jalview.git
7 years agoJAL-2154 always check dataset sequence for sequence instance exists in dataset before...
Jim Procter [Mon, 22 Aug 2016 11:55:36 +0000 (12:55 +0100)]
JAL-2154 always check dataset sequence for sequence instance exists in dataset before adding it in AlignmentI.addSequence()

7 years agoJAL-2154 patch verifyAlignment so it fails for duplicate entries for same SequenceI...
Jim Procter [Mon, 22 Aug 2016 10:54:02 +0000 (11:54 +0100)]
JAL-2154 patch verifyAlignment so it fails for duplicate entries for same SequenceI instance on alignment

7 years agoJAL-2154 tidy assert messages and fix test to verify asserts were raised when expected
Jim Procter [Mon, 22 Aug 2016 10:53:13 +0000 (11:53 +0100)]
JAL-2154 tidy assert messages and fix test to verify asserts were raised when expected

7 years agoJAL-2154 test that verifyAlignment fails for duplicate entries for same SequenceI...
Jim Procter [Mon, 22 Aug 2016 10:40:46 +0000 (11:40 +0100)]
JAL-2154 test that verifyAlignment fails for duplicate entries for same SequenceI instance on alignment

7 years agoJAL-2154 - possible patch .. but leads to new stringify difference:
Jim Procter [Fri, 19 Aug 2016 15:47:13 +0000 (16:47 +0100)]
JAL-2154 - possible patch .. but leads to new stringify difference:
expected to see below in dataset, but it doesn’t appear in recovered:
>ENSMUSP00000131873/1-222 ENSEMBL (Protein)
MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSS
KLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVP
VLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITL
ICYHSR

This is actually a duplicate sequence in dataset.. so difference may be due to normalisation when project file is written out

7 years agoJAL-2154 major rejigging of test looping again
Jim Procter [Fri, 19 Aug 2016 15:26:07 +0000 (16:26 +0100)]
JAL-2154 major rejigging of test looping again
probably not 100% correct, but now fails when:

Recovered view for 'UNIPROT P01731 -> EMBL{1} -> ENSEMBL{0}' from '/var/folders/km/m8_86nbd4bbcpd5s2h8xqtk4_kj190/T/crossRefTest9144214145355720129.jvp'

Cause is:
Parsing as Jalview Version 2 file failed.
java.lang.ArrayIndexOutOfBoundsException: 73
at jalview.gui.Jalview2XML.loadFromObject(Jalview2XML.java:2827)
at jalview.gui.Jalview2XML.loadJalviewAlign(Jalview2XML.java:2390)
at jalview.gui.Jalview2XML.loadJalviewAlign(Jalview2XML.java:2277)
at jalview.io.FileLoader.run(FileLoader.java:308)
at java.lang.Thread.run(Thread.java:745)

7 years agoJAL-2154 disable DAS sources for Jalview2XML tests
Jim Procter [Fri, 19 Aug 2016 15:24:33 +0000 (16:24 +0100)]
JAL-2154 disable DAS sources for Jalview2XML tests

7 years agoJAL-2154 fix looping structure so for a particular pass (either 2-pass: retrieve...
Jim Procter [Fri, 19 Aug 2016 10:57:00 +0000 (11:57 +0100)]
JAL-2154 fix looping structure so for a particular pass (either 2-pass: retrieve cross-ref+save/recover from project or one pass: retrieve cross-ref and compare string) we do all cross-refs or dbfetches in a pass.

7 years agoJAL-2154 drop unused hashes
Jim Procter [Fri, 19 Aug 2016 10:55:02 +0000 (11:55 +0100)]
JAL-2154 drop unused hashes

7 years agoJAL-2154 testNG like assertAlignmentDatasetRefs static wrappers and allow a message...
Jim Procter [Fri, 19 Aug 2016 10:52:25 +0000 (11:52 +0100)]
JAL-2154 testNG like assertAlignmentDatasetRefs static wrappers and allow a message to be passed to prefix any assert failed messages

