2 * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
3 * Copyright (C) $$Year-Rel$$ The Jalview Authors
5 * This file is part of Jalview.
7 * Jalview is free software: you can redistribute it and/or
8 * modify it under the terms of the GNU General Public License
9 * as published by the Free Software Foundation, either version 3
10 * of the License, or (at your option) any later version.
12 * Jalview is distributed in the hope that it will be useful, but
13 * WITHOUT ANY WARRANTY; without even the implied warranty
14 * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
15 * PURPOSE. See the GNU General Public License for more details.
17 * You should have received a copy of the GNU General Public License
18 * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
19 * The Jalview Authors are detailed in the 'AUTHORS' file.
23 import static org.testng.AssertJUnit.assertNotNull;
25 import jalview.api.AlignExportSettingI;
26 import jalview.datamodel.Alignment;
27 import jalview.datamodel.AlignmentAnnotation;
28 import jalview.datamodel.AlignmentI;
29 import jalview.datamodel.Annotation;
30 import jalview.datamodel.ColumnSelection;
31 import jalview.datamodel.Sequence;
32 import jalview.datamodel.SequenceFeature;
33 import jalview.datamodel.SequenceGroup;
34 import jalview.datamodel.SequenceI;
35 import jalview.gui.AlignFrame;
36 import jalview.gui.JvOptionPane;
37 import jalview.json.binding.biojson.v1.ColourSchemeMapper;
38 import jalview.schemes.ColourSchemeI;
40 import java.io.IOException;
41 import java.util.ArrayList;
42 import java.util.HashMap;
43 import java.util.List;
45 import org.testng.Assert;
46 import org.testng.AssertJUnit;
47 import org.testng.annotations.AfterTest;
48 import org.testng.annotations.BeforeClass;
49 import org.testng.annotations.BeforeMethod;
50 import org.testng.annotations.BeforeTest;
51 import org.testng.annotations.Test;
53 public class JSONFileTest
56 @BeforeClass(alwaysRun = true)
57 public void setUpJvOptionPane()
59 JvOptionPane.setInteractiveMode(false);
60 JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
63 private int TEST_SEQ_HEIGHT = 0;
65 private int TEST_GRP_HEIGHT = 0;
67 private int TEST_ANOT_HEIGHT = 0;
69 private int TEST_CS_HEIGHT = 0;
71 private String TEST_JSON_FILE = "examples/example.json";
73 private Alignment alignment;
75 private HashMap<String, SequenceI> expectedSeqs = new HashMap<String, SequenceI>();
77 private HashMap<String, AlignmentAnnotation> expectedAnnots = new HashMap<String, AlignmentAnnotation>();
79 private HashMap<String, SequenceGroup> expectedGrps = new HashMap<String, SequenceGroup>();
81 private ColumnSelection expectedColSel = new ColumnSelection();
83 private SequenceI[] expectedHiddenSeqs = new SequenceI[1];
85 private AlignmentI testAlignment;
87 private int passedCount;
89 private JSONFile testJsonFile;
93 @BeforeTest(alwaysRun = true)
94 public void setup() throws Exception
96 // create and add sequences
97 Sequence[] seqs = new Sequence[5];
98 seqs[0] = new Sequence("FER_CAPAN",
99 "SVSATMISTSFMPRKPAVTSL-KPIPNVGE--ALF", 3, 34);
100 seqs[1] = new Sequence("FER1_SOLLC",
101 "SISGTMISTSFLPRKPAVTSL-KAISNVGE--ALF", 3, 34);
102 seqs[2] = new Sequence("Q93XJ9_SOLTU",
103 "SISGTMISTSFLPRKPVVTSL-KAISNVGE--ALF", 3, 34);
104 seqs[3] = new Sequence("FER1_PEA",
105 "ALYGTAVSTSFLRTQPMPMSV-TTTKAFSN--GFL", 6, 37);
106 seqs[4] = new Sequence("Q7XA98_TRIPR",
107 "ALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGF", 6, 39);
109 SequenceI hiddenSeq = new Sequence("FER_TOCH",
110 "FILGTMISKSFLFRKPAVTSL-KAISNVGE--ALF", 3, 34);
111 expectedHiddenSeqs[0] = hiddenSeq;
113 // create and add sequence features
114 SequenceFeature seqFeature2 = new SequenceFeature("feature_x",
115 "desciption", "status", 6, 15, "Jalview");
