1 <?xml version="1.0" encoding="UTF-8"?>
2 <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd">
3 <html xmlns="http://www.w3.org/1999/xhtml">
6 <meta name="Last-modified" content="Fri, 28 Jun 2013 12:00:00 GMT"/>
7 <title>Java Bioinformatics Analyses Web Services (JABAWS): Manual</title>
8 <link href="ws.css" rel="stylesheet" type="text/css" media="screen, projection, handheld, tv" />
9 <link href="print.css" rel="stylesheet" type="text/css" media="print" />
10 <link href='http://fonts.googleapis.com/css?family=Yanone+Kaffeesatz:700' rel='stylesheet' type='text/css' />
11 <script type="text/javascript" src="prototype-1.6.0.3.js"></script>
20 <td style="width:158px;"><a href="http://www.dundee.ac.uk"><img src="images/uod_lt_long.gif" width="158" height="90" alt="University of Dundee" class="logo" title="University of Dundee" longdesc="http://www.dundee.ac.uk"/></a></td>
21 <td class="bg"><img src="images/jabaws21.png" width="256" height="67" alt="JABAWS-2.1" title="Java Bioinformatics Analysis Web Services version 2.1"/></td>
22 <td class="bg"><img src="images/banner_right.png" alt="Disorder" width="200" height="80"/></td>
32 <a class="newa" href="index.html">Home</a>
33 <a class="newa" href="quick_start.html">Getting Started</a>
34 <a class="newpressed" href="man_about.html">Manual</a>
37 <a class="newa" href="man_about.html">About</a>
38 <a class="newa" href="man_servervm.html" title="JABAWS Server as Virtual Appliance">Server VA</a>
39 <a class="newa" href="man_awscloud.html" title="JABAWS Server in the Amazon EC2 Cloud">Server in the Cloud</a>
40 <a class="newa" href="man_serverwar.html" title="JABAWS Server as Web Application aRchive">Server WAR</a>
41 <a class="newa" href="man_configuration.html" >Configure JABAWS</a>
42 <a class="newa" href="man_client.html" title="JABAWS Command Line Client">Command Client</a>
43 <a class="newa" href="man_stats.html" title="JABAWS Usage Statistics">Usage Statistics</a>
44 <a class="newpressed" href="man_dev.html" title="Accessing JABAWS from your program">Accessing JABAWS</a>
45 <a class="newa" href="man_server_dev.html" >Develop JABAWS</a>
52 <h2 id="headtitle">JABAWS MANUAL</h2>
54 <h2>Using JABAWS From Your Program </h2>
56 <li><a href="#wsfunctions">Web services functions overview </a></li>
57 <li><a href="#templatestr">The template client structure</a></li>
58 <li><a href="#connectto">Connecting to JABAWS</a></li>
59 <li><a href="#validnames">Valid JABAWS service names and WSDL files</a></li>
60 <li><a href="#defalign">Aligning sequences</a></li>
61 <li><a href="#checkresults">Checking the status of the calculation </a></li>
62 <li><a href="#presetalign">Aligning with presets</a></li>
63 <li><a href="#customalign">Aligning with custom parameters</a></li>
64 <li><a href="#writingaltofile">Writing alignments to a file</a></li>
65 <li><a href="#compex">A complete client example </a></li>
66 <li><a href="#buildart">Building web services artifacts</a></li>
68 <h3><a name="wsfunctions" id="wsfunctions"></a>Web services functions overview </h3>
69 <p>All JABA multiple sequence alignment web services comply to the same interface, thus the function described below are available from all the services. </p>
70 <p><strong>Functions for initiating the alignment </strong><span class="code"> String id = align(List<FastaSequence> list)<br />
71 String id = customAlign(List<FastaSequence> sequenceList, List<Option> optionList)<br />
72 String id = presetAlign(List<FastaSequence> sequenceList, Preset preset)</span></p>
73 <p><strong>Functions pertaining to job monitoring and control</strong><br />
74 <span class="code">JobStatus status = getJobStatus(String id)<br />
75 Alignment al = getResult(String id)<br />
76 boolean cancelled = cancelJob(String id)<br />
77 ChunkHolder chunk = pullExecStatistics(String id, long marker)</span></p>
