1 <?xml version="1.0" encoding="UTF-8"?>
\r
2 <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd">
\r
3 <html xmlns="http://www.w3.org/1999/xhtml">
\r
6 <meta name="Last-modified" content="Fri, 28 Jun 2013 12:00:00 GMT"/>
\r
7 <title>Java Bioinformatics Analyses Web Services (JABAWS): Manual</title>
\r
8 <link href="ws.css" rel="stylesheet" type="text/css" media="screen, projection, handheld, tv" />
\r
9 <link href="print.css" rel="stylesheet" type="text/css" media="print" />
\r
10 <link href='http://fonts.googleapis.com/css?family=Yanone+Kaffeesatz:700' rel='stylesheet' type='text/css' />
\r
11 <script type="text/javascript" src="prototype-1.6.0.3.js"></script>
\r
20 <td style="width:158px;"><a href="http://www.dundee.ac.uk"><img src="images/uod_lt_long.gif" width="158" height="90" alt="University of Dundee" class="logo" title="University of Dundee" longdesc="http://www.dundee.ac.uk"/></a></td>
\r
21 <td class="bg"><img src="images/jabaws21.png" width="256" height="67" alt="JABAWS-2.1" title="Java Bioinformatics Analysis Web Services version 2.1"/></td>
\r
22 <td class="bg"><img src="images/banner_right.png" alt="Disorder" width="200" height="80"/></td>
\r
31 <div id="supermenu">
\r
32 <a class="newa" href="index.html">Home</a>
\r
33 <a class="newa" href="quick_start.html">Getting Started</a>
\r
34 <a class="newpressed" href="man_about.html">Manual</a>
\r
37 <a class="newa" href="man_about.html">About</a>
\r
38 <a class="newa" href="man_servervm.html" title="JABAWS Server as Virtual Appliance">Server VA</a>
\r
39 <a class="newa" href="man_awscloud.html" title="JABAWS Server in the Amazon EC2 Cloud">Server in the Cloud</a>
\r
40 <a class="newa" href="man_serverwar.html" title="JABAWS Server as Web Application aRchive">Server WAR</a>
\r
41 <a class="newa" href="man_configuration.html" >Configure JABAWS</a>
\r
42 <a class="newa" href="man_client.html" title="JABAWS Command Line Client">Command Client</a>
\r
43 <a class="newa" href="man_stats.html" title="JABAWS Usage Statistics">Usage Statistics</a>
\r
44 <a class="newpressed" href="man_dev.html" title="Accessing JABAWS from your program">Accessing JABAWS</a>
\r
45 <a class="newa" href="man_server_dev.html" >Develop JABAWS</a>
\r
52 <h2 id="headtitle">JABAWS MANUAL</h2>
\r
54 <h2>Using JABAWS From Your Program </h2>
\r
56 <li><a href="#wsfunctions">Web services functions overview </a></li>
\r
57 <li><a href="#templatestr">The template client structure</a></li>
\r
58 <li><a href="#connectto">Connecting to JABAWS</a></li>
\r
59 <li><a href="#validnames">Valid JABAWS service names and WSDL files</a></li>
\r
60 <li><a href="#defalign">Aligning sequences</a></li>
\r
61 <li><a href="#checkresults">Checking the status of the calculation </a></li>
\r
62 <li><a href="#presetalign">Aligning with presets</a></li>
\r
63 <li><a href="#customalign">Aligning with custom parameters</a></li>
\r
64 <li><a href="#writingaltofile">Writing alignments to a file</a></li>
\r