116 SequenceFeature seqFeature3 = new SequenceFeature("feature_x",
117 "desciption", "status", 9, 18, "Jalview");
118 SequenceFeature seqFeature4 = new SequenceFeature("feature_x",
119 "desciption", "status", 9, 18, "Jalview");
120 seqs[2].addSequenceFeature(seqFeature2);
121 seqs[3].addSequenceFeature(seqFeature3);
122 seqs[4].addSequenceFeature(seqFeature4);
124 for (Sequence seq : seqs)
126 seq.createDatasetSequence();
127 expectedSeqs.put(seq.getName(), seq);
130 // create and add sequence groups
131 ArrayList<SequenceI> grpSeqs = new ArrayList<SequenceI>();
132 grpSeqs.add(seqs[1]);
133 grpSeqs.add(seqs[2]);
134 grpSeqs.add(seqs[3]);
135 grpSeqs.add(seqs[4]);
136 SequenceGroup seqGrp = new SequenceGroup(grpSeqs, "JGroup:1883305585",
137 null, true, true, false, 21, 29);
138 ColourSchemeI scheme = ColourSchemeMapper.getJalviewColourScheme(
141 seqGrp.setShowNonconserved(false);
142 seqGrp.setDescription(null);
144 expectedGrps.put(seqGrp.getName(), seqGrp);
146 // create and add annotation
147 Annotation[] annot = new Annotation[35];
148 annot[0] = new Annotation("", "", '\u0000', 0);
149 annot[1] = new Annotation("", "", '\u0000', 0);
150 annot[2] = new Annotation("α", "", 'H', 0);
151 annot[3] = new Annotation("α", "", 'H', 0);
152 annot[4] = new Annotation("α", "", 'H', 0);
153 annot[5] = new Annotation("", "", '\u0000', 0);
154 annot[6] = new Annotation("", "", '\u0000', 0);
155 annot[7] = new Annotation("", "", '\u0000', 0);
156 annot[8] = new Annotation("β", "", 'E', 0);
157 annot[9] = new Annotation("β", "", 'E', 0);
158 annot[10] = new Annotation("β", "", 'E', 0);
159 annot[11] = new Annotation("β", "", 'E', 0);
160 annot[12] = new Annotation("β", "", 'E', 0);
161 annot[13] = new Annotation("β", "", 'E', 0);
162 annot[14] = new Annotation("β", "", 'E', 0);
163 annot[15] = new Annotation("β", "", 'E', 0);
164 annot[16] = new Annotation("", "", '\u0000', 0);
165 annot[17] = new Annotation("", "", '\u0000', 0);
166 annot[18] = new Annotation("", "", '\u0000', 0);
167 annot[19] = new Annotation("", "", '\u0000', 0);
168 annot[20] = new Annotation("", "", '\u0000', 0);
169 annot[21] = new Annotation("", "", '\u0000', 0);
170 annot[22] = new Annotation("", "", '\u0000', 0);
171 annot[23] = new Annotation("", "", '\u0000', 0);
172 annot[24] = new Annotation("", "", '\u0000', 0);
173 annot[25] = new Annotation("", "", '\u0000', 0);
174 annot[26] = new Annotation("α", "", 'H', 0);
175 annot[27] = new Annotation("α", "", 'H', 0);
176 annot[28] = new Annotation("α", "", 'H', 0);
177 annot[29] = new Annotation("α", "", 'H', 0);
178 annot[30] = new Annotation("α", "", 'H', 0);
179 annot[31] = new Annotation("", "", '\u0000', 0);
180 annot[32] = new Annotation("", "", '\u0000', 0);
181 annot[33] = new Annotation("", "", '\u0000', 0);
182 annot[34] = new Annotation("", "", '\u0000', 0);
184 AlignmentAnnotation alignAnnot = new AlignmentAnnotation(
185 "Secondary Structure", "New description", annot);
186 expectedAnnots.put(alignAnnot.label, alignAnnot);
188 expectedColSel.hideColumns(32, 33);
189 expectedColSel.hideColumns(34, 34);
191 TEST_SEQ_HEIGHT = expectedSeqs.size();
192 TEST_GRP_HEIGHT = expectedGrps.size();
193 TEST_ANOT_HEIGHT = expectedAnnots.size();
194 TEST_CS_HEIGHT = expectedColSel.getHiddenColumns().size();
196 AlignExportSettingI exportSettings = new AlignExportSettingI()
199 public boolean isExportHiddenSequences()
205 public boolean isExportHiddenColumns()
211 public boolean isExportGroups()
217 public boolean isExportFeatures()
223 public boolean isExportAnnotations()
229 public boolean isCancelled()
235 AppletFormatAdapter formatAdapter = new AppletFormatAdapter();
238 alignment = (Alignment) formatAdapter.readFile(TEST_JSON_FILE,
239 AppletFormatAdapter.FILE, JSONFile.FILE_DESC);
240 jf = (JSONFile) formatAdapter.getAlignFile();
