resolved merge conflict

diff --git a/examples/testdata/phyre2results/56da5616b4559c93/allhits.ann b/examples/testdata/phyre2results/56da5616b4559c93/allhits.ann
index 2fc6ceb..096c597 100644 (file)
--- a/examples/testdata/phyre2results/56da5616b4559c93/allhits.ann
+++ b/examples/testdata/phyre2results/56da5616b4559c93/allhits.ann
@@ -20,4 +20,4 @@ STRUCTMODEL   FER_CAPAN_1-144 c1krhA_ c1krhA_.16.pdb  c1krhA_.16.fasta        0.999   25      48-
 STRUCTMODEL    FER_CAPAN_1-144 d1krha3 d1krha3.17.pdb  d1krha3.17.fasta        0.999   24      48-143  <b>Fold: </b>Beta-Grasp (ubiquitin-like)<br><b>Superfamily: </b>2Fe-2S ferredoxin-like<br><b>Family: </b>2Fe-2S ferredoxin domains from multi domain proteins
 STRUCTMODEL    FER_CAPAN_1-144 d1jq4a_ d1jq4a_.18.pdb  d1jq4a_.18.fasta        0.999   29      47-138  <b>Fold: </b>Beta-Grasp (ubiquitin-like)<br><b>Superfamily: </b>2Fe-2S ferredoxin-like<br><b>Family: </b>2Fe-2S ferredoxin domains from multi domain proteins
 STRUCTMODEL    FER_CAPAN_1-144 c4wqmA_ c4wqmA_.19.pdb  c4wqmA_.19.fasta        0.999   28      49-144  <b>PDB header: </b>Oxidoreductase<br><b>Chain: </b>A<br><b>PDB Molecule: </b>Toluene-4-monooxygenase electron transfer component<br><b>PDB Title: </b>Structure of the toluene 4-monooxygenase nah oxidoreductase t4mof,2 k270s k271s variant
-STRUCTMODEL    FER_CAPAN_1-144 c2piaA_ c2piaA_.20.pdb  c2piaA_.20.fasta        0.999   22      1-136   <b>PDB header: </b>Reductase<br><b>Chain: </b>A<br><b>PDB Molecule: </b>Phthalate deoxygenase reductase<br><b>PDB Title: </b>Phthalate deoxygenate reductase: a modular structure for2 electron transfer from pyridine nucleotides to [2fe-2s]
+STRUCTMODEL    FER_CAPAN_1-144 c2piaA_ c2piaA_.20.pdb  c2piaA_.20.fasta        0.999   22      1-136   <b>PDB header: </b>Reductase<br><b>Chain: </b>A<br><b>PDB Molecule: </b>Phthalate deoxygenase reductase<br><b>PDB Title: </b>Phthalate deoxygenate reductase: a modular structure for2 electron transfer from pyridine nucleotides to [2fe-2s]
\ No newline at end of file

diff --git a/examples/testdata/phyre2results/56da5616b4559c93/c1krhA_.1.fasta b/examples/testdata/phyre2results/56da5616b4559c93/c1krhA_.16.fasta
similarity index 100%
rename from examples/testdata/phyre2results/56da5616b4559c93/c1krhA_.1.fasta
rename to examples/testdata/phyre2results/56da5616b4559c93/c1krhA_.16.fasta

diff --git a/src/jalview/structure/AtomSpec.java b/src/jalview/structure/AtomSpec.java
index f20cd31..54e2261 100644 (file)
--- a/src/jalview/structure/AtomSpec.java
+++ b/src/jalview/structure/AtomSpec.java
@@ -88,8 +88,12 @@ public class AtomSpec
       throw new IllegalArgumentException(spec);
     }
 
-    String chainId = dotPos == -1 ? "" : residueChain.substring(dotPos + 1);
-
+    String chainId = dotPos == -1 ? " " : residueChain
+            .substring(dotPos + 1);
+    if (chainId.length() == 0)
+    {
+      chainId = " ";
+    }
     return new AtomSpec(modelId, chainId, resNum, 0);
   }
 

diff --git a/src/jalview/structure/StructureMapping.java b/src/jalview/structure/StructureMapping.java
index 40789ed..b8a0fc6 100644 (file)
--- a/src/jalview/structure/StructureMapping.java
+++ b/src/jalview/structure/StructureMapping.java
@@ -26,9 +26,22 @@ import jalview.datamodel.SequenceI;
 import java.util.ArrayList;
 import java.util.HashMap;
 import java.util.List;
+import java.util.Map.Entry;
 
 public class StructureMapping
 {
+  public static final int UNASSIGNED = -1;
+
+  public static final int PDB_RES_NUM_INDEX = 0;
+
+  public static final int PDB_ATOM_NUM_INDEX = 1;
+
+  /**
+   * Space character constant, for consistent representation when no chain
+   * specified
+   */
+  public static String NO_CHAIN = " ";
+
   String mappingDetails;
 