65 <li><a href="#compex">A complete client example </a></li>
\r
66 <li><a href="#buildart">Building web services artifacts</a></li>
\r
68 <h3><a name="wsfunctions" id="wsfunctions"></a>Web services functions overview </h3>
\r
69 <p>All JABA multiple sequence alignment web services comply to the same interface, thus the function described below are available from all the services. </p>
\r
70 <p><strong>Functions for initiating the alignment </strong><span class="code"> String id = align(List<FastaSequence> list)<br />
\r
71 String id = customAlign(List<FastaSequence> sequenceList, List<Option> optionList)<br />
\r
72 String id = presetAlign(List<FastaSequence> sequenceList, Preset preset)</span></p>
\r
73 <p><strong>Functions pertaining to job monitoring and control</strong><br />
\r
74 <span class="code">JobStatus status = getJobStatus(String id)<br />
\r
75 Alignment al = getResult(String id)<br />
\r
76 boolean cancelled = cancelJob(String id)<br />
\r
77 ChunkHolder chunk = pullExecStatistics(String id, long marker)</span></p>
\r
78 <p><strong>Functions relating to service features discovery</strong><br />
\r
79 <span class="code">RunnerConfig rc = getRunnerOptions()<br />
\r
80 Limit limit = getLimit(String name)<br />
\r
81 LimitsManager lm = getLimits()<br />
\r
82 PresetManager pm = getPresets()</span></p>
\r
83 <p>Please refer to a <a href="dm_javadoc/compbio/data/msa/MsaWS.html">data model javadoc</a> for a detailed description of each methods. </p>
\r
84 <h3><a name="templatestr" id="templatestr"></a>Structure of the template command line client</h3>
\r
85 <table width="100%" border="1">
\r
87 <td style="width:19%"><strong>Packages</strong></td>
\r
88 <td style="width:81%"><strong>Classes and Interfaces </strong></td>
\r
91 <td>compbio.data.msa </td>
\r
92 <td>MsaWS the interface for all multiple sequence alignment web services </td>
\r
95 <td>compbio.data.sequence</td>
\r
96 <td>JABAWS data types </td>
\r
99 <td>compbio.metadata</td>
\r
100 <td>JABAWS meta data types </td>
\r
103 <td>compbio.ws.client</td>
\r
104 <td>JABAWS command line client </td>
\r
107 <p>Additional utility libraries that this client depend upon is the compbio-util-1.3.jar and compbio-annotation-1.0.jar. <br />
\r
108 Please refer to a <a href="dm_javadoc/index.html">data model javadoc</a> for a detailed description of each class and its methods. </p>
\r
111 <h3><a name="connectto" id="connectto"></a>Connecting to JABAWS</h3>
\r
112 <p class="attention">
\r
113 For a complete working example of JABAWS command line client please see compbio.ws.client.Jws2Client class. JABAWS command line client
\r
114 source code is available from the <a href="http://gjb-www-1.cluster.lifesci.dundee.ac.uk:8086/jabaws-dev">download page</a>. Please note that for now all
\r
115 the examples are in Java, other languages will follow if there is sufficient demand. </p>
\r
117 Download a binary JABAWS client. Add the client to the class path. The following code excerpt will connect your program to Clustal