78 <p><strong>Functions relating to service features discovery</strong><br />
79 <span class="code">RunnerConfig rc = getRunnerOptions()<br />
80 Limit limit = getLimit(String name)<br />
81 LimitsManager lm = getLimits()<br />
82 PresetManager pm = getPresets()</span></p>
83 <p>Please refer to a <a href="dm_javadoc/compbio/data/msa/MsaWS.html">data model javadoc</a> for a detailed description of each methods. </p>
84 <h3><a name="templatestr" id="templatestr"></a>Structure of the template command line client</h3>
85 <table width="100%" border="1">
87 <td style="width:19%"><strong>Packages</strong></td>
88 <td style="width:81%"><strong>Classes and Interfaces </strong></td>
91 <td>compbio.data.msa </td>
92 <td>MsaWS the interface for all multiple sequence alignment web services </td>
95 <td>compbio.data.sequence</td>
96 <td>JABAWS data types </td>
99 <td>compbio.metadata</td>
100 <td>JABAWS meta data types </td>
103 <td>compbio.ws.client</td>
104 <td>JABAWS command line client </td>
107 <p>Additional utility libraries that this client depend upon is the compbio-util-1.3.jar and compbio-annotation-1.0.jar. <br />
108 Please refer to a <a href="dm_javadoc/index.html">data model javadoc</a> for a detailed description of each class and its methods. </p>
111 <h3><a name="connectto" id="connectto"></a>Connecting to JABAWS</h3>
112 <p class="attention">
113 For a complete working example of JABAWS command line client please see compbio.ws.client.Jws2Client class. JABAWS command line client
114 source code is available from the <a href="http://www.compbio.dundee.ac.uk/download">download page</a>. Please note that for now all
115 the examples are in Java other languages will follow given a sufficient demand. </p>
118 Download a binary JABAWS client. Add the client to the class path. The following code excerpt will connect your program to Clustal
119 web service deployed in the University of Dundee. </p>
120 <p class="code"> import java.net.URL;<br />
121 import javax.xml.namespace.QName;<br />
122 import javax.xml.ws.Service;<br />
123 ...............<br />
124 1) String qualifiedName = "http://msa.data.compbio/01/01/2010/";<br />
125 2) URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl");<br />
126 3) QName qname = new QName(, "ClustalWS");<br />
127 4) Service serv = Service.create(url, qname);<br />
128 5) MsaWS msaws = serv.getPort(new QName(qualifiedName, "ClustalWSPort"),
132 Line 1 makes a qualified name for JABA web services.<br />
133 Line 2 constructs the URL to the web services WSDL. <br />
134 Line 3 makes a qualified name instance for Clustal JABA web service. <br />
135 Line 4 creates a service instance.<br />
136 Line 5 makes a connection to the server.
139 A more generic connection method would look like this
141 <p class="code"> import java.net.URL;<br />
142 import javax.xml.namespace.QName;<br />
143 import javax.xml.ws.Service;<br />
144 import compbio.ws.client.Services<br />
145 .............. <br />
146 String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/";<br />
147 String host = "http://www.compbio.dundee.ac.uk/jabaws";<br />
148 // In real life the service name can come from args<br />
149 Services clustal = Services.ClustalWS;<br />
150 URL url = new URL(host + "/" + clustal.toString() + "?wsdl");<br />
151 QName qname = new QName(qualifiedServiceName, clustal.toString());<br />
152 Service serv = Service.create(url, qname);<br />
153 MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, clustal<br />
154 + "Port"), MsaWS.class);
157 Where Services is enumeration of JABAWS web services. All JABAWS multiple sequence alignment methods confirm to
158 MsaWS specification, thus from the caller point of view all JABAWS web services can be represented by MsaWS
159 interface. The full documentation of MsaWS functions is available from the <a href="dm_javadoc/compbio/data/msa/MsaWS.html">javadoc</a>.
