1 <%--<?xml version="1.0" encoding="ISO-8859-1" ?>--%>
2 <%--<%@ page language="java" contentType="text/html; charset=ISO-8859-1" pageEncoding="ISO-8859-1"%>--%>
4 <%@ taglib prefix="c" uri="http://java.sun.com/jsp/jstl/core" %>
5 <%@ taglib uri="http://java.sun.com/jsp/jstl/functions" prefix="fn" %>
6 <%@ taglib uri="http://java.sun.com/jsp/jstl/fmt" prefix="fmt" %>
7 <%@ taglib uri="http://displaytag.sf.net" prefix="dt" %>
10 <c:import url="template_header.jsp" >
11 <c:param name="title">Documentation</c:param>
14 <ol class="breadcrumb">
15 <li><a href="${pageContext.request.contextPath}/index.jsp">Home</a></li>
16 <li><a href="man_docs.jsp">Documentation</a></li>
17 <li class="active"><a href="man_server_dev.jsp">Develop JABAWS</a></li>
20 <div class="col-md-12">
21 <div class="panel panel-default">
22 <div class="panel panel-heading">
23 <h1 class="panel-title">Using JABAWS From Your Program</h1>
25 <div class="panel-body">
26 <!--<h4>JABAWS Server Virtual Appliance</h4>-->
28 <li><a href="#wsfunctions">Web services functions overview </a></li>
29 <li><a href="#templatestr">The template client structure</a></li>
30 <li><a href="#connectto">Connecting to JABAWS</a></li>
31 <li><a href="#validnames">Valid JABAWS service names and WSDL files</a></li>
32 <li><a href="#defalign">Aligning sequences</a></li>
33 <li><a href="#checkresults">Checking the status of the calculation </a></li>
34 <li><a href="#presetalign">Aligning with presets</a></li>
35 <li><a href="#customalign">Aligning with custom parameters</a></li>
36 <li><a href="#writingaltofile">Writing alignments to a file</a></li>
37 <li><a href="#compex">A complete client example </a></li>
38 <li><a href="#buildart">Building web services artifacts</a></li>
40 <!--<p class="justify">-->
47 <div class="row" id="wsfunctions">
48 <div class="col-md-12">
49 <div class="panel panel-default">
50 <div class="panel panel-heading">
51 <h1 class="panel-title">Web services functions overview</h1>
53 <div class="panel-body">
55 All JABA multiple sequence alignment web services comply to the same
56 interface, thus the function described below are available from all the services.
58 <strong>Functions for initiating the alignment </strong>
59 <pre><code class="java">String id = align(List<FastaSequence> list)
60 String id = customAlign(List<FastaSequence> sequenceList, List<Option> optionList)
61 String id = presetAlign(List<FastaSequence> sequenceList, Preset preset)</code></pre>
63 <strong>Functions pertaining to job monitoring and control</strong><br />
64 <pre><code class="java">JobStatus status = getJobStatus(String id)
65 Alignment al = getResult(String id)
66 boolean cancelled = cancelJob(String id)
67 ChunkHolder chunk = pullExecStatistics(String id, long marker)</code></pre>
68 <strong>Functions relating to service features discovery</strong><br />
69 <pre><code class="java">RunnerConfig rc = getRunnerOptions()
70 Limit limit = getLimit(String name)
71 LimitsManager lm = getLimits()
72 PresetManager pm = getPresets()</code></pre>
74 Please refer to a <a href="dm_javadoc/compbio/data/msa/MsaWS.html">data model
75 javadoc</a> for a detailed description of each methods.
77 <p class="text-right">
78 <a href="#">Back to top <i class="fa fa-arrow-up" aria-hidden="true"></i></a>
84 <div class="row" id="templatestr">
85 <div class="col-md-12">
86 <div class="panel panel-default">
87 <div class="panel panel-heading">
88 <h1 class="panel-title">Structure of the template command line client</h1>
90 <div class="panel-body">
93 <td style="width:19%"><strong>Packages</strong></td>
94 <td style="width:81%"><strong>Classes and Interfaces </strong></td>
97 <td>compbio.data.msa </td>
98 <td>MsaWS the interface for all multiple sequence alignment web services </td>
101 <td>compbio.data.sequence</td>
102 <td>JABAWS data types </td>
105 <td>compbio.metadata</td>
106 <td>JABAWS meta data types </td>
109 <td>compbio.ws.client</td>
110 <td>JABAWS command line client </td>
114 Additional utility libraries that this client depend upon is the
115 compbio-util-1.3.jar and compbio-annotation-1.0.jar.