7 years agoJAL-2154 reorder the dataset sequences according to the dataset XML doc (which, perve...
Jim Procter [Fri, 19 Aug 2016 10:18:56 +0000 (11:18 +0100)]
JAL-2154 reorder the dataset sequences according to the dataset XML doc (which, perversely, is read after all views)

7 years agoJAL-2154 belt-and-braces patch:
Jim Procter [Fri, 19 Aug 2016 10:18:11 +0000 (11:18 +0100)]
JAL-2154 belt-and-braces patch:
* when dataset XML doc is read in, all vamsasSet sequences should be processed in sync with the ‘view’ JSeq entries containing start/end metadata
* features, dbrefs and pdbentrys are now added direct to dataset sequences, but old behaviour should be preserved for reading alignment views containing dbrefs that get propagated to dataset.

7 years agoJAL-2154 verify mapping’s sequenceI ref has been resolved for AlignedCodonFrame forwa...
Jim Procter [Fri, 19 Aug 2016 10:12:28 +0000 (11:12 +0100)]
JAL-2154 verify mapping’s sequenceI ref has been resolved for AlignedCodonFrame forward refs

7 years agoJAL-2154 use right reference string for recovering saved project
Jim Procter [Fri, 19 Aug 2016 10:11:04 +0000 (11:11 +0100)]
JAL-2154 use right reference string for recovering saved project

7 years agoJAL-2154 refactor setSequenceAt to replaceSequenceAt, fixed implementation and docs
Jim Procter [Fri, 19 Aug 2016 10:10:04 +0000 (11:10 +0100)]
JAL-2154 refactor setSequenceAt to replaceSequenceAt, fixed implementation and docs

7 years agoJAL-2154 verify sequenceI/dataset refs for codonmappings
Jim Procter [Tue, 16 Aug 2016 17:39:32 +0000 (18:39 +0100)]
JAL-2154 verify sequenceI/dataset refs for codonmappings

7 years agoJAL-2154 make sure any new sequences via DBRefEntry->Mapping->To are added to dataset...
Jim Procter [Tue, 16 Aug 2016 14:31:33 +0000 (15:31 +0100)]
JAL-2154 make sure any new sequences via DBRefEntry->Mapping->To are added to dataset as cross-refs are resolved.

7 years agoJAL-2154 check alignment isn’t null before validating
Jim Procter [Tue, 16 Aug 2016 14:30:40 +0000 (15:30 +0100)]
JAL-2154 check alignment isn’t null before validating

7 years agoJAL-2154 always resolve dataset sequences when creating a mapping for a DBRefEntry
Jim Procter [Tue, 16 Aug 2016 14:15:15 +0000 (15:15 +0100)]
JAL-2154 always resolve dataset sequences when creating a mapping for a DBRefEntry

7 years agoJAL-2154 [test] verify reference integrity for alignment/dataset after each retrieval...
Jim Procter [Tue, 16 Aug 2016 13:41:35 +0000 (14:41 +0100)]
JAL-2154 [test] verify reference integrity for alignment/dataset after each retrieval/crossref view

7 years agoJAL-2154 formatting
Jim Procter [Tue, 16 Aug 2016 13:31:37 +0000 (14:31 +0100)]
JAL-2154 formatting

7 years agoJAL-2154 new assert to check reference integrity for an alignment, and a dataset...
Jim Procter [Tue, 16 Aug 2016 13:30:48 +0000 (14:30 +0100)]
JAL-2154 new assert to check reference integrity for an alignment, and a dataset, and associated DBRefEntry mappings to other sequences

7 years agoJAL-2154 xref test harness - test fails if there are differences between dataset...
Jim Procter [Tue, 16 Aug 2016 09:39:11 +0000 (10:39 +0100)]
JAL-2154 xref test harness - test fails if there are differences between dataset/alignment/codonframes for views created from a sequence of cross-ref actions, and the same views after restoring from a jalview project.

Currently fails !

7 years agoJAL-2154 refactor CrossRef UI code to its own class
Jim Procter [Sat, 13 Aug 2016 16:06:25 +0000 (17:06 +0100)]
JAL-2154 refactor CrossRef UI code to its own class
JAL-2154 first pass of cross-ref + project save/restore test

7 years agoJAL-2154 check if the desktop is constructed before trying to clear it !
Jim Procter [Sat, 13 Aug 2016 15:59:34 +0000 (16:59 +0100)]
JAL-2154 check if the desktop is constructed before trying to clear it !