163 <h3><a name="validnames" id="validnames"></a>Valid JABAWS service names and WSDL files </h3>
164 <p>Multiple sequence alignment services </p>
165 <ul><li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalOWS?wsdl">ClustalOWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalOWS?wsdl) </li>
166 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalWS?wsdl">ClustalWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/ClustalWS?wsdl) </li>
167 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/MuscleWS?wsdl">MuscleWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/MuscleWS?wsdl) </li>
168 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/MafftWS?wsdl">MafftWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/MafftWS?wsdl) </li>
169 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/TcoffeeWS?wsdl">TcoffeeWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/TcoffeeWS?wsdl) </li>
170 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/ProbconsWS?wsdl">ProbconsWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/ProbconsWS?wsdl) </li>
171 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/MSAprobsWS?wsdl">MSAprobsWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/MSAprobsWS?wsdl) </li>
172 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/GLprobsWS?wsdl">GLprobsWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/GLprobsWS?wsdl) </li>
174 <p>Protein disorder prediction services </p>
176 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/IUPredWS?wsdl">IUPredWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/IUPredWS?wsdl) </li>
177 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/GlobPlotWS?wsdl">GlobPlotWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/GlobPlotWS?wsdl) </li>
178 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/DisemblWS?wsdl">DisemblWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/DisemblWS?wsdl) </li>
179 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/JronnWS?wsdl">JronnWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/JronnWS?wsdl) </li>
181 <p>Amino acid conservation service</p>
183 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/AAConWS?wsdl">AAConWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/AAConWS?wsdl) </li>
185 <p>Protein and RNA Secondary Structure Prediction</p>
187 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/JpredWS?wsdl">JpredWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/JpredWS?wsdl) </li>
188 <li><a href="http://www.compbio.dundee.ac.uk/jabaws-dev/RNAalifoldWS?wsdl">RNAalifoldWS</a> (http://www.compbio.dundee.ac.uk/jabaws-dev/RNAalifoldWS?wsdl) </li>
191 Please replace <span class="hightlight">http://www.compbio.dundee.ac.uk/</span> with your JABAWS instance host name, and
192 <span class="hightlight">jabaws</span> with your JABAWS context name to access your local version of JABAWS web services.
193 For example <span class="hightlight">http://localhost:8080/jabaws</span> would be a valid URL for the default Apache-Tomcat
194 installation and jabaws.war file deployment. </p>
197 <h3><a name="defalign" id="defalign"></a>Aligning sequences </h3>
199 Given that <span class="hightlight">msaws</span> is web service proxy, created as described in "Connecting to JABAWS"
200 section, the actual alignment can be obtained as follows: </p>
201 <p class="code">1) List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));<br />
202 2) String jobId = msaws.align(fastalist); <br />
203 3) Alignment alignment = msaws.getResult(jobId);</p>
204 <p>Line one loads FASTA sequence from the file.<br />
205 Line two submits them to web service represented by msaws proxy. <br />
206 Line three retrieves the alignment from a web service. This line will block the execution until the result is available.
207 Use this with caution. In general, you should make sure that the calculation has been completed before attempting
208 retrieving results. This is to avoid keeping the connection to the server on hold for a prolonged periods of time.
209 While this may be ok with your local server, our public server
210 (<a href="http://www.compbio.dundee.ac.uk/jabaws">www.compbio.dundee.ac.uk/jabaws</a>) will not let you hold the connection
211 for longer than 10 minutes. This is done to prevent excessive load on the server. The next section describes how to check
212 the status of the calculation.<br />
213 Methods and classes mentioned in the excerpt are available from the JABAWS client library. </p>
214 <h3><a name="checkresults" id="checkresults"></a>Checking the status of the calculation </h3>
215 <p> You may have noticed that there was no pause between submitting the job and retrieving of the results. This is
216 because <span class="hightlight">getResult(jobId)</span> method block the processing until the calculation is completed.