118 Please refer to a <a href="dm_javadoc/index.html">data model javadoc</a>
119 for a detailed description of each class and its methods.
121 <p class="text-right">
122 <a href="#">Back to top <i class="fa fa-arrow-up" aria-hidden="true"></i></a>
128 <div class="row" id="connectto">
129 <div class="col-md-12">
130 <div class="panel panel-default">
131 <div class="panel panel-heading">
132 <h1 class="panel-title">Connecting to JABAWS</h1>
134 <div class="panel-body">
136 For a complete working example of JABAWS command line client please see
137 compbio.ws.client.Jws2Client class. JABAWS command line client
138 source code is available from the
139 <a href="http://gjb-www-1.cluster.lifesci.dundee.ac.uk:8086/jabaws-dev">download page</a>.
140 Please note that for now all
141 the examples are in Java, other languages will follow if there is sufficient demand.
144 Download a binary JABAWS client. Add the client to the class path. The following
145 code excerpt will connect your program to Clustal
146 web service deployed in the University of Dundee.
148 <pre><code class="java">import java.net.URL;
149 import javax.xml.namespace.QName;
150 import javax.xml.ws.Service;
152 String qualifiedName = "http://msa.data.compbio/01/01/2010/";
153 URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl");
154 QName qname = new QName(, "ClustalWS");
155 Service serv = Service.create(url, qname);
156 MsaWS msaws = serv.getPort(new QName(qualifiedName, "ClustalWSPort"),
157 MsaWS.class);</code></pre>
158 <p>Line 1 makes a qualified name for JABA web services.</p>
159 <p>Line 2 constructs the URL to the web services WSDL.</p>
160 <p>Line 3 makes a qualified name instance for Clustal JABA web service.</p>
161 <p>Line 4 creates a service instance.</p>
162 <p>Line 5 makes a connection to the server.</p>
163 <p>A more generic connection method would look like this</p>
165 <pre><code class="java">import java.net.URL;
166 import javax.xml.namespace.QName;
167 import javax.xml.ws.Service;
168 import compbio.ws.client.Services
170 String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/";
171 String host = "http://www.compbio.dundee.ac.uk/jabaws";
172 // In real life the service name can come from args
173 Services clustal = Services.ClustalWS;
174 URL url = new URL(host + "/" + clustal.toString() + "?wsdl");
175 QName qname = new QName(qualifiedServiceName, clustal.toString());
176 Service serv = Service.create(url, qname);
177 MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, clustal + "Port"), MsaWS.class);</code></pre>
180 Where Services is enumeration of JABAWS web services. All JABAWS multiple
181 sequence alignment methods confirm to
182 MsaWS specification, thus from the caller point of view all JABAWS web
183 services can be represented by MsaWS
184 interface. The full documentation of MsaWS functions is available from
185 the <a href="dm_javadoc/compbio/data/msa/MsaWS.html">javadoc</a>.
188 <p class="text-right">
189 <a href="#">Back to top <i class="fa fa-arrow-up" aria-hidden="true"></i></a>
195 <div class="row" id="validnames">
196 <div class="col-md-12">
197 <div class="panel panel-default">
198 <div class="panel panel-heading">
199 <h1 class="panel-title">Valid JABAWS service names and WSDL files</h1>
201 <div class="panel-body">
202 <p>Multiple sequence alignment services</p>
203 <ul><li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalOWS?wsdl">ClustalOWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalOWS?wsdl) </li>
204 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalWS?wsdl">ClustalWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalWS?wsdl) </li>
205 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/MuscleWS?wsdl">MuscleWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/MuscleWS?wsdl) </li>
206 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/MafftWS?wsdl">MafftWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/MafftWS?wsdl) </li>
207 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/TcoffeeWS?wsdl">TcoffeeWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/TcoffeeWS?wsdl) </li>
208 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/ProbconsWS?wsdl">ProbconsWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/ProbconsWS?wsdl) </li>
209 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/MSAprobsWS?wsdl">MSAprobsWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/MSAprobsWS?wsdl) </li>
210 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/GLprobsWS?wsdl">GLprobsWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/GLprobsWS?wsdl) </li>
212 <p>Protein disorder prediction services</p>
214 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/IUPredWS?wsdl">IUPredWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/IUPredWS?wsdl) </li>
215 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/GlobPlotWS?wsdl">GlobPlotWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/GlobPlotWS?wsdl) </li>
216 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/DisemblWS?wsdl">DisemblWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/DisemblWS?wsdl) </li>
217 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/JronnWS?wsdl">JronnWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/JronnWS?wsdl) </li>
219 <p>Amino acid conservation service</p>
221 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/AAConWS?wsdl">AAConWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/AAConWS?wsdl) </li>
223 <p>Protein and RNA Secondary Structure Prediction</p>
225 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/JpredWS?wsdl">JpredWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/JpredWS?wsdl) </li>
226 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/RNAalifoldWS?wsdl">RNAalifoldWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/RNAalifoldWS?wsdl) </li>
229 Please replace <em2>http://www.compbio.dundee.ac.uk/</em2> with your JABAWS instance host name, and
230 <em2>jabaws</em2> with your JABAWS context name to access your local version of JABAWS web services.
