webservices/compbio/ws/client/WSTester.java

   1 /* Copyright (c) 2011 Peter Troshin\r
   2  *  \r
   3  *  JAva Bioinformatics Analysis Web Services (JABAWS) @version: 2.0     \r
   4  * \r
   5  *  This library is free software; you can redistribute it and/or modify it under the terms of the\r
   6  *  Apache License version 2 as published by the Apache Software Foundation\r
   7  * \r
   8  *  This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without\r
   9  *  even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the Apache \r
  10  *  License for more details.\r
  11  * \r
  12  *  A copy of the license is in apache_license.txt. It is also available here:\r
  13  * @see: http://www.apache.org/licenses/LICENSE-2.0.txt\r
  14  * \r
  15  * Any republication or derived work distributed in source code form\r
  16  * must include this copyright and license notice.\r
  17  */\r
  18 \r
  19 package compbio.ws.client;\r
  20 \r
  21 import static compbio.ws.client.Constraints.hostkey;\r
  22 import static compbio.ws.client.Constraints.pseparator;\r
  23 import static compbio.ws.client.Constraints.servicekey;\r
  24 \r
  25 import java.io.ByteArrayInputStream;\r
  26 import java.io.Closeable;\r
  27 import java.io.IOException;\r
  28 import java.io.PrintWriter;\r
  29 import java.net.ConnectException;\r
  30 import java.util.Arrays;\r
  31 import java.util.List;\r
  32 \r
  33 import javax.xml.ws.WebServiceException;\r
  34 \r
  35 import compbio.data.msa.JABAService;\r
  36 import compbio.data.msa.Metadata;\r
  37 import compbio.data.msa.MsaWS;\r
  38 import compbio.data.msa.SequenceAnnotation;\r
  39 import compbio.data.sequence.Alignment;\r
  40 import compbio.data.sequence.FastaSequence;\r
  41 import compbio.data.sequence.ScoreManager;\r
  42 import compbio.data.sequence.SequenceUtil;\r
  43 import compbio.metadata.JobStatus;\r
  44 import compbio.metadata.Limit;\r
  45 import compbio.metadata.LimitsManager;\r
  46 import compbio.metadata.Option;\r
  47 import compbio.metadata.Preset;\r
  48 import compbio.metadata.PresetManager;\r
  49 import compbio.metadata.RunnerConfig;\r
  50 import compbio.metadata.UnsupportedRuntimeException;\r
  51 import compbio.util.FileUtil;\r
  52 import compbio.util.Util;\r
  53 \r
  54 /**\r
  55  * Class for testing web services\r
  56  * \r
  57  * @author pvtroshin\r
  58  * \r
  59  * @version 1.0 February 2010\r
  60  */\r
  61 public class WSTester {\r
  62 \r
  63         /**\r
  64          * Sequences to be used as input for all WS\r
  65          */\r
  66         public static final String fastaInput = ">Foo\n"\r
  67                         + "MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAV"\r
  68                         + "\n>Bar\n"\r
  69                         + "ASDAAPEHPGIALWLHALEDAGQAEAAAAYTRAHQLLPEEPYITAQLLNAVA\n";\r
  70 \r
  71         public static final String fastaAlignment = ">Foo\n"\r
  72                         + "MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAV--------\n"\r
  73                         + ">Bar\n"\r
  74                         + "ASDAAPEH------------PGIALWLHALE-DAGQAEAAA---AYTRAHQLLPEEPYITAQLLNAVA\n"\r
  75                         + "";\r
  76 \r
  77         static final List<FastaSequence> seqs = loadSeqs();\r
  78 \r
  79         private static final String FAILED = "FAILED";\r
  80         private static final String OK = "OK";\r
  81 \r
  82         private static final String UNSUPPORTED = "UNSUPPORTED";\r
  83 \r
  84         /**\r
  85          * Converting input to a form accepted by WS\r
  86          * \r
  87          * @return List of FastaSequence records\r
  88          */\r
  89         private static List<FastaSequence> loadSeqs() {\r
  90                 try {\r
  91                         return SequenceUtil.readFasta(new ByteArrayInputStream(fastaInput\r
  92                                         .getBytes()));\r
  93                 } catch (IOException ignored) {\r
  94                         // Should not happen as a source is not a external stream\r
  95                         ignored.printStackTrace();\r
  96                 }\r
  97                 return null;\r
  98         }\r
  99 \r
 100         /**\r
 101          * Converting input to a form accepted by WS\r
 102          * \r
 103          * @return List of FastaSequence records\r
 104          */\r
 105         private static List<FastaSequence> loadAlignment() {\r
 106                 try {\r
 107                         return SequenceUtil.readFasta(new ByteArrayInputStream(\r
 108                                         fastaAlignment.getBytes()));\r
 109                 } catch (IOException ignored) {\r
 110                         // Should not happen as a source is not a external stream\r
 111                         ignored.printStackTrace();\r
 112                 }\r
 113                 return null;\r
 114         }\r
 115 \r
 116         private final PrintWriter writer;\r
 117         private final String hostname;\r
 118 \r
 119         /**\r
 120          * Construct an instance of JABAWS tester\r
 121          * \r
 122          * @param hostname\r
 123          *            - fully qualified host and context name of JABAWS e.g.\r
 124          *            http://nanna.cluster.lifesci.dundee.ac.uk:8080/jaba\r
 125          * @param writer\r