   SequenceI sequence;
@@ -39,12 +52,6 @@ public class StructureMapping
 
   String pdbchain;
 
-  public static final int UNASSIGNED_VALUE = -1;
-
-  private static final int PDB_RES_NUM_INDEX = 0;
-
-  private static final int PDB_ATOM_NUM_INDEX = 1;
-
   // Mapping key is residue index while value is an array containing PDB resNum,
   // and atomNo
   HashMap<Integer, int[]> mapping;
@@ -89,39 +96,31 @@ public class StructureMapping
   }
 
   /**
+   * Answers the structure atom number mapped to the given sequence position, or
+   * -1 if no mapping
    * 
    * @param seqpos
-   * @return 0 or corresponding atom number for the sequence position
+   * @return
    */
   public int getAtomNum(int seqpos)
   {
     int[] resNumAtomMap = mapping.get(seqpos);
-    if (resNumAtomMap != null)
-    {
-      return resNumAtomMap[PDB_ATOM_NUM_INDEX];
-    }
-    else
-    {
-      return UNASSIGNED_VALUE;
-    }
+    return (resNumAtomMap == null ? UNASSIGNED
+            : resNumAtomMap[PDB_ATOM_NUM_INDEX]);
   }
 
   /**
+   * Answers the structure residue number mapped to the given sequence position,
+   * or -1 if no mapping
    * 
    * @param seqpos
-   * @return 0 or the corresponding residue number for the sequence position
+   * @return
    */
   public int getPDBResNum(int seqpos)
   {
     int[] resNumAtomMap = mapping.get(seqpos);
-    if (resNumAtomMap != null)
-    {
-      return resNumAtomMap[PDB_RES_NUM_INDEX];
-    }
-    else
-    {
-      return UNASSIGNED_VALUE;
-    }
+    return (resNumAtomMap == null ? UNASSIGNED
+            : resNumAtomMap[PDB_RES_NUM_INDEX]);
   }
 
   /**
@@ -141,7 +140,7 @@ public class StructureMapping
     for (int i = fromSeqPos; i <= toSeqPos; i++)
     {
       int resNo = getPDBResNum(i);
-      if (resNo == UNASSIGNED_VALUE)
+      if (resNo == UNASSIGNED)
       {
         continue; // no mapping from this sequence position
       }
@@ -189,20 +188,22 @@ public class StructureMapping
   }
 
   /**
+   * Answers the sequence position mapped to the given structure residue number,
+   * or -1 if no mapping is found
    * 
    * @param pdbResNum
-   * @return -1 or the corresponding sequence position for a pdb residue number
+   * @return
    */
   public int getSeqPos(int pdbResNum)
   {
-    for (Integer seqPos : mapping.keySet())
+    for (Entry<Integer, int[]> map : mapping.entrySet())
     {
-      if (pdbResNum == getPDBResNum(seqPos))
+      if (pdbResNum == map.getValue()[PDB_RES_NUM_INDEX])
       {
-        return seqPos;
+        return map.getKey();
       }
     }
-    return UNASSIGNED_VALUE;
+    return UNASSIGNED;
   }
 
   /**
@@ -243,8 +244,4 @@ public class StructureMapping
     return mappingDetails;
   }
 
-  public HashMap<Integer, int[]> getMapping()
-  {
-    return mapping;
-  }
 }

diff --git a/src/jalview/structure/StructureMappingClient.java b/src/jalview/structure/StructureMappingClient.java
index 1e78c3c..bcc4d46 100644 (file)
--- a/src/jalview/structure/StructureMappingClient.java
+++ b/src/jalview/structure/StructureMappingClient.java
@@ -4,26 +4,36 @@ import jalview.datamodel.SequenceI;
 import jalview.io.StructureFile;
 import jalview.structures.models.MappingOutputModel;
 