231 For example <em2>http://localhost:8080/jabaws</em2> would be a valid URL for the default Apache-Tomcat
232 installation and jabaws.war file deployment.
234 <p class="text-right">
235 <a href="#">Back to top <i class="fa fa-arrow-up" aria-hidden="true"></i></a>
241 <div class="row" id="defalign">
242 <div class="col-md-12">
243 <div class="panel panel-default">
244 <div class="panel panel-heading">
245 <h1 class="panel-title">Aligning sequences</h1>
247 <div class="panel-body">
249 Given that <em2>msaws</em2> is web service proxy, created as described in "Connecting to JABAWS"
250 section, the actual alignment can be obtained as follows:
252 <pre><code class="java">List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));
253 String jobId = msaws.align(fastalist);
254 Alignment alignment = msaws.getResult(jobId);</code></pre>
256 <p>Line one loads FASTA sequence from the file.</p>
257 <p>Line two submits them to web service represented by msaws proxy.</p>
259 Line three retrieves the alignment from a web service. This line will block the execution until the result is available.
260 Use this with caution. In general, you should make sure that the calculation has been completed before attempting
261 retrieving results. This is to avoid keeping the connection to the server on hold for a prolonged periods of time.
262 While this may be ok with your local server, our public server
263 (<a href="http://www.compbio.dundee.ac.uk/jabaws">www.compbio.dundee.ac.uk/jabaws</a>) will not let you hold the connection
264 for longer than 10 minutes. This is done to prevent excessive load on the server. The next section describes how to check
265 the status of the calculation.<br />
266 Methods and classes mentioned in the excerpt are available from the JABAWS client library.
268 <p class="text-right">
269 <a href="#">Back to top <i class="fa fa-arrow-up" aria-hidden="true"></i></a>
275 <div class="row" id="checkresults">
276 <div class="col-md-12">
277 <div class="panel panel-default">
278 <div class="panel panel-heading">
279 <h1 class="panel-title">Checking the status of the calculation</h1>
281 <div class="panel-body">
283 You may have noticed that there was no pause between submitting the job and retrieving of the results. This is
284 because <em2>getResult(jobId)</em2> method block the processing until the calculation is completed.
285 However, taking into account that the connection holds server resources, our public server
286 (<a href="http://www.compbio.dundee.ac.uk/jabaws">www.compbio.dundee.ac.uk/jabaws</a>) is configured to reset the
287 connection after 10 minutes of waiting. To work around the connection reset you are encouraged to check whether the
288 calculation has been completed before accessing the results. You can do it like this:
290 <pre><code class="java">while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) {
291 Thread.sleep(2000); // wait two seconds, then recheck the status
293 <p class="text-right">
294 <a href="#">Back to top <i class="fa fa-arrow-up" aria-hidden="true"></i></a>
300 <div class="row" id="presetalign">
301 <div class="col-md-12">
302 <div class="panel panel-default">
303 <div class="panel panel-heading">
304 <h1 class="panel-title">Aligning with presets</h1>
306 <div class="panel-body">
307 <pre><code class="java">PresetManager presetman = msaws.getPresets();
308 Preset preset = presetman.getPresetByName(presetName);
309 List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));
310 String jobId = msaws.presetAlign(fastalist, preset);
311 Alignment alignment = msaws.getResult(jobId);</code></pre>
312 <p>Line one obtains the lists of presets supported by a web service.</p>
313 <p>Line two return a particular Preset by its name.</p>
315 Lines three to five are doing the same job as in the first <a href="#defalign">
316 aligning sequences example</a>.