7 years agoJAL-2154 ignore all but the primary source resolved during programmatic invocation
Jim Procter [Sat, 13 Aug 2016 15:57:58 +0000 (16:57 +0100)]
JAL-2154 ignore all but the primary source resolved during programmatic invocation

7 years agoJAL-2154 make sure we wait for constructor thread to finish
Jim Procter [Sat, 13 Aug 2016 15:29:09 +0000 (16:29 +0100)]
JAL-2154 make sure we wait for constructor thread to finish

7 years agoJAL-2154 clear the desktop before every 2xml test
Jim Procter [Thu, 11 Aug 2016 20:36:09 +0000 (21:36 +0100)]
JAL-2154 clear the desktop before every 2xml test

7 years agoJAL-2154 jalview.gui.SequenceFetcher.fetchAndShow(db,query) entry point for programma...
Jim Procter [Thu, 11 Aug 2016 20:32:56 +0000 (21:32 +0100)]
JAL-2154 jalview.gui.SequenceFetcher.fetchAndShow(db,query) entry point for programmatically triggering a sequence fetch

7 years agoJAL-2154 JAL-1993 relocate show dbchooser action out of jbInit
Jim Procter [Thu, 11 Aug 2016 17:25:03 +0000 (18:25 +0100)]
JAL-2154 JAL-1993 relocate show dbchooser action out of jbInit

7 years agoJAL-2154 refactor setup/teardown from Jalview2xml for other 2xml related tests
Jim Procter [Thu, 11 Aug 2016 13:39:39 +0000 (14:39 +0100)]
JAL-2154 refactor setup/teardown from Jalview2xml for other 2xml related tests

7 years agoJAL-2154 add in missing class for createDatasetAlignment(), and add support for recov...
Jim Procter [Sun, 7 Aug 2016 15:13:43 +0000 (16:13 +0100)]
JAL-2154 add in missing class for createDatasetAlignment(), and add support for recovering position for an object in the set.

7 years agoJAL-2154 make sure codon mappings between sequences discovered via database cross...
Jim Procter [Thu, 4 Aug 2016 19:59:46 +0000 (20:59 +0100)]
JAL-2154 make sure codon mappings between sequences discovered via database cross-reference matching are added to the codonframe.

7 years agoJAL-2154 todo
Jim Procter [Thu, 4 Aug 2016 19:58:38 +0000 (20:58 +0100)]
JAL-2154 todo

7 years agoJAL-2154 use convenience method
Jim Procter [Thu, 4 Aug 2016 19:58:16 +0000 (20:58 +0100)]
JAL-2154 use convenience method

7 years agoJAL-2154 make sure all sequences referenced via DBRefEntry->getMap()->getTo() are...
Jim Procter [Thu, 4 Aug 2016 19:57:33 +0000 (20:57 +0100)]
JAL-2154 make sure all sequences referenced via DBRefEntry->getMap()->getTo() are added to dataset when it is created

7 years agoJAL-2110 comment on failing test (consider skipping for release ?)
Jim Procter [Thu, 4 Aug 2016 19:55:28 +0000 (20:55 +0100)]
JAL-2110 comment on failing test (consider skipping for release ?)

7 years agoJAL-2154 test for CDS->protein map
Jim Procter [Thu, 4 Aug 2016 19:54:57 +0000 (20:54 +0100)]
JAL-2154 test for CDS->protein map

7 years agoJAL-2046 stack trace for implementation warning
Jim Procter [Thu, 4 Aug 2016 19:53:40 +0000 (20:53 +0100)]
JAL-2046 stack trace for implementation warning

7 years agoJAL-2008 handle fast mouse drag of feature ordering correctly
gmungoc [Thu, 4 Aug 2016 09:55:50 +0000 (10:55 +0100)]
JAL-2008 handle fast mouse drag of feature ordering correctly