 126          *            a PrintWriter instance to writer test log to.\r
 127          */\r
 128         public WSTester(String hostname, PrintWriter writer) {\r
 129                 if (Util.isEmpty(hostname)) {\r
 130                         throw new NullPointerException("Hostname must be provided!");\r
 131                 }\r
 132                 this.hostname = hostname;\r
 133                 this.writer = writer;\r
 134         }\r
 135 \r
 136         /**\r
 137          * Prints usage\r
 138          */\r
 139         static void printUsage() {\r
 140                 System.out.println("Usage: <Class or Jar file name> " + hostkey\r
 141                                 + pseparator + "host_and_context " + "<" + servicekey\r
 142                                 + pseparator + "serviceName>");\r
 143                 System.out.println();\r
 144                 System.out.println(hostkey\r
 145                                                 + pseparator\r
 146                                                 + "<host_and_context> - a full URL to the JABAWS web server including context path e.g. http://10.31.1.159:8080/ws");\r
 147                 System.out.println(servicekey\r
 148                                                 + pseparator\r
 149                                                 + "<ServiceName> - optional if unspecified all services are tested otherwise one of "\r
 150                                                 + Arrays.toString(Services.values()));\r
 151                 System.out.println();\r
 152 \r
 153         }\r
 154 \r
 155         /**\r
 156          * Calls alignment with preset\r
 157          * \r
 158          * @param <T>\r
 159          * @param msaws\r
 160          * @param presets\r
 161          *            list of the Preset\r
 162          * @throws UnsupportedRuntimeException\r
 163          */\r
 164         private <T> boolean presetAlign(MsaWS<T> msaws, List<Preset<T>> presets)\r
 165                         throws UnsupportedRuntimeException {\r
 166                 boolean succeed = false;\r
 167                 for (Preset<T> preset : presets) {\r
 168                         writer.print("Aligning with preset '" + preset.getName() + "'... ");\r
 169                         Alignment al = null;\r
 170                         try {\r
 171                                 String taskId = msaws.presetAlign(seqs, preset);\r
 172                                 al = msaws.getResult(taskId);\r
 173                                 if (al != null) {\r
 174                                         writer.println(OK);\r
 175                                 }\r
 176                                 succeed = true;\r
 177                         } catch (Exception e) {\r
 178                                 if (e instanceof UnsupportedRuntimeException) {\r
 179                                         // If executable is not supported than none of the presets\r
 180                                         // are\r
 181                                         // going to work\r
 182                                         throw (UnsupportedRuntimeException) e;\r
 183                                 } else {\r
 184                                         reportException(e);\r
 185                                 }\r
 186                                 continue;\r
 187                         }\r
 188                 }\r
 189                 return succeed;\r
 190         }\r
 191 \r
 192         private <T> boolean testMsaWS(MsaWS<T> msaws) throws Exception {\r
 193                 assert msaws != null;\r
 194 \r
 195                 boolean succeed = testDefaultAlignment(msaws);\r
 196                 // If exception above is thrown than the tests below is not run\r
 197 \r
 198                 PresetManager<T> pmanager = msaws.getPresets();\r
 199                 if (pmanager != null && pmanager.getPresets().size() > 0) {\r
 200                         writer.println("Testing alignment with presets:");\r
 201                         List<Preset<T>> plist = pmanager.getPresets();\r
 202                         succeed = !succeed ? presetAlign(msaws, plist) : succeed;\r
 203                 }\r
 204                 testMetadata(msaws);\r
 205                 return succeed;\r
 206         }\r
 207         /**\r
 208          * Call most of web services functions and check the output\r
 209          * \r
 210          * @param <T>\r
 211          *            web service type\r
 212          * @param msaws\r
 213          * @throws UnsupportedRuntimeException\r
 214          *             is thrown if the connection to a web service was made, but\r
 215          *             the web service is not functional. e.g. when native\r
 216          *             executable does not exists for a server platform\r
 217          */\r
 218         @SuppressWarnings("unchecked")\r
 219         private <T> boolean checkService(JABAService wservice, Services service) {\r
 220                 try {\r
 221                         if (wservice == null) {\r
 222                                 throw new NullPointerException("JABAService instance must be provided!");\r
 223                         }\r
 224 \r
 225                         if (wservice instanceof MsaWS) {\r
 226                                 return testMsaWS((MsaWS<T>) wservice);\r
