattccta atttatgtag tctaagaacc
+     4681 agtattacta atacaggatt gactccgaca acgtattcat tacgtgtagg cggtttagaa
+     4741 agcggtgtgg tatgggttaa tgccctttct aatggcaatg atattttagg aataacaaat
+     4801 acttctaatg tatctttttt agaggtaata cctcaaacaa acgcttaaac aatttttatt
+     4861 ggatttttct tataggtttt atatttagag aaaacagttc gaattacggg gtttgttatg
+     4921 caaaataaaa gaaaagtgag ggacgatttt attaaaattg ttaaagatgt gaaaaaagat
+     4981 ttccccgaat tagacctaaa aatacgagta aacaaggaaa aagtaacttt cttaaattct
+     5041 cccttagaac tctaccataa aagtgtctca ctaattctag gactgcttca acaaatagaa
+     5101 aactctttag gattattccc agactctcct gttcttgaaa aattagagga taacagttta
+     5161 aagctaaaaa aggctttgat tatgcttatc ttgtctagaa aagacatgtt ttccaaggct
+     5221 gaatagacaa cttactctaa cgttggagtt gatttgcaca ccttagtttt ttgctctttt
+     5281 aagggaggaa ctggaaaaac aacactttct ctaaacgtgg gatgcaactt ggcccaattt
+     5341 ttagggaaaa aagtgttact tgctgaccta gacccgcaat ccaatttatc ttctggattg
+     5401 ggggctagtg tcagaagtga ccaaaaaggc ttgcacgaca tagtatacac atcaaacgat
+     5461 ttaaaatcaa tcatttgcga aacaaaaaaa gatagtgtgg acctaattcc tgcatcattt
+     5521 tcatccgaac agtttagaga attggatatt catagaggac ctagtaacaa cttaaagtta
+     5581 tttctgaatg agtactgcgc tcctttttat gacatctgca taatagacac tccacctagc
+     5641 ctaggagggt taacgaaaga agcttttgtt gcaggagaca aattaattgc ttgtttaact
+     5701 ccagaacctt tttctattct agggttacaa aagatacgtg aattcttaag ttcggtcgga
+     5761 aaacctgaag aagaacacat tcttggaata gctttgtctt tttgggatga tcgtaactcg
+     5821 actaaccaaa tgtatataga cattatcgag tctatttaca aaaacaagct tttttcaaca
+     5881 aaaattcgtc gagatatttc tctcagccgt tctcttctta aagaagattc tgtagctaat
+     5941 gtctatccaa attctagggc cgcagaagat attctgaagt taacgcatga aatagcaaat
+     6001 attttgcata tcgaatatga acgagattac tctcagagga caacgtgaac aaactaaaaa
+     6061 aagaagcgga tgtctttttt aaaaaaaatc aaactgccgc ttctctagat tttaagaaga
+     6121 cgcttccctc cattgaacta ttctcagcaa ctttgaattc tgaggaaagt cagagtttgg
+     6181 atcgattatt tttatcagag tcccaaaact attcggatga agaattttat caagaagaca
+     6241 tcctagcggt aaaactgctt actggtcaga taaaatccat acagaagcaa cacgtacttc
+     6301 ttttaggaga aaaaatctat aatgctagaa aaatcctgag taaggatcac ttctcctcaa
+     6361 caactttttc atcttggata gagttagttt ttagaactaa gtcttctgct tacaatgctc
+     6421 ttgcatatta cgagcttttt ataaacctcc ccaaccaaac tctacaaaaa gagtttcaat
+     6481 cgatccccta taaatccgca tatattttgg ccgctagaaa aggcgattta aaaaccaagg
+     6541 tcgatgtgat agggaaagta tgtggaatgt cgaactcatc ggcgataagg gtgttggatc
+     6601 aatttcttcc ttcatctaga aacaaagacg ttagagaaac gatagataag tctgattcag
+     6661 agaagaatcg ccaattatct gatttcttaa tagagatact tcgcatcatg tgttccggag
+     6721 tttctttgtc ctcctataac gaaaatcttc tacaacagct ttttgaactt tttaagcaaa
+     6781 agagctgatc ctccgtcagc tcatatatat atatctatta tatatatata tttagggatt
+     6841 tgatttcacg agagagattt gcaactcttg gtggtagact ttgcaactct tggtggtaga
+     6901 ctttgcaact cttggtggta gactttgcaa ctcttggtgg tagacttggt cataatggac
+     6961 ttttgttaaa aaatttatta aaatcttaga gctccgattt tgaatagctt tggttaagaa
+     7021 aatgggctcg atggctttcc ataaaagtag attgttttta acttttgggg acgcgtcgga
+     7081 aatttggtta tctactttat cttatctaac tagaaaaaat tatgcgtctg ggattaactt
+     7141 tcttgtttct ttagagattc tggatttatc ggaaaccttg ataaaggcta tttctcttga
+     7201 ccacagcgaa tctttgttta aaatcaagtc tctagatgtt tttaatggaa aagttgtttc
+     7261 agaggcatct aaacaggcta gagcggcatg ctacatatct ttcacaaagt ttttgtatag
+     7321 attgaccaag ggatatatta aacccgctat tccattgaaa gattttggaa acactacatt
+     7381 ttttaaaatc cgagacaaaa tcaaaacaga atcgatttct aagcaggaat ggacagtttt
+     7441 ttttgaagcg ctccggatag tgaattatag agactattta atcggtaaat tgattgtaca
+     7501 ag
+//
+