7 years agoJAL-2015 convert Color from colour picker to FeatureColour
gmungoc [Thu, 4 Aug 2016 09:11:06 +0000 (10:11 +0100)]
JAL-2015 convert Color from colour picker to FeatureColour

7 years agoJAL-2046 additional logic to suppress spurious implementation-error warnings
Jim Procter [Tue, 2 Aug 2016 15:22:43 +0000 (16:22 +0100)]
JAL-2046 additional logic to suppress spurious implementation-error warnings

7 years agoMerge branch 'efficiency/JAL-2034_JAL-1421' into develop
Jim Procter [Tue, 2 Aug 2016 14:56:19 +0000 (15:56 +0100)]
Merge branch 'efficiency/JAL-2034_JAL-1421' into develop

7 years agoJAL-2034 show greyed out image during overview update
Jim Procter [Tue, 2 Aug 2016 14:46:58 +0000 (15:46 +0100)]
JAL-2034 show greyed out image during overview update

7 years agoMerge branch 'develop' into efficiency/JAL-2034_JAL-1421
Jim Procter [Tue, 2 Aug 2016 13:16:06 +0000 (14:16 +0100)]
Merge branch 'develop' into efficiency/JAL-2034_JAL-1421

7 years agoJAL-2068 reinstated false return value for notifyWorking
Jim Procter [Tue, 2 Aug 2016 13:15:35 +0000 (14:15 +0100)]
JAL-2068 reinstated false return value for notifyWorking
  (prevents multiple worker threads starting when new view created)
 * documentation for AlignCalcManagerI

7 years agoMerge branch 'develop' into efficiency/JAL-2034_JAL-1421
Jim Procter [Tue, 2 Aug 2016 10:05:53 +0000 (11:05 +0100)]
Merge branch 'develop' into efficiency/JAL-2034_JAL-1421

7 years agoJAL-2164 TODO: make test pass for JMOL_PARSER
Jim Procter [Mon, 1 Aug 2016 20:13:52 +0000 (21:13 +0100)]
JAL-2164 TODO: make test pass for JMOL_PARSER

7 years agoJAL-2164 JAL-1919 JAL-1270 use structure import settings to properly configure for...
Jim Procter [Mon, 1 Aug 2016 20:13:22 +0000 (21:13 +0100)]
JAL-2164 JAL-1919 JAL-1270 use structure import settings to properly configure for test

7 years agoMerge branch 'develop' of http://source.jalview.org/git/jalview into develop
Jim Procter [Mon, 1 Aug 2016 19:16:42 +0000 (20:16 +0100)]
Merge branch 'develop' of source.jalview.org/git/jalview into develop

7 years agoJAL-2164 bugfix to convert insCodes of '\000' to ' ' in JmolParser, this fixes the...
tcofoegbu [Mon, 1 Aug 2016 16:21:08 +0000 (17:21 +0100)]
JAL-2164 bugfix to convert insCodes of '\000' to ' ' in JmolParser, this fixes the xml marshalling bug

7 years agoMerge branch 'bug/JAL-2154projectMappings' into develop
Jim Procter [Mon, 1 Aug 2016 14:40:24 +0000 (15:40 +0100)]
Merge branch 'bug/JAL-2154projectMappings' into develop

7 years agoMerge branch 'task/JAL-2164_mcviewforoldjalviewprojects' into develop
Jim Procter [Mon, 1 Aug 2016 13:00:19 +0000 (14:00 +0100)]
Merge branch 'task/JAL-2164_mcviewforoldjalviewprojects' into develop

7 years agoJAL-2164 prevent jalview news from opening task/JAL-2164_mcviewforoldjalviewprojects
Jim Procter [Mon, 1 Aug 2016 12:46:09 +0000 (13:46 +0100)]
JAL-2164 prevent jalview news from opening

7 years agoJAL-2164 clear the desktop before testStoreAndRecoverExpandedViews
Jim Procter [Mon, 1 Aug 2016 12:45:05 +0000 (13:45 +0100)]
JAL-2164 clear the desktop before testStoreAndRecoverExpandedViews

