2 * Jalview - A Sequence Alignment Editor and Viewer (Version 2.9.0b2)
3 * Copyright (C) 2015 The Jalview Authors
5 * This file is part of Jalview.
7 * Jalview is free software: you can redistribute it and/or
8 * modify it under the terms of the GNU General Public License
9 * as published by the Free Software Foundation, either version 3
10 * of the License, or (at your option) any later version.
12 * Jalview is distributed in the hope that it will be useful, but
13 * WITHOUT ANY WARRANTY; without even the implied warranty
14 * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
15 * PURPOSE. See the GNU General Public License for more details.
17 * You should have received a copy of the GNU General Public License
18 * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
19 * The Jalview Authors are detailed in the 'AUTHORS' file.
21 package jalview.datamodel;
23 import static org.testng.AssertJUnit.assertEquals;
24 import static org.testng.AssertJUnit.assertFalse;
26 import org.testng.annotations.Test;
29 * Unit tests for SeqCigar
31 public class SeqCigarTest
34 * refactored 'as is' from main method
36 * TODO: split into separate tests
38 @Test(groups = { "Functional" })
39 public void testSomething() throws Exception
41 String o_seq = "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt";
42 Sequence s = new Sequence("MySeq", o_seq, 39, 80);
43 String orig_gapped = "----asdf------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhttt";
44 Sequence s_gapped = new Sequence("MySeq", orig_gapped, 39, 80);
45 String ex_cs_gapped = "4I4M6I6M3I11M4I12M4I9M";
46 s_gapped.setDatasetSequence(s);
47 String sub_gapped_s = "------ktryas---dtqwrtsasll----dddptyipqqwa----slchvh";
48 Sequence s_subsequence_gapped = new Sequence("MySeq", sub_gapped_s, 43,
50 s_subsequence_gapped.setDatasetSequence(s);
52 SeqCigar c_null = new SeqCigar(s);
53 String cs_null = c_null.getCigarstring();
54 assertEquals("Failed to recover ungapped sequence cigar operations",
56 testCigar_string(s_gapped, ex_cs_gapped);
57 SeqCigar gen_sgapped = SeqCigar.parseCigar(s, ex_cs_gapped);
58 assertEquals("Failed parseCigar", ex_cs_gapped,
59 gen_sgapped.getCigarstring());
61 testSeqRecovery(gen_sgapped, s_gapped);
64 * Test dataset resolution
66 SeqCigar sub_gapped = new SeqCigar(s_subsequence_gapped);
67 testSeqRecovery(sub_gapped, s_subsequence_gapped);
70 * Test width functions
72 assertEquals("Failed getWidth", sub_gapped_s.length(),
73 sub_gapped.getWidth());
75 sub_gapped.getFullWidth();
76 assertFalse("hasDeletedRegions is incorrect",
77 sub_gapped.hasDeletedRegions());
79 // Test start-end region SeqCigar
80 SeqCigar sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48);
82 "SeqCigar(seq, start, end) not properly clipped alignsequence",
83 41, sub_se_gp.getWidth());
86 * TODO: can we add assertions to the sysouts that follow?
88 System.out.println("Original sequence align:\n" + sub_gapped_s
89 + "\nReconstructed window from 8 to 48\n" + "XXXXXXXX"
90 + sub_se_gp.getSequenceString('-') + "..." + "\nCigar String:"
91 + sub_se_gp.getCigarstring() + "\n");
92 SequenceI ssgp = sub_se_gp.getSeq('-');
93 System.out.println("\t " + ssgp.getSequenceAsString());
94 for (int r = 0; r < 10; r++)
96 sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48);
97 int sl = sub_se_gp.getWidth();
99 for (int rs = 0; rs < 10; rs++)
102 sub_se_gp.deleteRange(st, e);
103 String ssgapedseq = sub_se_gp.getSeq('-').getSequenceAsString();
104 System.out.println(st + "," + e + "\t:" + ssgapedseq);
109 SeqCigar[] set = new SeqCigar[] { new SeqCigar(s),
110 new SeqCigar(s_subsequence_gapped, 8, 48), new SeqCigar(s_gapped) };
111 Alignment al = new Alignment(set);
112 for (int i = 0; i < al.getHeight(); i++)
114 System.out.println("" + al.getSequenceAt(i).getName() + "\t"
115 + al.getSequenceAt(i).getStart() + "\t"
116 + al.getSequenceAt(i).getEnd() + "\t"
117 + al.getSequenceAt(i).getSequenceAsString());
120 System.out.println("Gapped.");
121 set = new SeqCigar[] { new SeqCigar(s),
122 new SeqCigar(s_subsequence_gapped, 8, 48), new SeqCigar(s_gapped) };
123 set[0].deleteRange(20, 25);
124 al = new Alignment(set);
125 for (int i = 0; i < al.getHeight(); i++)
127 System.out.println("" + al.getSequenceAt(i).getName() + "\t"
128 + al.getSequenceAt(i).getStart() + "\t"
129 + al.getSequenceAt(i).getEnd() + "\t"
130 + al.getSequenceAt(i).getSequenceAsString());
133 // if (!ssgapedseq.equals("ryas---dtqqwa----slchvh"))
134 // System.err.println("Subseqgaped\n------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhryas---dtqwrtsasll--qwa----slchvh\n"+ssgapedseq+"\n"+sub_se_gp.getCigarstring());
138 * non rigorous testing
142 * @param ex_cs_gapped
147 protected void testCigar_string(Sequence seq, String ex_cs_gapped)
149 SeqCigar c_sgapped = new SeqCigar(seq);
150 String cs_gapped = c_sgapped.getCigarstring();
151 assertEquals("Failed getCigarstring", ex_cs_gapped, cs_gapped);
154 protected void testSeqRecovery(SeqCigar gen_sgapped, SequenceI s_gapped)
156 // this is non-rigorous - start and end recovery is not tested.
157 SequenceI gen_sgapped_s = gen_sgapped.getSeq('-');
158 // assertEquals("Couldn't reconstruct sequence", s_gapped.getSequence(),
160 if (!gen_sgapped_s.getSequence().equals(s_gapped.getSequence()))
162 // TODO: investigate errors reported here, to allow full conversion to
163 // passing JUnit assertion form
164 System.err.println("Couldn't reconstruct sequence.\n"
165 + gen_sgapped_s.getSequenceAsString() + "\n"
166 + s_gapped.getSequenceAsString());