\r
118 web service deployed in the University of Dundee. </p>
\r
119 <p class="code"> import java.net.URL;<br />
\r
120 import javax.xml.namespace.QName;<br />
\r
121 import javax.xml.ws.Service;<br />
\r
122 ...............<br />
\r
123 1) String qualifiedName = "http://msa.data.compbio/01/01/2010/";<br />
\r
124 2) URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl");<br />
\r
125 3) QName qname = new QName(, "ClustalWS");<br />
\r
126 4) Service serv = Service.create(url, qname);<br />
\r
127 5) MsaWS msaws = serv.getPort(new QName(qualifiedName, "ClustalWSPort"),
\r
131 Line 1 makes a qualified name for JABA web services.<br />
\r
132 Line 2 constructs the URL to the web services WSDL. <br />
\r
133 Line 3 makes a qualified name instance for Clustal JABA web service. <br />
\r
134 Line 4 creates a service instance.<br />
\r
135 Line 5 makes a connection to the server.
\r
138 A more generic connection method would look like this
\r
140 <p class="code"> import java.net.URL;<br />
\r
141 import javax.xml.namespace.QName;<br />
\r
142 import javax.xml.ws.Service;<br />
\r
143 import compbio.ws.client.Services<br />
\r
144 .............. <br />
\r
145 String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/";<br />
\r
146 String host = "http://www.compbio.dundee.ac.uk/jabaws";<br />
\r
147 // In real life the service name can come from args<br />
\r
148 Services clustal = Services.ClustalWS;<br />
\r
149 URL url = new URL(host + "/" + clustal.toString() + "?wsdl");<br />
\r
150 QName qname = new QName(qualifiedServiceName, clustal.toString());<br />
\r
151 Service serv = Service.create(url, qname);<br />
\r
152 MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, clustal<br />
\r
153 + "Port"), MsaWS.class);
\r
156 Where Services is enumeration of JABAWS web services. All JABAWS multiple sequence alignment methods confirm to
\r
157 MsaWS specification, thus from the caller point of view all JABAWS web services can be represented by MsaWS
\r
158 interface. The full documentation of MsaWS functions is available from the <a href="dm_javadoc/compbio/data/msa/MsaWS.html">javadoc</a>.
\r
162 <h3><a name="validnames" id="validnames"></a>Valid JABAWS service names and WSDL files </h3>
\r
163 <p>Multiple sequence alignment services </p>
\r
164 <ul><li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalOWS?wsdl">ClustalOWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalOWS?wsdl) </li>
\r
165 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalWS?wsdl">ClustalWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalWS?wsdl) </li>
\r
166 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/MuscleWS?wsdl">MuscleWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/MuscleWS?wsdl) </li>
\r
167 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/MafftWS?wsdl">MafftWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/MafftWS?wsdl) </li>
\r
168 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/TcoffeeWS?wsdl">TcoffeeWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/TcoffeeWS?wsdl) </li>
\r
169 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/ProbconsWS?wsdl">ProbconsWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/ProbconsWS?wsdl) </li>
\r
170 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/MSAprobsWS?wsdl">MSAprobsWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/MSAprobsWS?wsdl) </li>
\r
171 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/GLprobsWS?wsdl">GLprobsWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/GLprobsWS?wsdl) </li>
\r
173 <p>Protein disorder prediction services </p>
\r
175 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/IUPredWS?wsdl">IUPredWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/IUPredWS?wsdl) </li>
\r
176 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/GlobPlotWS?wsdl">GlobPlotWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/GlobPlotWS?wsdl) </li>
\r
177 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/DisemblWS?wsdl">DisemblWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/DisemblWS?wsdl) </li>
\r
178 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/JronnWS?wsdl">JronnWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/JronnWS?wsdl) </li>
\r
180 <p>Amino acid conservation service</p>
\r
182 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/AAConWS?wsdl">AAConWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/AAConWS?wsdl) </li>
\r
184 <p>Protein and RNA Secondary Structure Prediction</p>
\r
186 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/JpredWS?wsdl">JpredWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/JpredWS?wsdl) </li>
\r
187 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/RNAalifoldWS?wsdl">RNAalifoldWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/RNAalifoldWS?wsdl) </li>
\r
190 Please replace <span class="hightlight">http://www.compbio.dundee.ac.uk/</span> with your JABAWS instance host name, and
\r
191 <span class="hightlight">jabaws</span> with your JABAWS context name to access your local version of JABAWS web services.
\r
192 For example <span class="hightlight">http://localhost:8080/jabaws</span> would be a valid URL for the default Apache-Tomcat
\r
193 installation and jabaws.war file deployment. </p>
\r
196 <h3><a name="defalign" id="defalign"></a>Aligning sequences </h3>
\r
198 Given that <span class="hightlight">msaws</span> is web service proxy, created as described in "Connecting to JABAWS"
\r
199 section, the actual alignment can be obtained as follows: </p>
\r
200 <p class="code">1) List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));<br />
\r
201 2) String jobId = msaws.align(fastalist); <br />
\r
202 3) Alignment alignment = msaws.getResult(jobId);</p>
\r
203 <p>Line one loads FASTA sequence from the file.<br />
\r
204 Line two submits them to web service represented by msaws proxy. <br />
\r
205 Line three retrieves the alignment from a web service. This line will block the execution until the result is available.