+import java.util.ArrayList;
 import java.util.Collection;
+import java.util.List;
 import java.util.Map;
+import java.util.Map.Entry;
 
 import MCview.Atom;
 import MCview.PDBChain;
 
 public abstract class StructureMappingClient
 {
-
   protected StructureFile structureFile;
 
-  public static final int UNASSIGNED = -1;
-
-  private static final int PDB_RES_POS = 0;
+  private static final int PDB_RES_POS = StructureMapping.PDB_RES_NUM_INDEX; // 0
 
-  private static final int PDB_ATOM_POS = 1;
+  private static final int PDB_ATOM_POS = StructureMapping.PDB_ATOM_NUM_INDEX; // 1
 
+  /**
+   * Populates the atom positions mapped to by finding the atom number (if any)
+   * for each structure residue number in the map. If no atom is found (as is
+   * the case for residues missing in a PDB file), then deletes the residue from
+   * the map.
+   * 
+   * @param chainId
+   * @param mapping
+   * @throws IllegalArgumentException
+   * @throws StructureMappingException
+   */
   public void populateAtomPositions(String chainId,
-          Map<Integer, int[]> mapping)
- throws IllegalArgumentException,
+          Map<Integer, int[]> mapping) throws IllegalArgumentException,
           StructureMappingException
   {
     try
@@ -35,13 +45,31 @@ public abstract class StructureMappingClient
         throw new IllegalArgumentException(
                 "Chain id or mapping must not be null.");
       }
-      for (int[] map : mapping.values())
+
+      List<Integer> notFound = new ArrayList<Integer>();
+      for (Entry<Integer, int[]> map : mapping.entrySet())
       {
-        if (map[PDB_RES_POS] != UNASSIGNED)
+        int structureResNo = map.getValue()[PDB_RES_POS];
+
+        /*
+         * find the atom number in the chain for this residue number
+         * NB only CA or P atoms have been saved in the chain - see
+         * JmolParser.convertSignificantAtoms
+         */
+        int atomIndex = getAtomIndex(structureResNo, chain.atoms);
+        if (atomIndex == StructureMapping.UNASSIGNED)
+        {
+          notFound.add(map.getKey());
+        }
+        else
         {
-          map[PDB_ATOM_POS] = getAtomIndex(map[PDB_RES_POS], chain.atoms);
+          map.getValue()[PDB_ATOM_POS] = atomIndex;
         }
       }
+      for (Integer missing : notFound)
+      {
+        mapping.remove(missing);
+      }
     } catch (Exception e)
     {
       throw new StructureMappingException(
@@ -71,7 +99,7 @@ public abstract class StructureMappingClient
         return atom.atomIndex;
       }
     }
-    return UNASSIGNED;
+    return StructureMapping.UNASSIGNED;
   }
 
   public class StructureMappingException extends Exception

diff --git a/src/jalview/structure/StructureSelectionManager.java b/src/jalview/structure/StructureSelectionManager.java
index c91317e..59f37d9 100644 (file)
--- a/src/jalview/structure/StructureSelectionManager.java
+++ b/src/jalview/structure/StructureSelectionManager.java
@@ -454,7 +454,7 @@ public class StructureSelectionManager
         {
           if (targetChainId.trim().length() == 0)
           {
-            targetChainId = " ";
+            targetChainId = StructureMapping.NO_CHAIN;
           }
           else
           {
@@ -474,7 +474,7 @@ public class StructureSelectionManager
        */
       int max = -10;
       AlignSeq maxAlignseq = null;
-      String maxChainId = " ";
+      String maxChainId = StructureMapping.NO_CHAIN; // space
       PDBChain maxChain = null;
       boolean first = true;
       for (PDBChain chain : pdb.getChains())
@@ -602,7 +602,8 @@ public class StructureSelectionManager
                 .getString("status.obtaining_mapping_with_phyre2_template_alignment"));
         String fastaFile = getPhyre2FastaFileFor(pdbFile);
         StructureMapping phyre2ModelMapping = new Phyre2Client(pdb)
-                .getStructureMapping(seq, pdbFile, fastaFile, " ");
+                .getStructureMapping(seq, pdbFile, fastaFile,
+                        StructureMapping.NO_CHAIN);
         seqToStrucMapping.add(phyre2ModelMapping);
         maxChain.makeExactMapping(maxAlignseq, seq);
         maxChain.transferRESNUMFeatures(seq, null);
@@ -882,7 +883,7 @@ public class StructureSelectionManager
                 && sm.pdbchain.equals(atom.getChain()))
         {
           int indexpos = sm.getSeqPos(atom.getPdbResNum());
-          if (lastipos != indexpos && lastseq != sm.sequence)
+          if (lastipos != indexpos || lastseq != sm.sequence)
           {
             results.addResult(sm.sequence, indexpos, indexpos);
             lastipos = indexpos;

