Finally, the new web services are working
[jabaws.git] / testsrc / compbio / data / sequence / SequenceUtilTester.java
1 /*\r
2  * Copyright (c) 2009 Peter Troshin JAva Bioinformatics Analysis Web Services\r
3  * (JABAWS) @version: 1.0 This library is free software; you can redistribute it\r
4  * and/or modify it under the terms of the Apache License version 2 as published\r
5  * by the Apache Software Foundation This library is distributed in the hope\r
6  * that it will be useful, but WITHOUT ANY WARRANTY; without even the implied\r
7  * warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the\r
8  * Apache License for more details. A copy of the license is in\r
9  * apache_license.txt. It is also available here:\r
10  * @see: http://www.apache.org/licenses/LICENSE-2.0.txt Any republication or\r
11  * derived work distributed in source code form must include this copyright and\r
12  * license notice.\r
13  */\r
14 package compbio.data.sequence;\r
15 \r
16 import static org.testng.AssertJUnit.assertEquals;\r
17 import static org.testng.AssertJUnit.assertFalse;\r
18 import static org.testng.AssertJUnit.assertNotNull;\r
19 import static org.testng.AssertJUnit.assertTrue;\r
20 import static org.testng.AssertJUnit.fail;\r
21 \r
22 import java.io.FileInputStream;\r
23 import java.io.FileNotFoundException;\r
24 import java.io.FileOutputStream;\r
25 import java.io.IOException;\r
26 import java.io.InputStream;\r
27 import java.util.HashMap;\r
28 import java.util.HashSet;\r
29 import java.util.List;\r
30 import java.util.Map;\r
31 import java.util.Set;\r
32 \r
33 import org.testng.annotations.Test;\r
34 \r
35 import compbio.metadata.AllTestSuit;\r
36 \r
37 public class SequenceUtilTester {\r
38 \r
39         @Test()\r
40         public void testisNonAmbNucleotideSequence() {\r
41                 String dnaseq = "atgatTGACGCTGCTGatgtcgtgagtgga";\r
42                 assertTrue(SequenceUtil.isNonAmbNucleotideSequence(dnaseq));\r
43                 String dirtyDnaseq = "atgAGTggt\taGGTgc\ncgcACTgc gACtcgcGAt cgA ";\r
44                 assertTrue(SequenceUtil.isNonAmbNucleotideSequence(dirtyDnaseq));\r
45                 String nonDna = "atgfctgatgcatgcatgatgctga";\r
46                 assertFalse(SequenceUtil.isNonAmbNucleotideSequence(nonDna));\r
47 \r
48                 nonDna = "atgc1tgatgcatgcatgatgctga";\r
49                 assertFalse(SequenceUtil.isNonAmbNucleotideSequence(nonDna));\r
50 \r
51                 nonDna = "ARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQL";\r
52                 assertFalse(SequenceUtil.isNonAmbNucleotideSequence(nonDna));\r
53                 // String ambDna = "AGTCRYMKSWHBVDN"; // see IUPAC Nucleotide Code\r
54                 assertFalse(SequenceUtil.isNonAmbNucleotideSequence(nonDna));\r
55 \r
56         }\r
57 \r
58         @Test()\r
59         public void testCleanSequence() {\r
60                 String dirtySeq = "atgAGTggt\taGGTgc\ncgcAC\rTgc gACtcgcGAt cgA ";\r
61                 assertEquals("atgAGTggtaGGTgccgcACTgcgACtcgcGAtcgA".toUpperCase(),\r
62                                 SequenceUtil.cleanSequence(dirtySeq));\r
63         }\r
64 \r
65         @Test()\r
66         public void testDeepCleanSequence() {\r
67                 String dirtySeq = "a!t?g.A;GTggt\ta12GGTgc\ncgc23AC\rTgc gAC<>.,?!|\\|/t@cg-c¬GA=_+(0){]}[:£$&^*\"t cgA ";\r
68                 assertEquals("atgAGTggtaGGTgccgcACTgcgACtcgcGAtcgA".toUpperCase(),\r
69                                 SequenceUtil.deepCleanSequence(dirtySeq));\r
70         }\r
71 \r
72         @Test()\r
73         public void testisProteinSequence() {\r
74                 String dirtySeq = "atgAGTggt\taGGTgc\ncgcAC\rTgc gACtcgcGAt cgA ";\r
75                 assertFalse(SequenceUtil.isProteinSequence(dirtySeq));\r
76                 String notaSeq = "atgc1tgatgcatgcatgatgctga";\r
77                 assertFalse(SequenceUtil.isProteinSequence(notaSeq));\r
78                 String AAseq = "ARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQL";\r
79                 assertTrue(SequenceUtil.isProteinSequence(AAseq));\r
80                 AAseq += "XU";\r
81                 assertFalse(SequenceUtil.isProteinSequence(AAseq));\r
82 \r
83         }\r
84 \r
85         @Test()\r
86         public void testReadWriteFasta() {\r
87 \r
88                 try {\r
89                         FileInputStream fio = new FileInputStream(\r
90                                         AllTestSuit.TEST_DATA_PATH + "TO1381.fasta");\r
91                         assertNotNull(fio);\r