242 AlignFrame af = new AlignFrame(alignment, jf.getHiddenSequences(),
243 jf.getColumnSelection(), AlignFrame.DEFAULT_WIDTH,
244 AlignFrame.DEFAULT_HEIGHT);
245 af.getViewport().setShowSequenceFeatures(jf.isShowSeqFeatures());
246 String colourSchemeName = jf.getGlobalColourScheme();
247 ColourSchemeI cs = ColourSchemeMapper.getJalviewColourScheme(
248 colourSchemeName, alignment);
250 af.getViewport().setFeaturesDisplayed(jf.getDisplayedFeatures());
252 formatAdapter = new AppletFormatAdapter(af.alignPanel, exportSettings);
253 String jsonOutput = formatAdapter.formatSequences(JSONFile.FILE_DESC,
254 af.alignPanel.getAlignment(), false);
256 formatAdapter = new AppletFormatAdapter();
257 testAlignment = formatAdapter.readFile(jsonOutput,
258 AppletFormatAdapter.PASTE, JSONFile.FILE_DESC);
259 testJsonFile = (JSONFile) formatAdapter.getAlignFile();
260 // System.out.println(jsonOutput);
261 } catch (IOException e)
268 @BeforeMethod(alwaysRun = true)
269 public void methodSetup()
274 @AfterTest(alwaysRun = true)
275 public void tearDown() throws Exception
280 expectedAnnots = null;
282 testAlignment = null;
286 @Test(groups = { "Functional" })
287 public void roundTripTest()
289 assertNotNull("JSON roundtrip test failed!", testJsonFile);
292 @Test(groups = { "Functional" })
293 public void testSeqParsed()
295 assertNotNull("Couldn't read supplied alignment data.", testAlignment);
296 Assert.assertNotNull(testAlignment.getSequences());
297 for (SequenceI seq : testAlignment.getSequences())
299 SequenceI expectedSeq = expectedSeqs.get(seq.getName());
300 AssertJUnit.assertTrue(
301 "Failed Sequence Test for >>> " + seq.getName(),
302 isSeqMatched(expectedSeq, seq));
305 AssertJUnit.assertEquals("Some Sequences did not pass the test",
306 TEST_SEQ_HEIGHT, passedCount);
309 @Test(groups = { "Functional" })
310 public void hiddenColsTest()
312 ColumnSelection cs = testJsonFile.getColumnSelection();
313 Assert.assertNotNull(cs);
314 Assert.assertNotNull(cs.getHiddenColumns());
315 List<int[]> hiddenCols = cs.getHiddenColumns();
316 Assert.assertEquals(hiddenCols.size(), TEST_CS_HEIGHT);
317 Assert.assertEquals(hiddenCols.get(0), expectedColSel
318 .getHiddenColumns().get(0),
319 "Mismatched hidden columns!");
322 @Test(groups = { "Functional" })
323 public void hiddenSeqsTest()
325 Assert.assertNotNull(testJsonFile.getHiddenSequences(),
326 "Hidden sequence Expected but found Null");
327 Assert.assertEquals(jf.getHiddenSequences().length, 1,
331 @Test(groups = { "Functional" })
332 public void colorSchemeTest()
334 Assert.assertNotNull(testJsonFile.getGlobalColourScheme(),
335 "Colourscheme is null, parsing failed!");
336 Assert.assertEquals(testJsonFile.getGlobalColourScheme(), "Zappo",
337 "Zappo colour scheme expected!");
340 @Test(groups = { "Functional" })
341 public void isShowSeqFeaturesSet()
343 Assert.assertTrue(testJsonFile.isShowSeqFeatures(),
344 "Sequence feature isDisplayed setting expected to be true");
347 @Test(groups = { "Functional" })
348 public void testGrpParsed()
350 Assert.assertNotNull(testAlignment.getGroups());
351 for (SequenceGroup seqGrp : testAlignment.getGroups())
353 SequenceGroup expectedGrp = expectedGrps.get(seqGrp.getName());
354 AssertJUnit.assertTrue(
355 "Failed SequenceGroup Test for >>> " + seqGrp.getName(),
356 isGroupMatched(expectedGrp, seqGrp));
359 AssertJUnit.assertEquals("Some SequenceGroups did not pass the test",
360 TEST_GRP_HEIGHT, passedCount);
363 @Test(groups = { "Functional" })
364 public void testAnnotationParsed()
366 Assert.assertNotNull(testAlignment.getAlignmentAnnotation());
367 for (AlignmentAnnotation annot : testAlignment.getAlignmentAnnotation())
369 AlignmentAnnotation expectedAnnot = expectedAnnots.get(annot.label);