diff --git a/src/jalview/structures/models/AAStructureBindingModel.java b/src/jalview/structures/models/AAStructureBindingModel.java
index d9e8c95..03d37d1 100644 (file)
--- a/src/jalview/structures/models/AAStructureBindingModel.java
+++ b/src/jalview/structures/models/AAStructureBindingModel.java
@@ -586,8 +586,8 @@ public abstract class AAStructureBindingModel extends
              * move on to next pdb file (ignore sequences for other chains
              * for the same structure)
              */
-            s = seqCountForPdbFile;
-            break;
+            // s = seqCountForPdbFile;
+            // break;
           }
         }
       }

diff --git a/src/jalview/ws/phyre2/Phyre2Client.java b/src/jalview/ws/phyre2/Phyre2Client.java
index e4f67bb..80dc841 100644 (file)
--- a/src/jalview/ws/phyre2/Phyre2Client.java
+++ b/src/jalview/ws/phyre2/Phyre2Client.java
@@ -16,7 +16,6 @@ import jalview.util.Comparison;
 import jalview.util.Format;
 
 import java.io.BufferedReader;
-import java.io.File;
 import java.io.FileReader;
 import java.io.IOException;
 import java.io.PrintStream;
@@ -31,10 +30,6 @@ public class Phyre2Client extends StructureMappingClient
 {
   private final static String NEWLINE = System.lineSeparator();
 
-  public static final int UNASSIGNED = -1;
-
-  private final static String PATH_SEPARATOR = File.separator;
-
   private String fastaMappingFile;
 
   public Phyre2Client(StructureFile structureFile)
@@ -105,24 +100,25 @@ public class Phyre2Client extends StructureMappingClient
     tStructureRes.setEnd(structureFile.getSeqsAsArray()[0].getEnd());
     try
     {
-      int sequenceResLenght = tSequenceRes.getLength();
-      int structureResLenght = tStructureRes.getLength();
-      if (sequenceResLenght == structureResLenght)
+      int sequenceResLength = tSequenceRes.getLength();
+      int structureResLength = tStructureRes.getLength();
+      if (sequenceResLength == structureResLength)
       {
         int prevStructResNum = -1;
-        int alignmentLenght = sequenceResLenght + tSequenceRes.getStart();
-        for (int x = 0; x < alignmentLenght; x++)
+        int alignmentLength = sequenceResLength + tSequenceRes.getStart();
+        for (int x = 0; x < alignmentLength; x++)
         {
           int alignSeqResidueIndex = tSequenceRes.findIndex(x);
           int structResNum = tStructureRes
                   .findPosition(alignSeqResidueIndex);
           int sequenceResNum = tSequenceRes
                   .findPosition(alignSeqResidueIndex - 1);
-          boolean sameResNum = (structResNum == prevStructResNum);
-          // System.out.println(sequenceResNum + " : "
-          // + (sameResNum ? -1 : prevStructResNum));
-          mapping.put(sequenceResNum, new int[] {
-              sameResNum ? -1 : prevStructResNum, -1 });
+          if (structResNum != prevStructResNum)
+          {
+            // System.out.println(sequenceResNum + " : " + prevStructResNum);
+            mapping.put(sequenceResNum, new int[] { prevStructResNum,
+                StructureMapping.UNASSIGNED });
+          }
           prevStructResNum = structResNum;
         }
       }
@@ -131,6 +127,10 @@ public class Phyre2Client extends StructureMappingClient
       e.printStackTrace();
     }
 
+    /*
+     * now populate atom positions for structure residues (and remove
+     * residue if atom position cannot be found)
+     */
     try
     {
       populateAtomPositions(" ", mapping);

diff --git a/src/jalview/ws/sifts/SiftsClient.java b/src/jalview/ws/sifts/SiftsClient.java
index 5825a26..7b26214 100644 (file)
--- a/src/jalview/ws/sifts/SiftsClient.java
+++ b/src/jalview/ws/sifts/SiftsClient.java
@@ -79,6 +79,10 @@ public class SiftsClient extends StructureMappingClient implements
    */
   private static File mockSiftsFile;
 