318 <p class="text-right">
319 <a href="#">Back to top <i class="fa fa-arrow-up" aria-hidden="true"></i></a>
325 <div class="row" id="customalign">
326 <div class="col-md-12">
327 <div class="panel panel-default">
328 <div class="panel panel-heading">
329 <h1 class="panel-title">Aligning with custom parameters</h1>
331 <div class="panel-body">
332 <pre><code class="java">RunnerConfig options = msaws.getRunnerOptions();
333 Argument matrix = options.getArgument("MATRIX");
334 matrix.setValue("PAM300");
335 Argument gapopenpenalty = options.getArgument("GAPOPEN");
336 gapopenpenalty.setValue("20");
337 List<Argument> arguments = new ArrayList<Argument>();
338 arguments.add(matrix); arguments.add(gapopenpenalty);
339 List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));
340 String jobId = msaws.customAlign(fastalist, arguments);
341 Alignment alignment = msaws.getResult(jobId);</code></pre>
343 <p>Line one obtains the <em2>RunnerConfig</em2> object that holds information on
344 supported parameters and their values</p>
345 <p>Line two retrieve a particular parameter from the holder by its name.</p>
346 <p>Lines three sets a value to this parameter which will be used in the calculation. </p>
347 <p>Line four and five do the same but for another parameter.</p>
348 <p>Line six makes a List to hold the parameters.</p>
349 <p>Line seven puts the parameters into that list.</p>
350 <p>Line eight and ten is the same as in previous examples.</p>
351 <p>Line nine submit an alignment request with the sequences and the parameters.</p>
352 <p class="justify">The names of all the parameters supported by a web service e.g. "PAM300" can be obtained
353 using <em2>options.getArguments()</em2>method. Further details on the methods
354 available from <em2>RunnerConfig</em2> object are available from the
355 <a href="dm_javadoc/index.html">javadoc</a>.
357 <p class="text-right">
358 <a href="#">Back to top <i class="fa fa-arrow-up" aria-hidden="true"></i></a>
364 <div class="row" id="writingaltofile">
365 <div class="col-md-12">
366 <div class="panel panel-default">
367 <div class="panel panel-heading">
368 <h1 class="panel-title">Writing alignments to a file</h1>
370 <div class="panel-body">
372 There is a utility method in the client library that does exactly that.
374 <pre><code class="java">Alignment alignment = align(...)
375 FileOutputStream outStream = new FileOutputStream(file);
376 ClustalAlignmentUtil.writeClustalAlignment(outStream, align);</code></pre>
377 <p class="text-right">
378 <a href="#">Back to top <i class="fa fa-arrow-up" aria-hidden="true"></i></a>
384 <div class="row" id="compex">
385 <div class="col-md-12">
386 <div class="panel panel-default">
387 <div class="panel panel-heading">
388 <h1 class="panel-title">A complete client example</h1>
390 <div class="panel-body">
392 Finally, a complete example of the program that connects to JABAWS Clustal
393 service and aligns sequences using
394 one of the Clustal web service presets. There is also a
395 <a href="2.1/Example_template.pdf">PDF version</a> of
396 this example with syntax highlighted. The text comments are commented by block
397 style comments e.g. /* comment */,
398 the alternatives given in the code are line commented // comment. You may want
399 to remove line style comments to
400 test alternatives of the functions. All you need for this to work is a
401 <a href="http://gjb-www-1.cluster.lifesci.dundee.ac.uk:8086/jabaws-dev/get?id=min-jaba-client-2.0.jar">JABAWS binary client</a>.