370 AssertJUnit.assertTrue("Failed AlignmentAnnotation Test for >>> "
371 + annot.label, isAnnotationMatched(expectedAnnot, annot));
374 AssertJUnit.assertEquals("Some Sequences did not pass the test",
375 TEST_ANOT_HEIGHT, passedCount);
378 public boolean isAnnotationMatched(AlignmentAnnotation eAnnot,
379 AlignmentAnnotation annot)
381 if (!eAnnot.label.equals(annot.label)
382 || !eAnnot.description.equals(annot.description)
383 || eAnnot.annotations.length != annot.annotations.length)
388 for (int x = 0; x < annot.annotations.length; x++)
390 Annotation y = annot.annotations[x];
391 Annotation z = annot.annotations[x];
393 if (!y.displayCharacter.equals(z.displayCharacter)
394 || y.value != z.value
395 || y.secondaryStructure != z.secondaryStructure)
403 public boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq)
405 System.out.println("Testing >>> " + actualSeq.getName());
407 if (expectedSeq.getName().equals(actualSeq.getName())
408 && expectedSeq.getSequenceAsString().equals(
409 actualSeq.getSequenceAsString())
410 && expectedSeq.getStart() == actualSeq.getStart()
411 && expectedSeq.getEnd() == actualSeq.getEnd()
412 && featuresMatched(expectedSeq, actualSeq))
419 public boolean isGroupMatched(SequenceGroup expectedGrp,
420 SequenceGroup actualGrp)
423 System.out.println("Testing >>> " + actualGrp.getName());
424 System.out.println(expectedGrp.getName() + " | " + actualGrp.getName());
425 System.out.println(expectedGrp.getColourText() + " | "
426 + actualGrp.getColourText());
427 System.out.println(expectedGrp.getDisplayBoxes() + " | "
428 + actualGrp.getDisplayBoxes());
429 System.out.println(expectedGrp.getIgnoreGapsConsensus() + " | "
430 + actualGrp.getIgnoreGapsConsensus());
431 System.out.println(expectedGrp.getSequences().size() + " | "
432 + actualGrp.getSequences().size());
433 System.out.println(expectedGrp.getStartRes() + " | "
434 + actualGrp.getStartRes());
435 System.out.println(expectedGrp.getEndRes() + " | "
436 + actualGrp.getEndRes());
437 System.out.println(expectedGrp.cs + " | " + actualGrp.cs);
439 if (expectedGrp.getName().equals(actualGrp.getName())
440 && expectedGrp.getColourText() == actualGrp.getColourText()
441 && expectedGrp.getDisplayBoxes() == actualGrp.getDisplayBoxes()
442 && expectedGrp.getIgnoreGapsConsensus() == actualGrp
443 .getIgnoreGapsConsensus()
444 && (expectedGrp.cs.getClass().equals(actualGrp.cs.getClass()))
445 && expectedGrp.getSequences().size() == actualGrp
446 .getSequences().size()
447 && expectedGrp.getStartRes() == actualGrp.getStartRes()
448 && expectedGrp.getEndRes() == actualGrp.getEndRes())
455 private boolean featuresMatched(SequenceI seq1, SequenceI seq2)
457 boolean matched = false;
460 if (seq1 == null && seq2 == null)
465 SequenceFeature[] inFeature = seq1.getSequenceFeatures();
466 SequenceFeature[] outFeature = seq2.getSequenceFeatures();
468 if (inFeature == null && outFeature == null)
472 else if ((inFeature == null && outFeature != null)
473 || (inFeature != null && outFeature == null))
478 int testSize = inFeature.length;
479 int matchedCount = 0;
480 for (SequenceFeature in : inFeature)
482 for (SequenceFeature out : outFeature)
484 System.out.println(out.getType() + " | " + in.getType());
485 System.out.println(out.getBegin() + " | " + in.getBegin());
486 System.out.println(out.getEnd() + " | " + in.getEnd());
488 if (inFeature.length == outFeature.length
489 && in.getBegin() == out.getBegin()
490 && in.getEnd() == out.getEnd()
491 && in.getScore() == out.getScore()
492 && in.getFeatureGroup().equals(out.getFeatureGroup())
493 && in.getType().equals(out.getType()))
500 System.out.println("matched count >>>>>> " + matchedCount);
501 if (testSize == matchedCount)
505 } catch (Exception e)
509 // System.out.println(">>>>>>>>>>>>>> features matched : " + matched);