217 However, taking into account that the connection holds server resources, our public server
218 (<a href="http://www.compbio.dundee.ac.uk/jabaws">www.compbio.dundee.ac.uk/jabaws</a>) is configured to reset the
219 connection after 10 minutes of waiting. To work around the connection reset you are encouraged to check whether the
220 calculation has been completed before accessing the results. You can do it like this: </p>
221 <p> <span class="code">while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) {<br />
222 Thread.sleep(2000); // wait two seconds, then recheck the status <br />
224 <h3><a name="presetalign" id="presetalign"></a>Aligning with presets</h3>
225 <p class="code">1) PresetManager presetman = msaws.getPresets();<br />
226 2) Preset preset = presetman.getPresetByName(presetName);<br />
227 3) List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));<br />
228 4) String jobId = msaws.presetAlign(fastalist, preset);<br />
229 5) Alignment alignment = msaws.getResult(jobId);</p>
230 <p>Line one obtains the lists of presets supported by a web service.<br />
231 Line two return a particular Preset
233 Lines three to five are doing the same job as in the first <a href="#defalign"> aligning sequences example</a>.</p>
234 <h3><a name="customalign" id="customalign"></a>Aligning with custom parameters</h3>
235 <p class="code"> 1) RunnerConfig options = msaws.getRunnerOptions();<br />
236 2) Argument matrix = options.getArgument("MATRIX");<br />
237 3) matrix.setValue("PAM300");<br />
238 4) Argument gapopenpenalty = options.getArgument("GAPOPEN");<br />
239 5) gapopenpenalty.setValue("20");<br />
240 6) List<Argument> arguments = new ArrayList<Argument>(); <br />
241 7) arguments.add(matrix);
242 arguments.add(gapopenpenalty);<br />
243 8) List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));<br />
244 9) String jobId = msaws.customAlign(fastalist, arguments);<br />
245 10) Alignment alignment = msaws.getResult(jobId);</p>
246 <p>Line one obtains the <span class="hightlight">RunnerConfig</span> object that holds information on supported parameters and their values<br />
247 Line two retrieve a particular parameter from the holder by its name.<br />
248 Lines three sets a value to this parameter which will be used in the calculation. <br />
249 Line four and five do the same but for another parameter.<br />
250 Line 6 makes a List to hold the parameters. <br />
251 Line seven puts the parameters into that list.<br />
253 and ten is the same as in previous examples.<br />
254 Line nine submit an alignment request with the sequences and the parameters. <br />
255 The names of all the parameters supported by a web service e.g. "PAM300" can be obtained
256 using <span class="hightlight">options.getArguments() </span>method. Further details on the methods
257 available from <span class="hightlight">RunnerConfig</span> object are available from the
258 <a href="dm_javadoc/index.html">javadoc</a>. </p>
259 <h3><a name="writingaltofile" id="writingaltofile"></a>Writing alignments to a file</h3>
260 <p>There is a utility method in the client library that does exactly that. </p>
261 <p> <span class="code">Alignment alignment = align(...) <br />
262 FileOutputStream outStream = new FileOutputStream(file);<br />
263 ClustalAlignmentUtil.writeClustalAlignment(outStream, align);</span></p>
264 <h3><a name="compex" id="compex"></a>A complete client example </h3>
266 Finally, a complete example of the program that connects to JABAWS Clustal service and aligns sequences using
267 one of the Clustal web service presets. There is also a <a href="Example_template.pdf">PDF version</a> of
268 this example with syntax highlighted. The text comments are commented by block style comments e.g. /* comment */,
269 the alternatives given in the code are line commented // comment. You may want to remove line style comments to
270 test alternatives of the functions. All you need for this to work is a
271 <a href="http://www.compbio.dundee.ac.uk/download/get?id=min-jaba-client-2.0.jar">JABAWS binary client</a>.
