JAL-2154 always check dataset sequence for sequence instance exists in dataset before adding it in AlignmentI.addSequence()

JAL-2154 patch verifyAlignment so it fails for duplicate entries for same SequenceI instance on alignment

JAL-2154 tidy assert messages and fix test to verify asserts were raised when expected

JAL-2154 test that verifyAlignment fails for duplicate entries for same SequenceI instance on alignment

JAL-2154 - possible patch .. but leads to new stringify difference:
expected to see below in dataset, but it doesn’t appear in recovered:
>ENSMUSP00000131873/1-222 ENSEMBL (Protein)
MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSS
KLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVP
VLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITL
ICYHSR

This is actually a duplicate sequence in dataset.. so difference may be due to normalisation when project file is written out

JAL-2154 major rejigging of test looping again
probably not 100% correct, but now fails when:

Recovered view for 'UNIPROT P01731 -> EMBL{1} -> ENSEMBL{0}' from '/var/folders/km/m8_86nbd4bbcpd5s2h8xqtk4_kj190/T/crossRefTest9144214145355720129.jvp'

Cause is:
Parsing as Jalview Version 2 file failed.
java.lang.ArrayIndexOutOfBoundsException: 73
at jalview.gui.Jalview2XML.loadFromObject(Jalview2XML.java:2827)
at jalview.gui.Jalview2XML.loadJalviewAlign(Jalview2XML.java:2390)
at jalview.gui.Jalview2XML.loadJalviewAlign(Jalview2XML.java:2277)
at jalview.io.FileLoader.run(FileLoader.java:308)
at java.lang.Thread.run(Thread.java:745)

JAL-2154 disable DAS sources for Jalview2XML tests

JAL-2154 fix looping structure so for a particular pass (either 2-pass: retrieve cross-ref+save/recover from project or one pass: retrieve cross-ref and compare string) we do all cross-refs or dbfetches in a pass.

JAL-2154 drop unused hashes

JAL-2154 testNG like assertAlignmentDatasetRefs static wrappers and allow a message to be passed to prefix any assert failed messages

JAL-2154 reorder the dataset sequences according to the dataset XML doc (which, perversely, is read after all views)

JAL-2154 belt-and-braces patch:
* when dataset XML doc is read in, all vamsasSet sequences should be processed in sync with the ‘view’ JSeq entries containing start/end metadata
* features, dbrefs and pdbentrys are now added direct to dataset sequences, but old behaviour should be preserved for reading alignment views containing dbrefs that get propagated to dataset.

JAL-2154 verify mapping’s sequenceI ref has been resolved for AlignedCodonFrame forward refs

JAL-2154 use right reference string for recovering saved project

JAL-2154 refactor setSequenceAt to replaceSequenceAt, fixed implementation and docs

JAL-2154 verify sequenceI/dataset refs for codonmappings

JAL-2154 make sure any new sequences via DBRefEntry->Mapping->To are added to dataset as cross-refs are resolved.

JAL-2154 check alignment isn’t null before validating

JAL-2154 always resolve dataset sequences when creating a mapping for a DBRefEntry

JAL-2154 [test] verify reference integrity for alignment/dataset after each retrieval/crossref view

JAL-2154 formatting

JAL-2154 new assert to check reference integrity for an alignment, and a dataset, and associated DBRefEntry mappings to other sequences

JAL-2154 xref test harness - test fails if there are differences between dataset/alignment/codonframes for views created from a sequence of cross-ref actions, and the same views after restoring from a jalview project.

Currently fails !

JAL-2154 refactor CrossRef UI code to its own class
JAL-2154 first pass of cross-ref + project save/restore test

JAL-2154 check if the desktop is constructed before trying to clear it !

JAL-2154 ignore all but the primary source resolved during programmatic invocation

JAL-2154 make sure we wait for constructor thread to finish

JAL-2154 clear the desktop before every 2xml test

JAL-2154 jalview.gui.SequenceFetcher.fetchAndShow(db,query) entry point for programmatically triggering a sequence fetch

JAL-2154 JAL-1993 relocate show dbchooser action out of jbInit

JAL-2154 refactor setup/teardown from Jalview2xml for other 2xml related tests

JAL-2154 add in missing class for createDatasetAlignment(), and add support for recovering position for an object in the set.

JAL-2154 make sure codon mappings between sequences discovered via database cross-reference matching are added to the codonframe.

JAL-2154 todo

JAL-2154 use convenience method

JAL-2154 make sure all sequences referenced via DBRefEntry->getMap()->getTo() are added to dataset when it is created

JAL-2110 comment on failing test (consider skipping for release ?)