\r
206 Use this with caution. In general, you should make sure that the calculation has been completed before attempting
\r
207 retrieving results. This is to avoid keeping the connection to the server on hold for a prolonged periods of time.
\r
208 While this may be ok with your local server, our public server
\r
209 (<a href="http://www.compbio.dundee.ac.uk/jabaws">www.compbio.dundee.ac.uk/jabaws</a>) will not let you hold the connection
\r
210 for longer than 10 minutes. This is done to prevent excessive load on the server. The next section describes how to check
\r
211 the status of the calculation.<br />
\r
212 Methods and classes mentioned in the excerpt are available from the JABAWS client library. </p>
\r
213 <h3><a name="checkresults" id="checkresults"></a>Checking the status of the calculation </h3>
\r
214 <p> You may have noticed that there was no pause between submitting the job and retrieving of the results. This is
\r
215 because <span class="hightlight">getResult(jobId)</span> method block the processing until the calculation is completed.
\r
216 However, taking into account that the connection holds server resources, our public server
\r
217 (<a href="http://www.compbio.dundee.ac.uk/jabaws">www.compbio.dundee.ac.uk/jabaws</a>) is configured to reset the
\r
218 connection after 10 minutes of waiting. To work around the connection reset you are encouraged to check whether the
\r
219 calculation has been completed before accessing the results. You can do it like this: </p>
\r
220 <p> <span class="code">while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) {<br />
\r
221 Thread.sleep(2000); // wait two seconds, then recheck the status <br />
\r
223 <h3><a name="presetalign" id="presetalign"></a>Aligning with presets</h3>
\r
224 <p class="code">1) PresetManager presetman = msaws.getPresets();<br />
\r
225 2) Preset preset = presetman.getPresetByName(presetName);<br />
\r
226 3) List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));<br />
\r
227 4) String jobId = msaws.presetAlign(fastalist, preset);<br />
\r
228 5) Alignment alignment = msaws.getResult(jobId);</p>
\r
229 <p>Line one obtains the lists of presets supported by a web service.<br />
\r
230 Line two return a particular Preset
\r
232 Lines three to five are doing the same job as in the first <a href="#defalign"> aligning sequences example</a>.</p>
\r
233 <h3><a name="customalign" id="customalign"></a>Aligning with custom parameters</h3>
\r
234 <p class="code"> 1) RunnerConfig options = msaws.getRunnerOptions();<br />
\r
235 2) Argument matrix = options.getArgument("MATRIX");<br />
\r
236 3) matrix.setValue("PAM300");<br />
\r
237 4) Argument gapopenpenalty = options.getArgument("GAPOPEN");<br />
\r
238 5) gapopenpenalty.setValue("20");<br />
\r
239 6) List<Argument> arguments = new ArrayList<Argument>(); <br />
\r
240 7) arguments.add(matrix);
\r
241 arguments.add(gapopenpenalty);<br />
\r
242 8) List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));<br />
\r
243 9) String jobId = msaws.customAlign(fastalist, arguments);<br />
\r
244 10) Alignment alignment = msaws.getResult(jobId);</p>
\r
245 <p>Line one obtains the <span class="hightlight">RunnerConfig</span> object that holds information on supported parameters and their values<br />
\r
246 Line two retrieve a particular parameter from the holder by its name.<br />
\r
247 Lines three sets a value to this parameter which will be used in the calculation. <br />
\r
248 Line four and five do the same but for another parameter.<br />
\r
249 Line 6 makes a List to hold the parameters. <br />
\r
250 Line seven puts the parameters into that list.<br />
\r
252 and ten is the same as in previous examples.<br />
\r
253 Line nine submit an alignment request with the sequences and the parameters. <br />
\r
254 The names of all the parameters supported by a web service e.g. "PAM300" can be obtained
\r
255 using <span class="hightlight">options.getArguments() </span>method. Further details on the methods
\r
256 available from <span class="hightlight">RunnerConfig</span> object are available from the
\r
257 <a href="dm_javadoc/index.html">javadoc</a>. </p>
\r
258 <h3><a name="writingaltofile" id="writingaltofile"></a>Writing alignments to a file</h3>
\r
259 <p>There is a utility method in the client library that does exactly that. </p>
\r
260 <p> <span class="code">Alignment alignment = align(...) <br />
\r
261 FileOutputStream outStream = new FileOutputStream(file);<br />
\r
262 ClustalAlignmentUtil.writeClustalAlignment(outStream, align);</span></p>
\r
263 <h3><a name="compex" id="compex"></a>A complete client example </h3>
\r
265 Finally, a complete example of the program that connects to JABAWS Clustal service and aligns sequences using
\r
266 one of the Clustal web service presets. There is also a <a href="Example_template.pdf">PDF version</a> of
\r
267 this example with syntax highlighted. The text comments are commented by block style comments e.g. /* comment */,
\r
268 the alternatives given in the code are line commented // comment. You may want to remove line style comments to
\r
269 test alternatives of the functions. All you need for this to work is a
\r
270 <a href="http://gjb-www-1.cluster.lifesci.dundee.ac.uk:8086/jabaws-dev/get?id=min-jaba-client-2.0.jar">JABAWS binary client</a>.