7 years agoMerge branch 'task/JAL-2164_mcviewforoldjalviewprojects' into develop
Jim Procter [Mon, 1 Aug 2016 10:54:34 +0000 (11:54 +0100)]
Merge branch 'task/JAL-2164_mcviewforoldjalviewprojects' into develop

7 years agoJAL-1772 make sure we actually return reference to AlignFrame that is visible after...
Jim Procter [Mon, 1 Aug 2016 07:49:54 +0000 (08:49 +0100)]
JAL-1772 make sure we actually return reference to AlignFrame that is visible after views are gathered

7 years agoJAL-1772 JAL-2164 make expanded view save/restore test pass when run in isolation...
Jim Procter [Fri, 29 Jul 2016 16:37:32 +0000 (17:37 +0100)]
JAL-1772 JAL-2164 make expanded view save/restore test pass when run in isolation (problem may be that load returns an alignFrame that isn’t actually the one shown in the desktop…)

7 years agoJAL-2164 JAL-1772 explodeViews can be static, so make it so
Jim Procter [Fri, 29 Jul 2016 16:36:51 +0000 (17:36 +0100)]
JAL-2164 JAL-1772 explodeViews can be static, so make it so

7 years agoJAL-1957 JAL-1479 updated SIFTS user docs
tcofoegbu [Fri, 29 Jul 2016 16:06:27 +0000 (17:06 +0100)]
JAL-1957 JAL-1479 updated SIFTS user docs

7 years agoJAL-2164 revert tests depending on import of legacy jalview projects
Jim Procter [Fri, 29 Jul 2016 15:07:38 +0000 (16:07 +0100)]
JAL-2164 revert tests depending on import of legacy jalview projects

7 years agoJAL-2154 disable visual delay only after completed import
Jim Procter [Fri, 29 Jul 2016 14:02:29 +0000 (15:02 +0100)]
JAL-2154 disable visual delay only after completed import

7 years agoJAL-2154 register any new dataset codon frames only when all data imported
Jim Procter [Fri, 29 Jul 2016 14:02:03 +0000 (15:02 +0100)]
JAL-2154 register any new dataset codon frames only when all data imported

7 years agoJAL-2154 only include mappings in dbref/alcodon in dataset XML
Jim Procter [Fri, 29 Jul 2016 14:01:07 +0000 (15:01 +0100)]
JAL-2154 only include mappings in dbref/alcodon in dataset XML

7 years agoJAL-2157 fixed Jalview2xmlTest
tcofoegbu [Fri, 29 Jul 2016 09:38:38 +0000 (10:38 +0100)]
JAL-2157 fixed Jalview2xmlTest

7 years agoJAL-2154 toString for forward references
Jim Procter [Wed, 27 Jul 2016 16:41:59 +0000 (17:41 +0100)]
JAL-2154 toString for forward references

7 years agoMerge branch 'patch/JAL-2156_JAL-2163_saveSplitFrameFromSaveAs_restoreTitles' into...
Jim Procter [Wed, 27 Jul 2016 13:57:40 +0000 (14:57 +0100)]
Merge branch 'patch/JAL-2156_JAL-2163_saveSplitFrameFromSaveAs_restoreTitles' into bug/JAL-2154projectMappings

7 years agoJAL-2163 set title for the alignframe from restored view state patch/JAL-2156_JAL-2163_saveSplitFrameFromSaveAs_restoreTitles
Jim Procter [Wed, 27 Jul 2016 09:29:09 +0000 (10:29 +0100)]
JAL-2163 set title for the alignframe from restored view state

7 years agoJAL-2156 resolve and add complementary views for saveAlignment
Jim Procter [Wed, 27 Jul 2016 10:57:24 +0000 (11:57 +0100)]
JAL-2156 resolve and add complementary views for saveAlignment

7 years agoJAL-2156 refactor saveState & saveAlignment to common method
Jim Procter [Wed, 27 Jul 2016 10:55:51 +0000 (11:55 +0100)]
JAL-2156 refactor saveState & saveAlignment to common method