JAL-2154 test for CDS->protein map

JAL-2046 stack trace for implementation warning

JAL-2008 handle fast mouse drag of feature ordering correctly

JAL-2015 convert Color from colour picker to FeatureColour

JAL-2046 additional logic to suppress spurious implementation-error warnings

Merge branch 'efficiency/JAL-2034_JAL-1421' into develop

JAL-2034 show greyed out image during overview update

Merge branch 'develop' into efficiency/JAL-2034_JAL-1421

JAL-2068 reinstated false return value for notifyWorking
  (prevents multiple worker threads starting when new view created)
 * documentation for AlignCalcManagerI

Merge branch 'develop' into efficiency/JAL-2034_JAL-1421

JAL-2164 TODO: make test pass for JMOL_PARSER

JAL-2164 JAL-1919 JAL-1270 use structure import settings to properly configure for test

Merge branch 'develop' of source.jalview.org/git/jalview into develop

JAL-2164 bugfix to convert insCodes of '\000' to ' ' in JmolParser, this fixes the xml marshalling bug

Merge branch 'bug/JAL-2154projectMappings' into develop

Merge branch 'task/JAL-2164_mcviewforoldjalviewprojects' into develop

JAL-2164 prevent jalview news from opening

JAL-2164 clear the desktop before testStoreAndRecoverExpandedViews

Merge branch 'task/JAL-2164_mcviewforoldjalviewprojects' into develop

JAL-1772 make sure we actually return reference to AlignFrame that is visible after views are gathered

JAL-1772 JAL-2164 make expanded view save/restore test pass when run in isolation (problem may be that load returns an alignFrame that isn’t actually the one shown in the desktop…)

JAL-2164 JAL-1772 explodeViews can be static, so make it so

JAL-1957 JAL-1479 updated SIFTS user docs

JAL-2164 revert tests depending on import of legacy jalview projects

JAL-2154 disable visual delay only after completed import

JAL-2154 register any new dataset codon frames only when all data imported

JAL-2154 only include mappings in dbref/alcodon in dataset XML

JAL-2157 fixed Jalview2xmlTest

JAL-2154 toString for forward references

Merge branch 'patch/JAL-2156_JAL-2163_saveSplitFrameFromSaveAs_restoreTitles' into bug/JAL-2154projectMappings

JAL-2163 set title for the alignframe from restored view state

JAL-2156 resolve and add complementary views for saveAlignment

JAL-2156 refactor saveState & saveAlignment to common method

JAL-2156 getter for AlignFrame(s) held in a splitframe

Merge branch 'develop' of https://source.jalview.org/git/jalview into develop

JAL-1919 added codes for End-2-End scan for sequence consistency for PDB files parse with JmolParser vs. Jalview's PDBfile parser

JAL-2157 todo: verify parser/file format enums and static/dynamic status these fields

JAL-2157 bugfix for issues from enum refactoring

JAL-2157 bugfix for regression from commit 82a6c8e2e25b7534168b68b2c89b9cf195f815a5

JAL-2154 formatting

JAL-2154 keep track of incomplete sequences and report if they weren’t resolved

JAL-2154 systematic pattern for defining/resolving forward references to sequences

JAL-2154 patch the hack (Jalview2XML tests pass)

JAL-2148 Bugfix in structureImportSettings string-to-enum conversion and further enhancement to deal with Atoms from multi-model entries

Resolve merge conflict for StructureImportSettings

JAL-2148 fix to heuristically determine chain termination positions. This aids in decision making w.r.t CA HETATMs inclusion

Merge branch 'apifix/JAL-1926_JAL-2106' into develop
JAL-1919 JAL-2148 regularise use of jalview.datamodel.PDBEntry.Type for PDB/mmCIF file type
JAL-1919 JAL-2148 use new enum jalview.structure.StructureImportSettings.StructureParser

JAL-2154 poke JSeq start/end into Vamsas sequence

JAL-1926 JAL-2106 fix name for flag controlling addition of secondary structure annotation from 3D data

JAL-1926 JAL-2106 don’t use PDB database constant as a file format string

JAL-1926 JAL-2106 use enum for ‘DEFAULT_STRUCTURE_FORMAT’ property values

JAL-1926 JAL-2106 remove startRes/endRes fields - not used

JAL-2023 stronger check for whether to start cdna consensus

JAL-2023 avoid writing / loading empty mappings

JAL-2023 JAL-1681 fixed bug in computing '+' for co-modal codons

JAL-2068 AnnotationWorker create/update annotation, not delete / re-add

JAL-2068 small refactor to reuse shared method

JAL-2068 update rather than recreate AlignmentAnnotation on run()

JAL-391 corrected handling of gapped sequences

Merge branch 'develop' of https://source.jalview.org/git/jalview into develop

JAL-1919 set default structure file format to mmCIF, refactored some StructureImportSetting variables, removed mmCIF from DBRefSource, updated tests

Merge branch 'develop' into efficiency/JAL-2034_JAL-1421

Merge branch 'develop' of source.jalview.org/git/jalview into develop