package jalview.structure;
-import static org.junit.Assert.assertEquals;
-import static org.junit.Assert.assertTrue;
-import static org.junit.Assert.fail;
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertTrue;
+
import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.Annotation;
import jalview.datamodel.Sequence;
import jalview.io.FileLoader;
import jalview.io.FormatAdapter;
-import org.junit.Assert;
-import org.junit.Test;
+import org.testng.Assert;
+import org.testng.AssertJUnit;
+import org.testng.annotations.Test;
import MCview.PDBfile;
* 115 in PDB Res Numbering secondary structure numbers in jmol seem to be in
* msd numbering, not pdb res numbering.
*/
- @Test
+ @Test(groups =
+ { "Functional" }, enabled = false)
public void pdbEntryPositionMap() throws Exception
{
- fail("This test intentionally left to fail");
+ Assert.fail("This test intentionally left to fail");
for (int offset = 0; offset < 20; offset += 6)
{
// check we put the secondary structure in the right position
}
}
- @Test
+ @Test(groups =
+ { "Functional" }, enabled = false)
public void testPDBentryMapping() throws Exception
{
- fail("This test intentionally left to fail");
+ Assert.fail("This test intentionally left to fail");
Sequence sq = new Sequence(
"1GAQ A subseq 126 to 219",
"EIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKM");
* transform
*
*/
- @Test
+ @Test(groups ={ "Functional" })
public void mapFer1From3W5V() throws Exception
{
AlignFrame seqf = new FileLoader(false)
jalview.io.FormatAdapter.FILE);
if (pmap == null)
{
- Assert.fail("Couldn't make a mapping for 3W5V to FER1_MAIZE");
+ AssertJUnit.fail("Couldn't make a mapping for 3W5V to FER1_MAIZE");
}
}
* compare reference annotation for imported pdb sequence to identical
* seuqence with transferred annotation from mapped pdb file
*/
- @Test
+ @Test(groups ={ "Functional" })
public void compareTransferredToRefPDBAnnot() throws Exception
{
AlignFrame ref = new FileLoader(false)
newseq.setStart(refseq.getStart() + 25);
newseq.setEnd(refseq.getLength() + 25 + refseq.getStart());
StructureSelectionManager ssm = new jalview.structure.StructureSelectionManager();
+ ssm.setProcessSecondaryStructure(true);
+ ssm.setAddTempFacAnnot(true);
PDBfile pmap = ssm.setMapping(true, new SequenceI[]
{ newseq }, new String[]
{ null }, "test/jalview/ext/jmol/1QCF.pdb",
assertTrue(pmap != null);
assertEquals("Original and copied sequence of different lengths.",
refseq.getLength(), newseq.getLength());
- assertTrue(refseq.getAnnotation().length > 0
+ assertTrue(refseq.getAnnotation() != null
+ && refseq.getAnnotation().length > 0);
+ assertTrue(newseq.getAnnotation() != null
&& newseq.getAnnotation().length > 0);
for (AlignmentAnnotation oannot : refseq.getAnnotation())
{