7 years agoJAL-2156 getter for AlignFrame(s) held in a splitframe
Jim Procter [Wed, 27 Jul 2016 09:29:46 +0000 (10:29 +0100)]
JAL-2156 getter for AlignFrame(s) held in a splitframe

7 years agoMerge branch 'develop' of https://source.jalview.org/git/jalview into develop
tcofoegbu [Wed, 27 Jul 2016 12:02:46 +0000 (13:02 +0100)]
Merge branch 'develop' of https://source.jalview.org/git/jalview into develop

7 years agoJAL-1919 added codes for End-2-End scan for sequence consistency for PDB files parse...
tcofoegbu [Wed, 27 Jul 2016 12:02:07 +0000 (13:02 +0100)]
JAL-1919 added codes for End-2-End scan for sequence consistency for PDB files parse with JmolParser vs. Jalview's PDBfile parser

7 years agoJAL-2157 todo: verify parser/file format enums and static/dynamic status these fields
Jim Procter [Tue, 26 Jul 2016 11:59:31 +0000 (12:59 +0100)]
JAL-2157 todo: verify parser/file format enums and static/dynamic status these fields

7 years agoJAL-2157 bugfix for issues from enum refactoring
tcofoegbu [Tue, 26 Jul 2016 10:57:46 +0000 (11:57 +0100)]
JAL-2157 bugfix for issues from enum refactoring

7 years agoJAL-2157 bugfix for regression from commit 82a6c8e2e25b7534168b68b2c89b9cf195f815a5
tcofoegbu [Mon, 25 Jul 2016 14:05:01 +0000 (15:05 +0100)]
JAL-2157 bugfix for regression from commit 82a6c8e2e25b7534168b68b2c89b9cf195f815a5

7 years agoJAL-2154 formatting
Jim Procter [Sun, 24 Jul 2016 13:05:12 +0000 (14:05 +0100)]
JAL-2154 formatting

7 years agoJAL-2154 keep track of incomplete sequences and report if they weren’t resolved
Jim Procter [Sun, 24 Jul 2016 13:04:15 +0000 (14:04 +0100)]
JAL-2154 keep track of incomplete sequences and report if they weren’t resolved

7 years agoJAL-2154 systematic pattern for defining/resolving forward references to sequences
Jim Procter [Sun, 24 Jul 2016 12:58:45 +0000 (13:58 +0100)]
JAL-2154 systematic pattern for defining/resolving forward references to sequences

7 years agoJAL-2154 patch the hack (Jalview2XML tests pass)
Jim Procter [Sat, 23 Jul 2016 10:09:48 +0000 (11:09 +0100)]
JAL-2154 patch the hack (Jalview2XML tests pass)

7 years agoJAL-2148 Bugfix in structureImportSettings string-to-enum conversion and further...
tcofoegbu [Fri, 22 Jul 2016 16:13:53 +0000 (17:13 +0100)]
JAL-2148 Bugfix in structureImportSettings string-to-enum conversion and further enhancement to deal with Atoms from multi-model entries

7 years agoResolve merge conflict for StructureImportSettings
tcofoegbu [Thu, 21 Jul 2016 16:20:56 +0000 (17:20 +0100)]
Resolve merge conflict for StructureImportSettings

7 years agoJAL-2148 fix to heuristically determine chain termination positions. This aids in...
tcofoegbu [Thu, 21 Jul 2016 16:12:10 +0000 (17:12 +0100)]
JAL-2148 fix to heuristically determine chain termination positions. This aids in decision making w.r.t CA HETATMs inclusion

7 years agoMerge branch 'apifix/JAL-1926_JAL-2106' into develop
Jim Procter [Thu, 21 Jul 2016 12:03:21 +0000 (13:03 +0100)]
Merge branch 'apifix/JAL-1926_JAL-2106' into develop
JAL-1919 JAL-2148 regularise use of jalview.datamodel.PDBEntry.Type for PDB/mmCIF file type
JAL-1919 JAL-2148 use new enum jalview.structure.StructureImportSettings.StructureParser

7 years agoJAL-2154 poke JSeq start/end into Vamsas sequence
gmungoc [Wed, 20 Jul 2016 16:14:45 +0000 (17:14 +0100)]
JAL-2154 poke JSeq start/end into Vamsas sequence