+  private static final int UNASSIGNED = StructureMapping.UNASSIGNED; // -1
+
+  private static final int PDB_RES_POS = StructureMapping.PDB_RES_NUM_INDEX; // 0
+
   private Entry siftsEntry;
 
   private String pdbId;
@@ -89,10 +93,6 @@ public class SiftsClient extends StructureMappingClient implements
 
   private static final int BUFFER_SIZE = 4096;
 
-  public static final int UNASSIGNED = -1;
-
-  private static final int PDB_RES_POS = 0;
-
   private static final String NOT_OBSERVED = "Not_Observed";
 
   private static final String SIFTS_FTP_BASE_URL = "http://ftp.ebi.ac.uk/pub/databases/msd/sifts/xml/";

diff --git a/test/jalview/structure/AtomSpecTest.java b/test/jalview/structure/AtomSpecTest.java
index ea53131..2494555 100644 (file)
--- a/test/jalview/structure/AtomSpecTest.java
+++ b/test/jalview/structure/AtomSpecTest.java
@@ -28,7 +28,7 @@ public class AtomSpecTest
     as = AtomSpec.fromChimeraAtomspec("#3.2:15");
     assertEquals(as.getModelNumber(), 3);
     assertEquals(as.getPdbResNum(), 15);
-    assertEquals(as.getChain(), "");
+    assertEquals(as.getChain(), StructureMapping.NO_CHAIN); // space
     assertNull(as.getPdbFile());
 
     String spec = "3:12.B";

diff --git a/test/jalview/ws/phyre2/Phyre2ClientTest.java b/test/jalview/ws/phyre2/Phyre2ClientTest.java
index 1e9cf70..394ea69 100644 (file)
--- a/test/jalview/ws/phyre2/Phyre2ClientTest.java
+++ b/test/jalview/ws/phyre2/Phyre2ClientTest.java
@@ -33,55 +33,7 @@ public class Phyre2ClientTest
                     + "EEGWVLTCVAYPQSDVTIETHKEAELVG", 1, 144);
 
