JAL-2154 updated testMakeCDSAlignment for expected propagate CDS behaviour (ahem - this should have been checked in *before* implementation!)

JAL-2154 propagate from contig to CDS after constructing CDS sequence, and only propagate refs with congruent mappings *and* corresponding mapping on protein product

JAL-2154 should only add mappings between dataset sequences

JAL-2154 - only copy DBRef from contig to new CDS sequence which involve same mapped region

Merge branch 'develop' into bug/JAL-2154projectMappings

Conflicts:
 src/jalview/gui/AlignFrame.java
  - pushed raise warning dialog to CrossRefAction
 test/jalview/analysis/AlignmentUtilsTests.java
  - simple merge
 test/jalview/io/Jalview2xmlTests.java
  - pushed updated BeforeClass setup to Jalview2xmlBase

JAL-2174 markColumns() refactored inside ColumnSelection

JAL-2154 - rejig test pass code for breadth-first (or top down) repetition of fetch/fetch crossref/fetch crossref.

* First iteration, all pass counters at zero, process through all crossrefs.
* Next iteration, pass1=1 - recover, process through all crossers
* Next iteration, pass2=1 - recover each first crossref result and process through
* Last iteration, pass3=1 - recover each second crossref result and process.

JAL-1448 corrected for backwards compatibility for UK locale users

JAL-2175 code tidying

JAL-2175 code/test fixes/tidy for PFAM/MSF/JSON roundtrip

JAL-2154 verify recovered xref sequence not already in dataset before adding it

JAL-2154 regression warning - should never recover a sequence ‘like’ an xref’s mapping.getTo() sequence!

JAL-2154 always check dataset sequence for sequence instance exists in dataset before adding it in AlignmentI.addSequence()

JAL-2154 patch verifyAlignment so it fails for duplicate entries for same SequenceI instance on alignment

JAL-2154 tidy assert messages and fix test to verify asserts were raised when expected

JAL-2154 test that verifyAlignment fails for duplicate entries for same SequenceI instance on alignment

JAL-2011 adjust method to fix failing unit test

JAL-2174 bug fixes + refactoring to allow + unit tests

JAL-2154 - possible patch .. but leads to new stringify difference:
expected to see below in dataset, but it doesn’t appear in recovered:
>ENSMUSP00000131873/1-222 ENSEMBL (Protein)
MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSS
KLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVP
VLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITL
ICYHSR

This is actually a duplicate sequence in dataset.. so difference may be due to normalisation when project file is written out

JAL-2154 major rejigging of test looping again
probably not 100% correct, but now fails when:

Recovered view for 'UNIPROT P01731 -> EMBL{1} -> ENSEMBL{0}' from '/var/folders/km/m8_86nbd4bbcpd5s2h8xqtk4_kj190/T/crossRefTest9144214145355720129.jvp'

Cause is:
Parsing as Jalview Version 2 file failed.
java.lang.ArrayIndexOutOfBoundsException: 73
at jalview.gui.Jalview2XML.loadFromObject(Jalview2XML.java:2827)
at jalview.gui.Jalview2XML.loadJalviewAlign(Jalview2XML.java:2390)
at jalview.gui.Jalview2XML.loadJalviewAlign(Jalview2XML.java:2277)
at jalview.io.FileLoader.run(FileLoader.java:308)
at java.lang.Thread.run(Thread.java:745)

JAL-2154 disable DAS sources for Jalview2XML tests

Merge branch 'develop' of https://source.jalview.org/git/jalview into develop

JAL-1803 unit test for PDB chainCode save/restore from Jalview project

JAL-2154 fix looping structure so for a particular pass (either 2-pass: retrieve cross-ref+save/recover from project or one pass: retrieve cross-ref and compare string) we do all cross-refs or dbfetches in a pass.

JAL-2154 drop unused hashes

JAL-2154 testNG like assertAlignmentDatasetRefs static wrappers and allow a message to be passed to prefix any assert failed messages

JAL-2154 reorder the dataset sequences according to the dataset XML doc (which, perversely, is read after all views)

JAL-2154 belt-and-braces patch:
* when dataset XML doc is read in, all vamsasSet sequences should be processed in sync with the ‘view’ JSeq entries containing start/end metadata
* features, dbrefs and pdbentrys are now added direct to dataset sequences, but old behaviour should be preserved for reading alignment views containing dbrefs that get propagated to dataset.