 227                         } else if (wservice instanceof SequenceAnnotation) {\r
 228                                 return testSequenceAnnotationWS(\r
 229                                                 (SequenceAnnotation<T>) wservice, service);\r
 230                         } else {\r
 231                                 throw new UnsupportedOperationException("The service: " + wservice.getClass() + " is not supported! ");\r
 232                         }\r
 233                 } catch (Exception e) {\r
 234                         reportException(e);\r
 235                         return false;\r
 236                 }\r
 237         }\r
 238 \r
 239         private <T> boolean testSequenceAnnotationWS(\r
 240                         SequenceAnnotation<T> wservice, Services service) throws Exception {\r
 241                 writer.print("Calling analyse.........");\r
 242 \r
 243                 List<FastaSequence> input = loadSeqs();\r
 244                 if (service == Services.AAConWS) {\r
 245                         input = loadAlignment();\r
 246                 }\r
 247                 boolean success = testDefaultAnalyse(input, wservice, null, null);\r
 248 \r
 249                 PresetManager<T> presetman = wservice.getPresets();\r
 250                 if (presetman != null) {\r
 251                         List<Preset<T>> presets = presetman.getPresets();\r
 252                         if (presets != null && !presets.isEmpty()) {\r
 253                                 Preset<T> preset = presets.get(0);\r
 254                                 writer.print("Calling analyse with Preset.........");\r
 255                                 success = testDefaultAnalyse(input, wservice, preset, null);\r
 256                         }\r
 257                 }\r
 258                 testMetadata(wservice);\r
 259                 return success;\r
 260         }\r
 261 \r
 262         private <T> boolean testDefaultAnalyse(List<FastaSequence> fastalist,\r
 263                         SequenceAnnotation<T> wsproxy, Preset<T> preset,\r
 264                         List<Option<T>> customOptions) throws Exception {\r
 265 \r
 266                 ScoreManager scores = null;\r
 267 \r
 268                 String jobId = null;\r
 269                 if (customOptions != null) {\r
 270                         jobId = wsproxy.customAnalize(fastalist, customOptions);\r
 271                 } else if (preset != null) {\r
 272                         jobId = wsproxy.presetAnalize(fastalist, preset);\r
 273                 } else {\r
 274                         jobId = wsproxy.analize(fastalist);\r
 275                 }\r
 276                 Thread.sleep(1000);\r
 277                 scores = wsproxy.getAnnotation(jobId);\r
 278                 if (scores != null) {\r
 279                         writer.println(OK);\r
 280                 }\r
 281 \r
 282                 return scores != null;\r
 283         }\r
 284 \r
 285         private void reportException(Exception e) {\r
 286                 writer.println(FAILED);\r
 287                 writer.println("Exception while waiting for results. "\r
 288                                 + "Exception details are below:");\r
 289                 writer.println(e.getLocalizedMessage());\r
 290                 e.printStackTrace(writer);\r
 291         }\r
 292 \r
 293         private <T> void testMetadata(Metadata<T> msaws)\r
 294                         throws UnsupportedRuntimeException {\r
 295 \r
 296                 writer.print("Querying presets...");\r
 297                 PresetManager<T> pmanager = msaws.getPresets();\r
 298                 if (pmanager != null && pmanager.getPresets().size() > 0) {\r
 299                         writer.println(OK);\r
 300                 } else {\r
 301                         writer.println(UNSUPPORTED);\r
 302                 }\r
 303 \r
 304                 writer.print("Querying Parameters...");\r
 305                 RunnerConfig<T> options = msaws.getRunnerOptions();\r
 306                 if (options != null && options.getArguments().size() > 0) {\r
 307                         writer.println(OK);\r
 308                 } else {\r
 309                         writer.println(UNSUPPORTED);\r
 310                 }\r
 311 \r
 312                 writer.print("Querying Limits...");\r
 313                 LimitsManager<T> limits = msaws.getLimits();\r
 314                 if (limits != null && limits.getLimits().size() > 0) {\r
 315                         writer.println(OK);\r
 316                         // writer.println("Limits details: \n" + limits.toString());\r
 317                 } else {\r
 318                         writer.println(UNSUPPORTED);\r
 319                 }\r
 320 \r
 321                 writer.print("Querying Local Engine Limits...");\r
 322                 Limit<T> localLimit = msaws\r
 323                                 .getLimit(PresetManager.LOCAL_ENGINE_LIMIT_PRESET);\r
 324                 if (localLimit != null) {\r
 325                         writer.println(OK);\r
 326                 } else {\r
 327                         writer.println(UNSUPPORTED);\r
 328                 }\r
 329         }\r
 330 \r
 331         /**\r
 332          * Align using default settings\r
 333          * \r
 334          * @param <T>\r