92                         List<FastaSequence> fseqs = SequenceUtil.readFasta(fio);\r
93                         assertNotNull(fseqs);\r
94                         assertEquals(3, fseqs.size());\r
95                         assertEquals(3, fseqs.size());\r
96                         fio.close();\r
97                         FileOutputStream fou = new FileOutputStream(\r
98                                         AllTestSuit.TEST_DATA_PATH + "TO1381.fasta.written");\r
99                         SequenceUtil.writeFasta(fou, fseqs);\r
100                         fou.close();\r
101                         FileOutputStream fou20 = new FileOutputStream(\r
102                                         AllTestSuit.TEST_DATA_PATH + "TO1381.fasta20.written");\r
103                         SequenceUtil.writeFasta(fou20, fseqs, 21);\r
104                         fou20.close();\r
105 \r
106                 } catch (FileNotFoundException e) {\r
107                         e.printStackTrace();\r
108                         fail(e.getLocalizedMessage());\r
109                 } catch (IOException e) {\r
110                         e.printStackTrace();\r
111                         fail(e.getLocalizedMessage());\r
112                 }\r
113         }\r
114 \r
115         /**\r
116          * This test tests the loading of horizontally formatted Jronn output file\r
117          */\r
118         @Test\r
119         public void loadJronnFile() {\r
120 \r
121                 FileInputStream fio;\r
122                 try {\r
123                         fio = new FileInputStream(AllTestSuit.TEST_DATA_PATH + "jronn.out");\r
124                         Map<String, Score> aseqs = SequenceUtil.readJRonn(fio);\r
125                         assertNotNull(aseqs);\r
126                         assertEquals(aseqs.size(), 3);\r
127                         Score aseq = aseqs.get("Foobar");\r
128                         assertNotNull(aseq);\r
129                         assertNotNull(aseq.getScores());\r
130                         // System.out.println(aseq);\r
131                         assertEquals(aseq.getScores().size(), aseq.getScores().size());\r
132                         fio.close();\r
133                 } catch (FileNotFoundException e) {\r
134                         e.printStackTrace();\r
135                         fail(e.getLocalizedMessage());\r
136                 } catch (IOException e) {\r
137                         e.printStackTrace();\r
138                         fail(e.getLocalizedMessage());\r
139                 } catch (UnknownFileFormatException e) {\r
140                         e.printStackTrace();\r
141                         fail(e.getLocalizedMessage());\r
142                 }\r
143 \r
144         }\r
145 \r
146         enum Trial {\r
147                 one, two, three\r
148         };\r
149 \r
150         /**\r
151          * This test tests the loading of horizontally formatted Jronn output file\r
152          * \r
153          * First seq\r
154          * \r
155          * M 0.86010 0.88512 0.37094\r
156          * \r
157          * T 0.79983 0.85864 0.44331\r
158          * \r
159          */\r
160         @SuppressWarnings("unchecked")\r
161         @Test\r
162         public void testReadDisemblResults() {\r
163 \r
164                 FileInputStream fio;\r
165                 try {\r
166                         fio = new FileInputStream(AllTestSuit.TEST_DATA_PATH\r
167                                         + "disembl.out");\r
168                         Map<String, Set<Score>> aseqs = SequenceUtil.readDisembl(fio);\r
169                         assertNotNull(aseqs);\r
170                         assertEquals(aseqs.size(), 3);\r
171                         // System.out.println(aseqs);\r
172                         for (String fs : aseqs.keySet()) {\r
173                                 assertTrue(" Foobar_dundeefriends Foobar dundeefriends "\r
174                                                 .contains(fs));\r
175                                 Set<Score> scores = aseqs.get(fs);\r
176                                 assertEquals(scores.size(), 3);\r
177                         }\r
178                         fio.close();\r
179                 } catch (FileNotFoundException e) {\r
180                         e.printStackTrace();\r
181                         fail(e.getLocalizedMessage());\r
182                 } catch (IOException e) {\r
183                         e.printStackTrace();\r
184                         fail(e.getLocalizedMessage());\r
185                 } catch (UnknownFileFormatException e) {\r