     HashMap<Integer, int[]> expectedMapping = new HashMap<Integer, int[]>();
-
-    expectedMapping.put(1, new int[] { -1, -1 });
-    expectedMapping.put(2, new int[] { -1, -1 });
-    expectedMapping.put(3, new int[] { -1, -1 });
-    expectedMapping.put(4, new int[] { -1, -1 });
-    expectedMapping.put(5, new int[] { -1, -1 });
-    expectedMapping.put(6, new int[] { -1, -1 });
-    expectedMapping.put(7, new int[] { -1, -1 });
-    expectedMapping.put(8, new int[] { -1, -1 });
-    expectedMapping.put(9, new int[] { -1, -1 });
-    expectedMapping.put(10, new int[] { -1, -1 });
-    expectedMapping.put(11, new int[] { -1, -1 });
-    expectedMapping.put(12, new int[] { -1, -1 });
-    expectedMapping.put(13, new int[] { -1, -1 });
-    expectedMapping.put(14, new int[] { -1, -1 });
-    expectedMapping.put(15, new int[] { -1, -1 });
-    expectedMapping.put(16, new int[] { -1, -1 });
-    expectedMapping.put(17, new int[] { -1, -1 });
-    expectedMapping.put(18, new int[] { -1, -1 });
-    expectedMapping.put(19, new int[] { -1, -1 });
-    expectedMapping.put(20, new int[] { -1, -1 });
-    expectedMapping.put(21, new int[] { -1, -1 });
-    expectedMapping.put(22, new int[] { -1, -1 });
-    expectedMapping.put(23, new int[] { -1, -1 });
-    expectedMapping.put(24, new int[] { -1, -1 });
-    expectedMapping.put(25, new int[] { -1, -1 });
-    expectedMapping.put(26, new int[] { -1, -1 });
-    expectedMapping.put(27, new int[] { -1, -1 });
-    expectedMapping.put(28, new int[] { -1, -1 });
-    expectedMapping.put(29, new int[] { -1, -1 });
-    expectedMapping.put(30, new int[] { -1, -1 });
-    expectedMapping.put(31, new int[] { -1, -1 });
-    expectedMapping.put(32, new int[] { -1, -1 });
-    expectedMapping.put(33, new int[] { -1, -1 });
-    expectedMapping.put(34, new int[] { -1, -1 });
-    expectedMapping.put(35, new int[] { -1, -1 });
-    expectedMapping.put(36, new int[] { -1, -1 });
-    expectedMapping.put(37, new int[] { -1, -1 });
-    expectedMapping.put(38, new int[] { -1, -1 });
-    expectedMapping.put(39, new int[] { -1, -1 });
-    expectedMapping.put(40, new int[] { -1, -1 });
-    expectedMapping.put(41, new int[] { -1, -1 });
-    expectedMapping.put(42, new int[] { -1, -1 });
-    expectedMapping.put(43, new int[] { -1, -1 });
-    expectedMapping.put(44, new int[] { -1, -1 });
-    expectedMapping.put(45, new int[] { -1, -1 });
-    expectedMapping.put(46, new int[] { -1, -1 });
-    expectedMapping.put(47, new int[] { -1, -1 });
-    // forty eight gaps in PDB sequence
+    // PDB sequence starts with residue 48
     expectedMapping.put(48, new int[] { 48, 1 });
     expectedMapping.put(49, new int[] { 49, 6 });
     expectedMapping.put(50, new int[] { 50, 12 });
@@ -94,11 +46,8 @@ public class Phyre2ClientTest
     expectedMapping.put(57, new int[] { 57, 72 });
     expectedMapping.put(58, new int[] { 58, 79 });
     expectedMapping.put(59, new int[] { 59, 87 });
-    expectedMapping.put(60, new int[] { -1, -1 });
-    expectedMapping.put(61, new int[] { -1, -1 });
-    // two gaps in PDB sequence
-    expectedMapping.put(62, new int[] { 60, -1 });
-    expectedMapping.put(63, new int[] { 61, -1 });
+    // residues 60, 61 absent in PDB file
+    // residues 62, 63 also skipped in map (is this right?)
     expectedMapping.put(64, new int[] { 62, 91 });
     expectedMapping.put(65, new int[] { 63, 100 });
     expectedMapping.put(66, new int[] { 64, 111 });
@@ -151,11 +100,10 @@ public class Phyre2ClientTest
     expectedMapping.put(113, new int[] { 111, 445 });
     expectedMapping.put(114, new int[] { 112, 453 });
     expectedMapping.put(115, new int[] { 113, 461 });
-    // one gap in PDB sequence
-    expectedMapping.put(116, new int[] { -1, -1 });
+    // residue 116 absent in PDB file
     expectedMapping.put(117, new int[] { 114, 469 });
     expectedMapping.put(118, new int[] { 115, 477 });
-    expectedMapping.put(119, new int[] { 116, -1 });
+    // residue 119 gets removed as mapped to 116 - is this right?
     expectedMapping.put(120, new int[] { 117, 486 });
     expectedMapping.put(121, new int[] { 118, 495 });
     expectedMapping.put(122, new int[] { 119, 504 });
@@ -180,7 +128,7 @@ public class Phyre2ClientTest
     expectedMapping.put(141, new int[] { 138, 652 });
     expectedMapping.put(142, new int[] { 139, 661 });
     expectedMapping.put(143, new int[] { 140, 670 });
-    expectedMapping.put(144, new int[] { -1, -1 });
+    // residue 144 absent in PDB file
 
     StructureFile structureFile;
     try
@@ -222,40 +170,7 @@ public class Phyre2ClientTest
             13, 139);
 