\r
271 Please make sure that the client is in the Java class path before running this example.</p>
\r
272 <pre class="code" style="line-height:1em;">
\r
273 import java.io.ByteArrayInputStream;
\r
274 import java.io.FileNotFoundException;
\r
275 import java.io.IOException;
\r
276 import java.net.URL;
\r
277 import java.util.List;
\r
279 import javax.xml.namespace.QName;
\r
280 import javax.xml.ws.Service;
\r
282 import compbio.data.msa.MsaWS;
\r
283 import compbio.data.sequence.Alignment;
\r
284 import compbio.data.sequence.FastaSequence;
\r
285 import compbio.data.sequence.SequenceUtil;
\r
286 import compbio.metadata.JobSubmissionException;
\r
287 import compbio.metadata.LimitExceededException;
\r
288 import compbio.metadata.Preset;
\r
289 import compbio.metadata.PresetManager;
\r
290 import compbio.metadata.ResultNotAvailableException;
\r
291 import compbio.metadata.UnsupportedRuntimeException;
\r
292 import compbio.metadata.WrongParameterException;
\r
294 public class Example {
\r
297 * Input sequences for alignment
\r
299 static final String input = ">Foo\r\n"
\r
300 + "MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGR"
\r
301 + "VRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQ"
\r
302 + "LLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPL"
\r
303 + "APTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQA"
\r
304 + "STLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMD"
\r
305 + "YVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLN"
\r
306 + "PQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHAD"
\r
307 + "LFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALAS"
\r
308 + "DPAALTALHARVDVLRRESGVFEMDGFADDFGALLQALARRHGWLGI\r\n"
\r
310 + ">Bar\r\n"
\r
311 + "MGDTTAGEMAVQRGLALHQQRHAEAAVLLQQASDAAPEHPGIALWLHALEDAGQAEAAAAYTRAH"
\r
312 + "QLLPEEPYITAQLLNAVAQGVGAVEPFAFLSEDASAAESVRPLAPTRVRSKGPLRVGFVSNGFGA"
\r
313 + "HPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHG"
\r
314 + "IDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVL"
\r
315 + "RLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLL"
\r
316 + "SGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGC"
\r
317 + "PVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESGV"
\r
318 + "FEMDGFADDFGALLQALARRHGWLGI\r\n"
\r
320 + ">Friends\r\n"
\r
321 + "MTADGPRELLQLRAAVRHRPQDVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRV"
\r
322 + "RWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDHQLLPEEPYITAQLDVLSAQVRAAVAQG"
\r
323 + "VGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLL"
\r
324 + "TVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFD"
\r
325 + "LRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAF"
\r
326 + "QPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEA"
\r
327 + "DARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTP"
\r
328 + "GETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESI";
\r
330 public static void main(String[] args) throws UnsupportedRuntimeException,
\r
331 LimitExceededException, JobSubmissionException,
\r
332 WrongParameterException, FileNotFoundException, IOException,
\r
333 ResultNotAvailableException, InterruptedException {
\r
335 String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/";
\r
337 /* Make a URL pointing to web service WSDL */
\r
338 URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl");
\r
341 * If you are making a client that connects to different web services
\r
342 * you can use something like this:
\r
344 // URL url = new URL(host + "/" + Services.ClustalWS.toString() +
\r