402 Please make sure that the client is in the Java class path before running this example.
404 <pre><code class="java">
405 import java.io.ByteArrayInputStream;
406 import java.io.FileNotFoundException;
407 import java.io.IOException;
409 import java.util.List;
411 import javax.xml.namespace.QName;
412 import javax.xml.ws.Service;
414 import compbio.data.msa.MsaWS;
415 import compbio.data.sequence.Alignment;
416 import compbio.data.sequence.FastaSequence;
417 import compbio.data.sequence.SequenceUtil;
418 import compbio.metadata.JobSubmissionException;
419 import compbio.metadata.LimitExceededException;
420 import compbio.metadata.Preset;
421 import compbio.metadata.PresetManager;
422 import compbio.metadata.ResultNotAvailableException;
423 import compbio.metadata.UnsupportedRuntimeException;
424 import compbio.metadata.WrongParameterException;
426 public class Example {
429 * Input sequences for alignment
431 static final String input = ">Foo\r\n"
432 + "MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGR"
433 + "VRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQ"
434 + "LLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPL"
435 + "APTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQA"
436 + "STLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMD"
437 + "YVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLN"
438 + "PQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHAD"
439 + "LFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALAS"
440 + "DPAALTALHARVDVLRRESGVFEMDGFADDFGALLQALARRHGWLGI\r\n"
442 + ">Bar\r\n"
443 + "MGDTTAGEMAVQRGLALHQQRHAEAAVLLQQASDAAPEHPGIALWLHALEDAGQAEAAAAYTRAH"
444 + "QLLPEEPYITAQLLNAVAQGVGAVEPFAFLSEDASAAESVRPLAPTRVRSKGPLRVGFVSNGFGA"
445 + "HPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHG"
446 + "IDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVL"
447 + "RLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLL"
448 + "SGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGC"
449 + "PVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESGV"
450 + "FEMDGFADDFGALLQALARRHGWLGI\r\n"
452 + ">Friends\r\n"
453 + "MTADGPRELLQLRAAVRHRPQDVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRV"
454 + "RWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDHQLLPEEPYITAQLDVLSAQVRAAVAQG"
455 + "VGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLL"
456 + "TVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFD"
457 + "LRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAF"
458 + "QPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEA"
459 + "DARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTP"
460 + "GETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESI";
462 public static void main(String[] args) throws UnsupportedRuntimeException,
463 LimitExceededException, JobSubmissionException,
464 WrongParameterException, FileNotFoundException, IOException,
465 ResultNotAvailableException, InterruptedException {
467 String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/";
469 /* Make a URL pointing to web service WSDL */
470 URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl");
473 * If you are making a client that connects to different web services
474 * you can use something like this:
476 // URL url = new URL(host + "/" + Services.ClustalWS.toString() +
477 // "?wsdl");
479 QName qname = new QName(qualifiedServiceName, "ClustalWS");
480 Service serv = Service.create(url, qname);
482 * Multiple sequence alignment interface for Clustal web service
485 MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, "ClustalWS"
486 + "Port"), MsaWS.class);
488 /* Get the list of available presets */
489 PresetManager presetman = msaws.getPresets();
491 /* Get the Preset object by preset name */
492 Preset preset = presetman
493 .getPresetByName("Disable gap weighting (Speed-oriented)");
496 * Load sequences in FASTA format from the file You can use something
497 * like new FileInputStream(<filename>) to load sequence from the file
499 List<FastaSequence> fastalist = SequenceUtil
500 .readFasta(new ByteArrayInputStream(input.getBytes()));
503 * Submit loaded sequences for an alignment using preset. The job
504 * identifier is returned by this method, you can retrieve the results
505 * with it sometime later.
507 String jobId = msaws.presetAlign(fastalist, preset);
509 /* This method will block for the duration of the calculation */
510 Alignment alignment = msaws.getResult(jobId);
513 * This is a better way of obtaining results, it does not involve
514 * holding the connection open for the duration of the calculation,
515 * Besides, as the University of Dundee public server will reset the
516 * connection after 10 minutes of idling, this is the only way to obtain
517 * the results of long running task from our public server.
519 // while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) {
520 // Thread.sleep(1000); // wait a second, then recheck the status
523 /* Output the alignment to standard out */
524 System.out.println(alignment);
526 // Alternatively, you can record retrieved alignment into the file in
529 // ClustalAlignmentUtil.writeClustalAlignment(new FileOutputStream(
530 // "output.al"), alignment);
535 <p>For a more detailed description of all available types and their functions please
536 refer to the <a href="dm_javadoc/index.html">data model javadoc</a>.
538 <p class="text-right">
539 <a href="#">Back to top <i class="fa fa-arrow-up" aria-hidden="true"></i></a>
545 <div class="row" id="buildart">
546 <div class="col-md-12">
547 <div class="panel panel-default">
548 <div class="panel panel-heading">
549 <h1 class="panel-title">Building web services artifacts</h1>
551 <div class="panel-body">
553 JABAWS are the standard <a href="http://jax-ws.java.net/">JAX-WS</a> SOAP web
554 services, which are <a href="http://www.ws-i.org/">WS-I</a>
555 basic profile compatible. This means that you could use whatever tool your
556 language has to work with web services. Below is how you can
557 generate portable artifacts to work with JABAWS from Java. However if
558 programming in Java, we recommend using our client library as
559 it provides a handful of useful methods in addition to plain data types.
561 <pre><code class="bash">wsimport -keep http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl</code></pre>
567 <jsp:include page="template_footer.jsp" />