     HashMap<Integer, int[]> expectedMapping = new HashMap<Integer, int[]>();
-
-    expectedMapping.put(13, new int[] { -1, -1 });
-    expectedMapping.put(14, new int[] { -1, -1 });
-    expectedMapping.put(15, new int[] { -1, -1 });
-    expectedMapping.put(16, new int[] { -1, -1 });
-    expectedMapping.put(17, new int[] { -1, -1 });
-    expectedMapping.put(18, new int[] { -1, -1 });
-    expectedMapping.put(19, new int[] { -1, -1 });
-    expectedMapping.put(20, new int[] { -1, -1 });
-    expectedMapping.put(21, new int[] { -1, -1 });
-    expectedMapping.put(22, new int[] { -1, -1 });
-    expectedMapping.put(23, new int[] { -1, -1 });
-    expectedMapping.put(24, new int[] { -1, -1 });
-    expectedMapping.put(25, new int[] { -1, -1 });
-    expectedMapping.put(26, new int[] { -1, -1 });
-    expectedMapping.put(27, new int[] { -1, -1 });
-    expectedMapping.put(28, new int[] { -1, -1 });
-    expectedMapping.put(29, new int[] { -1, -1 });
-    expectedMapping.put(30, new int[] { -1, -1 });
-    expectedMapping.put(31, new int[] { -1, -1 });
-    expectedMapping.put(32, new int[] { -1, -1 });
-    expectedMapping.put(33, new int[] { -1, -1 });
-    expectedMapping.put(34, new int[] { -1, -1 });
-    expectedMapping.put(35, new int[] { -1, -1 });
-    expectedMapping.put(36, new int[] { -1, -1 });
-    expectedMapping.put(37, new int[] { -1, -1 });
-    expectedMapping.put(38, new int[] { -1, -1 });
-    expectedMapping.put(39, new int[] { -1, -1 });
-    expectedMapping.put(40, new int[] { -1, -1 });
-    expectedMapping.put(41, new int[] { -1, -1 });
-    expectedMapping.put(42, new int[] { -1, -1 });
-    expectedMapping.put(43, new int[] { -1, -1 });
-    expectedMapping.put(44, new int[] { -1, -1 });
-    // thirty two gaps in PDB sequence
+    // PDB sequence starts with residue 33
     expectedMapping.put(45, new int[] { 33, 1 });
     expectedMapping.put(46, new int[] { 34, 6 });
     expectedMapping.put(47, new int[] { 35, 13 });
@@ -372,6 +287,7 @@ public class Phyre2ClientTest
 
       Assert.assertEquals(testSeq.getStart(), 13);
       Assert.assertEquals(testSeq.getEnd(), 139);
+      Assert.assertEquals(actualMapping, expectedMapping);
       testMappings(actualMapping, expectedMapping);
     } catch (Exception e)
     {

diff --git a/test/jalview/ws/sifts/SiftsClientTest.java b/test/jalview/ws/sifts/SiftsClientTest.java
index 3b6858b..496b6dc 100644 (file)
--- a/test/jalview/ws/sifts/SiftsClientTest.java
+++ b/test/jalview/ws/sifts/SiftsClientTest.java
@@ -42,6 +42,8 @@ import java.util.HashMap;
 import java.util.Iterator;
 import java.util.Map;
 
+import junit.extensions.PA;
+
 import org.testng.Assert;
 import org.testng.FileAssert;
 import org.testng.annotations.AfterTest;
@@ -77,7 +79,7 @@ public class SiftsClientTest
                   + "AYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDD"
                   + "QSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEELTA.", 1, 147);
 
-  int u = SiftsClient.UNASSIGNED;
+  int u = StructureMapping.UNASSIGNED;
 
   HashMap<Integer, int[]> expectedMapping = new HashMap<Integer, int[]>();
 
@@ -295,8 +297,6 @@ public class SiftsClientTest
         Assert.assertEquals(actualMapping.get(pair.getKey()),
                 pair.getValue());
       }
-
-
     } catch (Exception e)
     {
       e.printStackTrace();
@@ -419,16 +419,19 @@ groups = { "Network" },
 
     // Can't do Assert.assertEquals(strucMapping.getMapping(), expectedMapping);
     // because this fails in our version of TestNG
-    Assert.assertEquals(strucMapping.getMapping().size(),
+    Map<Integer, int[]> mapping = (Map<Integer, int[]>) PA.getValue(
+            strucMapping, "mapping");
+    Assert.assertEquals(
+            mapping.size(),
             expectedMapping.size());
     Iterator<Map.Entry<Integer, int[]>> it = expectedMapping.entrySet()
             .iterator();
     while (it.hasNext())
     {
       Map.Entry<Integer, int[]> pair = it.next();
-      Assert.assertTrue(strucMapping.getMapping()
+      Assert.assertTrue(mapping
               .containsKey(pair.getKey()));
-      Assert.assertEquals(strucMapping.getMapping().get(pair.getKey()),
+      Assert.assertEquals(mapping.get(pair.getKey()),
               pair.getValue());
     }
   }