7 years agoJAL-1926 JAL-2106 fix name for flag controlling addition of secondary structure annot...
Jim Procter [Wed, 20 Jul 2016 15:25:25 +0000 (16:25 +0100)]
JAL-1926 JAL-2106 fix name for flag controlling addition of secondary structure annotation from 3D data

7 years agoJAL-1926 JAL-2106 don’t use PDB database constant as a file format string
Jim Procter [Wed, 20 Jul 2016 15:19:08 +0000 (16:19 +0100)]
JAL-1926 JAL-2106 don’t use PDB database constant as a file format string

7 years agoJAL-1926 JAL-2106 use enum for ‘DEFAULT_STRUCTURE_FORMAT’ property values
Jim Procter [Wed, 20 Jul 2016 15:18:01 +0000 (16:18 +0100)]
JAL-1926 JAL-2106 use enum for ‘DEFAULT_STRUCTURE_FORMAT’ property values

7 years agoJAL-1926 JAL-2106 remove startRes/endRes fields - not used
Jim Procter [Wed, 20 Jul 2016 13:30:29 +0000 (14:30 +0100)]
JAL-1926 JAL-2106 remove startRes/endRes fields - not used

7 years agoJAL-2023 stronger check for whether to start cdna consensus
gmungoc [Wed, 20 Jul 2016 09:00:57 +0000 (10:00 +0100)]
JAL-2023 stronger check for whether to start cdna consensus

7 years agoJAL-2023 avoid writing / loading empty mappings
gmungoc [Wed, 20 Jul 2016 09:00:24 +0000 (10:00 +0100)]
JAL-2023 avoid writing / loading empty mappings

7 years agoJAL-2023 JAL-1681 fixed bug in computing '+' for co-modal codons
gmungoc [Wed, 20 Jul 2016 08:05:29 +0000 (09:05 +0100)]
JAL-2023 JAL-1681 fixed bug in computing '+' for co-modal codons

7 years agoJAL-2068 AnnotationWorker create/update annotation, not delete / re-add
gmungoc [Wed, 20 Jul 2016 05:09:01 +0000 (06:09 +0100)]
JAL-2068 AnnotationWorker create/update annotation, not delete / re-add

7 years agoJAL-2068 small refactor to reuse shared method
gmungoc [Tue, 19 Jul 2016 17:31:02 +0000 (18:31 +0100)]
JAL-2068 small refactor to reuse shared method

7 years agoJAL-2068 update rather than recreate AlignmentAnnotation on run()
gmungoc [Tue, 19 Jul 2016 17:30:24 +0000 (18:30 +0100)]
JAL-2068 update rather than recreate AlignmentAnnotation on run()

7 years agoJAL-391 corrected handling of gapped sequences
gmungoc [Tue, 19 Jul 2016 15:21:18 +0000 (16:21 +0100)]
JAL-391 corrected handling of gapped sequences

7 years agoMerge branch 'develop' of https://source.jalview.org/git/jalview into develop
tcofoegbu [Tue, 19 Jul 2016 11:49:48 +0000 (12:49 +0100)]
Merge branch 'develop' of https://source.jalview.org/git/jalview into develop

7 years agoJAL-1919 set default structure file format to mmCIF, refactored some StructureImportS...
tcofoegbu [Tue, 19 Jul 2016 11:49:35 +0000 (12:49 +0100)]
JAL-1919 set default structure file format to mmCIF, refactored some StructureImportSetting variables, removed mmCIF from DBRefSource, updated tests

7 years agoMerge branch 'develop' into efficiency/JAL-2034_JAL-1421
Jim Procter [Tue, 19 Jul 2016 10:20:03 +0000 (11:20 +0100)]
Merge branch 'develop' into efficiency/JAL-2034_JAL-1421

7 years agoMerge branch 'develop' of http://source.jalview.org/git/jalview into develop
Jim Procter [Mon, 18 Jul 2016 16:03:04 +0000 (17:03 +0100)]
Merge branch 'develop' of source.jalview.org/git/jalview into develop