JAL-2154 verify mapping’s sequenceI ref has been resolved for AlignedCodonFrame forward refs

JAL-2154 use right reference string for recovering saved project

JAL-2154 refactor setSequenceAt to replaceSequenceAt, fixed implementation and docs

JAL-2077 using Platform method to check for Ctrl-down

JAL-1445 status message '...not containing...' for inverted selection

JAL-1693 show warning dialog if unable to make CDS for split frame

JAL-1855 fail gracefully if XML has no <sequence> element

JAL-2077 handling Cmd-click in scale panel for Mac / Windows

JAL-2001 return copy of selection in getSelected()

JAL-2146 status message now with formatted residue name / code

JAL-2173 don't remove annotation from hidden columns

JAL-2172 reverted to not sorting column selection

JAL-2105 rest versions updated to 4.6, change log link added

JAL-2172 handle case where column selection is not ordered

JAL-2154 verify sequenceI/dataset refs for codonmappings

JAL-2154 make sure any new sequences via DBRefEntry->Mapping->To are added to dataset as cross-refs are resolved.

JAL-2154 check alignment isn’t null before validating

JAL-2154 always resolve dataset sequences when creating a mapping for a DBRefEntry

JAL-2154 [test] verify reference integrity for alignment/dataset after each retrieval/crossref view

JAL-2172 unit test added

JAL-2154 formatting

JAL-2154 new assert to check reference integrity for an alignment, and a dataset, and associated DBRefEntry mappings to other sequences

JAL-2154 xref test harness - test fails if there are differences between dataset/alignment/codonframes for views created from a sequence of cross-ref actions, and the same views after restoring from a jalview project.

Currently fails !

JAL-1128 fix for truncated bottom boarder pixels in figures generated from wrapped alignment

JAL-1128 fix for truncated bottom boarder pixels in figures generated from wrapped alignment

Merge branch 'develop' of https://source.jalview.org/git/jalview into develop

JAL-1919 Added improvement to ensure consistence of annotations parsed via JmolParser vs PDBfile parser and fixed unit tests accordingly

JAL-2154 refactor CrossRef UI code to its own class
JAL-2154 first pass of cross-ref + project save/restore test

JAL-2154 check if the desktop is constructed before trying to clear it !

JAL-2154 ignore all but the primary source resolved during programmatic invocation

JAL-2154 make sure we wait for constructor thread to finish

JAL-2154 clear the desktop before every 2xml test

JAL-2154 jalview.gui.SequenceFetcher.fetchAndShow(db,query) entry point for programmatically triggering a sequence fetch

JAL-2154 JAL-1993 relocate show dbchooser action out of jbInit

JAL-2154 refactor setup/teardown from Jalview2xml for other 2xml related tests

JAL-2124 i18n of 'All' menu item

JAL-2124 i18n of "All" menu item

JAL-2146 small optimisation (avoid String creation)

JAL-2146 show Column no [Sequence no [Residue / pos]] on mouseover

JAL-1577 rebuild menus when secondary structure manually updated

replaced broken biojsmsa home link in jalveiw help

JAL-2119 replaced link with a non-404 alternative

JAL-2168 -nonews option also mentioned here

JAL-2119 updates to invalid / obsolete help links

JAL-2168 document '-nonews' parameter

JAL-2154 add in missing class for createDatasetAlignment(), and add support for recovering position for an object in the set.

JAL-2168 skip news feed if parameter "-nonews" is supplied

JAL-1448 always use UK locale for formatted date properties

JAL-2164 add transferred annotation to sequence

JAL-2154 make sure codon mappings between sequences discovered via database cross-reference matching are added to the codonframe.

JAL-2154 todo

JAL-2154 use convenience method

JAL-2154 make sure all sequences referenced via DBRefEntry->getMap()->getTo() are added to dataset when it is created

JAL-2110 comment on failing test (consider skipping for release ?)

JAL-2154 test for CDS->protein map

JAL-2046 stack trace for implementation warning

JAL-2164 changed to be Java 1.7 compliant

JAL-2008 handle fast mouse drag of feature ordering correctly

JAL-2015 convert Color from colour picker to FeatureColour

JAL-2046 additional logic to suppress spurious implementation-error warnings

Merge branch 'efficiency/JAL-2034_JAL-1421' into develop

JAL-2034 show greyed out image during overview update

Merge branch 'develop' into efficiency/JAL-2034_JAL-1421

JAL-2068 reinstated false return value for notifyWorking
  (prevents multiple worker threads starting when new view created)
 * documentation for AlignCalcManagerI

Merge branch 'develop' into efficiency/JAL-2034_JAL-1421

JAL-2164 TODO: make test pass for JMOL_PARSER

JAL-2164 JAL-1919 JAL-1270 use structure import settings to properly configure for test

Merge branch 'develop' of source.jalview.org/git/jalview into develop

JAL-2164 bugfix to convert insCodes of '\000' to ' ' in JmolParser, this fixes the xml marshalling bug

Merge branch 'bug/JAL-2154projectMappings' into develop

Merge branch 'task/JAL-2164_mcviewforoldjalviewprojects' into develop

JAL-2164 prevent jalview news from opening