 335          * @param msaws\r
 336          * @throws UnsupportedRuntimeException\r
 337          */\r
 338         private <T> boolean testDefaultAlignment(MsaWS<T> msaws) throws Exception {\r
 339                 writer.print("Testing alignment with default parameters:");\r
 340                 Alignment al = null;\r
 341                 boolean succeed = false;\r
 342 \r
 343                 String taskId = msaws.align(seqs);\r
 344                 writer.print("\nQuerying job status...");\r
 345                 JobStatus status = msaws.getJobStatus(taskId);\r
 346                 while (status != JobStatus.FINISHED) {\r
 347                         Thread.sleep(1000);\r
 348                         status = msaws.getJobStatus(taskId);\r
 349                 }\r
 350                 writer.println(OK);\r
 351                 writer.print("Retrieving results...");\r
 352                 al = msaws.getResult(taskId);\r
 353                 succeed = true;\r
 354                 if (al != null) {\r
 355                         writer.println(OK);\r
 356                 }\r
 357                 return succeed;\r
 358         }\r
 359         /**\r
 360          * Test JWS2 web services\r
 361          * \r
 362          * @param <T>\r
 363          *            web service type\r
 364          * @param args\r
 365          *            -h=<Your web application server host name, port and JWS2\r
 366          *            context path>\r
 367          * \r
 368          *            -s=<ServiceName> which is optional. If service name is not\r
 369          *            provided then all known JWS2 web services are tested\r
 370          * @throws IOException\r
 371          */\r
 372         public static <T> void main(String[] args) throws IOException {\r
 373 \r
 374                 if (args == null || args.length < 1) {\r
 375                         WSTester.printUsage();\r
 376                         System.exit(0);\r
 377                 }\r
 378                 String host = CmdHelper.getHost(args);\r
 379                 String serviceName = CmdHelper.getServiceName(args);\r
 380                 if (!Jws2Client.validURL(host)) {\r
 381                         System.err.println("<host_and_context> parameter is not provided or is incorrect!");\r
 382                         System.exit(1);\r
 383                 }\r
 384                 WSTester tester = new WSTester(host, new PrintWriter(System.out, true));\r
 385 \r
 386                 if (serviceName != null) {\r
 387                         Services service = Services.getService(serviceName);\r
 388                         if (service == null) {\r
 389                                 tester.writer.println("Service '" + serviceName + "' is not supported. Valid values are: "\r
 390                                                 + Arrays.toString(Services.values()));\r
 391                                 tester.writer.println();\r
 392                                 printUsage();\r
 393                                 System.exit(1);\r
 394                         }\r
 395                         tester.checkService(service);\r
 396                         System.exit(0);\r
 397                 }\r
 398 \r
 399                 tester.writer.println("<ServiceName> is not provided checking all known services...");\r
 400 \r
 401                 for (Services serv : Services.values()) {\r
 402                         tester.writer.println();\r
 403                         tester.checkService(serv);\r
 404                 }\r
 405 \r
 406         }\r
 407 \r
 408         /**\r
 409          * Test JABA web service\r
 410          * \r
 411          * @param service\r
 412          *            the service to test\r
 413          * @return true if the service works as expected, false otherwise\r
 414          * @throws WebServiceException\r
 415          * @throws ConnectException\r
 416          */\r
 417         public boolean checkService(Services service) throws ConnectException,\r
 418                         WebServiceException {\r
 419                 JABAService ws = Jws2Client.connect(hostname, service);\r
 420                 if (ws == null) {\r
 421                         String line = "Cannot estabilish the connection to host " + hostname + " with service ";\r
 422                         writer.println(line + service.toString());\r
 423                         return false;\r
 424                 }\r
 425                 boolean succeed = false;\r
 426                 try {\r
 427                         writer.println("Checking service " + service.toString());\r
 428                         succeed = checkService(ws, service);\r
 429                 } finally {\r
 430                         FileUtil.closeSilently(((Closeable) ws));\r
 431                 }\r
 432                 reportResults(service, succeed);\r
 433                 return succeed;\r
 434         }\r
 435 \r
 436         private void reportResults(Services serv, boolean succeed) {\r
 437                 if (succeed) {\r
 438                         writer.println("Check is completed. The Service " + serv + " IS WORKING\n");\r
 439                 } else {\r
 440                         writer.println("Check is aborted. The Service " + serv + " HAS SOME PROBLEMS\n");\r
 441                 }\r
 442         }\r
 443 }\r