186                         e.printStackTrace();\r
187                         fail(e.getLocalizedMessage());\r
188                 }\r
189         }\r
190 \r
191         /**\r
192          * This test tests the loading of horizontally formatted Jronn output file\r
193          * \r
194          * First sequence:\r
195          * \r
196          * >Foobar_dundeefriends\r
197          * \r
198          * # GlobDoms 2-358, 373-568\r
199          * \r
200          * # Disorder 1-5, 206-218, 243-250, 288-300, 313-324, 359-372, 475-481\r
201          * \r
202          * # RESIDUE DYDX RAW SMOOTHED\r
203          * \r
204          * M 0.0044 -0.2259 -0.2259\r
205          * \r
206          * T -0.1308 -0.2170 -0.2170\r
207          * \r
208          * ............\r
209          * \r
210          * > Second sequence\r
211          */\r
212         @SuppressWarnings("unchecked")\r
213         @Test\r
214         public void testReadGlobPlotResults() {\r
215 \r
216                 FileInputStream fio;\r
217                 try {\r
218                         fio = new FileInputStream(AllTestSuit.TEST_DATA_PATH\r
219                                         + "globplot.out");\r
220                         HashMap<String, Set<Score>> aseqs = SequenceUtil.readGlobPlot(fio);\r
221                         assertNotNull(aseqs);\r
222                         assertEquals(aseqs.size(), 3);\r
223 \r
224                         String fsdf = null;\r
225                         Set<Score> scores = null;\r
226                         for (String fs : aseqs.keySet()) {\r
227                                 if ("Foobar_dundeefriends".contains(fs)) {\r
228                                         fsdf = fs;\r
229                                         scores = aseqs.get(fs);\r
230                                 }\r
231                                 assertEquals(scores.size(), 5);\r
232                         }\r
233                         for (Score score : scores) {\r
234 \r
235                                 if (score.getMethod()\r
236                                                 .equals(GlobProtResult.Disorder.toString())) {\r
237                                         assertEquals(score.getRanges().size(), 7);\r
238                                         assertTrue(score.getScores().isEmpty());\r
239                                 }\r
240                                 if (GlobProtResult.valueOf(score.getMethod()) == GlobProtResult.Dydx) {\r
241                                         assertFalse(score.getScores().isEmpty());\r
242                                         assertTrue(score.getRanges().isEmpty());\r
243                                 }\r
244                         }\r
245                         fio.close();\r
246                 } catch (FileNotFoundException e) {\r
247                         e.printStackTrace();\r
248                         fail(e.getLocalizedMessage());\r
249                 } catch (IOException e) {\r
250                         e.printStackTrace();\r
251                         fail(e.getLocalizedMessage());\r
252                 } catch (UnknownFileFormatException e) {\r
253                         e.printStackTrace();\r
254                         fail(e.getLocalizedMessage());\r
255                 }\r
256         }\r
257 \r
258         @Test\r
259         public void testReadAAConResults() {\r
260                 try {\r
261                         InputStream inStream = new FileInputStream(\r
262                                         AllTestSuit.TEST_DATA_PATH + "aacon_results.txt");\r
263                         HashSet<Score> result = SequenceUtil.readAAConResults(inStream);\r
264                         inStream.close();\r
265                         assertNotNull(result);\r
266                         assertEquals(result.size(), 18);\r
267 \r
268                         inStream = new FileInputStream(AllTestSuit.TEST_DATA_PATH\r
269                                         + "aacon_result_single.out");\r
270                         result = SequenceUtil.readAAConResults(inStream);\r
271                         inStream.close();\r
272                         assertNotNull(result);\r
273                         assertEquals(result.size(), 1);\r
274                         assertEquals(result.iterator().next().getScores().size(), 568);\r
275                 } catch (IOException e) {\r
276                         e.printStackTrace();\r
277                         fail(e.getMessage());\r
278                 }\r
279         }\r
280 }\r