345 // "?wsdl");
\r
347 QName qname = new QName(qualifiedServiceName, "ClustalWS");
\r
348 Service serv = Service.create(url, qname);
\r
350 * Multiple sequence alignment interface for Clustal web service
\r
353 MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, "ClustalWS"
\r
354 + "Port"), MsaWS.class);
\r
356 /* Get the list of available presets */
\r
357 PresetManager presetman = msaws.getPresets();
\r
359 /* Get the Preset object by preset name */
\r
360 Preset preset = presetman
\r
361 .getPresetByName("Disable gap weighting (Speed-oriented)");
\r
364 * Load sequences in FASTA format from the file You can use something
\r
365 * like new FileInputStream(<filename>) to load sequence from the file
\r
367 List<FastaSequence> fastalist = SequenceUtil
\r
368 .readFasta(new ByteArrayInputStream(input.getBytes()));
\r
371 * Submit loaded sequences for an alignment using preset. The job
\r
372 * identifier is returned by this method, you can retrieve the results
\r
373 * with it sometime later.
\r
375 String jobId = msaws.presetAlign(fastalist, preset);
\r
377 /* This method will block for the duration of the calculation */
\r
378 Alignment alignment = msaws.getResult(jobId);
\r
381 * This is a better way of obtaining results, it does not involve
\r
382 * holding the connection open for the duration of the calculation,
\r
383 * Besides, as the University of Dundee public server will reset the
\r
384 * connection after 10 minutes of idling, this is the only way to obtain
\r
385 * the results of long running task from our public server.
\r
387 // while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) {
\r
388 // Thread.sleep(1000); // wait a second, then recheck the status
\r
391 /* Output the alignment to standard out */
\r
392 System.out.println(alignment);
\r
394 // Alternatively, you can record retrieved alignment into the file in
\r
397 // ClustalAlignmentUtil.writeClustalAlignment(new FileOutputStream(
\r
398 // "output.al"), alignment);
\r
403 For a more detailed description of all available types and their functions please refer to the <a href="dm_javadoc/index.html">data model javadoc</a>.
\r
404 <h3><a name="buildart" id="buildart"></a>Building web services artifacts</h3>
\r
406 JABAWS are the standard <a href="http://jax-ws.java.net/">JAX-WS</a> SOAP web services, which are <a href="http://www.ws-i.org/">WS-I</a>
\r
407 basic profile compatible. This means that you could use whatever tool your language has to work with web services. Below is how you can
\r
408 generate portable artifacts to work with JABAWS from Java. However if programming in Java, we recommend using our client library as
\r
409 it provides a handful of useful methods in addition to plain data types. </p>
\r
410 <p class="code">wsimport -keep http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl</p>
\r
411 </div><!-- content end-->
\r
412 <div id="copyright">Last update: 14 October 2013<br/>Sasha Sherstnev, Peter Troshin, Jim Procter and Geoff Barton, The Barton Group, University of Dundee, UK</div>
\r
413 </div><!-- wrapper end-->
\r
414 </div><!-- page end-->
\r
417 <!-- Google analitics -->
\r
418 <script type="text/javascript">
\r
419 var gaJsHost = (("https:" == document.location.protocol) ? "https://ssl." : "http://www.");
\r
420 document.write(unescape("%3Cscript src='" + gaJsHost + "google-analytics.com/ga.js' type='text/javascript'%3E%3C/script%3E"));
\r
422 <script type="text/javascript">
\r
424 var pageTracker = _gat._getTracker("UA-5356328-1");
\r
425 pageTracker._trackPageview();
\r