272 Please make sure that the client is in the Java class path before running this example.</p>
273 <pre class="code" style="line-height:1em;">
274 import java.io.ByteArrayInputStream;
275 import java.io.FileNotFoundException;
276 import java.io.IOException;
278 import java.util.List;
280 import javax.xml.namespace.QName;
281 import javax.xml.ws.Service;
283 import compbio.data.msa.MsaWS;
284 import compbio.data.sequence.Alignment;
285 import compbio.data.sequence.FastaSequence;
286 import compbio.data.sequence.SequenceUtil;
287 import compbio.metadata.JobSubmissionException;
288 import compbio.metadata.LimitExceededException;
289 import compbio.metadata.Preset;
290 import compbio.metadata.PresetManager;
291 import compbio.metadata.ResultNotAvailableException;
292 import compbio.metadata.UnsupportedRuntimeException;
293 import compbio.metadata.WrongParameterException;
295 public class Example {
298 * Input sequences for alignment
300 static final String input = ">Foo\r\n"
301 + "MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGR"
302 + "VRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQ"
303 + "LLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPL"
304 + "APTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQA"
305 + "STLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMD"
306 + "YVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLN"
307 + "PQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHAD"
308 + "LFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALAS"
309 + "DPAALTALHARVDVLRRESGVFEMDGFADDFGALLQALARRHGWLGI\r\n"
311 + ">Bar\r\n"
312 + "MGDTTAGEMAVQRGLALHQQRHAEAAVLLQQASDAAPEHPGIALWLHALEDAGQAEAAAAYTRAH"
313 + "QLLPEEPYITAQLLNAVAQGVGAVEPFAFLSEDASAAESVRPLAPTRVRSKGPLRVGFVSNGFGA"
314 + "HPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHG"
315 + "IDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVL"
316 + "RLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLL"
317 + "SGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGC"
318 + "PVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESGV"
319 + "FEMDGFADDFGALLQALARRHGWLGI\r\n"
321 + ">Friends\r\n"
322 + "MTADGPRELLQLRAAVRHRPQDVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRV"
323 + "RWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDHQLLPEEPYITAQLDVLSAQVRAAVAQG"
324 + "VGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLL"
325 + "TVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFD"
326 + "LRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAF"
327 + "QPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEA"
328 + "DARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTP"
329 + "GETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESI";
331 public static void main(String[] args) throws UnsupportedRuntimeException,
332 LimitExceededException, JobSubmissionException,
333 WrongParameterException, FileNotFoundException, IOException,
334 ResultNotAvailableException, InterruptedException {
336 String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/";
338 /* Make a URL pointing to web service WSDL */
339 URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl");
342 * If you are making a client that connects to different web services
343 * you can use something like this:
345 // URL url = new URL(host + "/" + Services.ClustalWS.toString() +
346 // "?wsdl");
348 QName qname = new QName(qualifiedServiceName, "ClustalWS");
349 Service serv = Service.create(url, qname);
351 * Multiple sequence alignment interface for Clustal web service
354 MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, "ClustalWS"
355 + "Port"), MsaWS.class);
357 /* Get the list of available presets */
358 PresetManager presetman = msaws.getPresets();
360 /* Get the Preset object by preset name */
361 Preset preset = presetman
362 .getPresetByName("Disable gap weighting (Speed-oriented)");
365 * Load sequences in FASTA format from the file You can use something
366 * like new FileInputStream(<filename>) to load sequence from the file
368 List<FastaSequence> fastalist = SequenceUtil
369 .readFasta(new ByteArrayInputStream(input.getBytes()));
372 * Submit loaded sequences for an alignment using preset. The job
373 * identifier is returned by this method, you can retrieve the results
374 * with it sometime later.
376 String jobId = msaws.presetAlign(fastalist, preset);
378 /* This method will block for the duration of the calculation */
379 Alignment alignment = msaws.getResult(jobId);
382 * This is a better way of obtaining results, it does not involve
383 * holding the connection open for the duration of the calculation,
384 * Besides, as the University of Dundee public server will reset the
385 * connection after 10 minutes of idling, this is the only way to obtain
386 * the results of long running task from our public server.
388 // while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) {
389 // Thread.sleep(1000); // wait a second, then recheck the status
392 /* Output the alignment to standard out */
393 System.out.println(alignment);
395 // Alternatively, you can record retrieved alignment into the file in
398 // ClustalAlignmentUtil.writeClustalAlignment(new FileOutputStream(
399 // "output.al"), alignment);
404 For a more detailed description of all available types and their functions please refer to the <a href="dm_javadoc/index.html">data model javadoc</a>.
405 <h3><a name="buildart" id="buildart"></a>Building web services artifacts</h3>
407 JABAWS are the standard <a href="http://jax-ws.java.net/">JAX-WS</a> SOAP web services, which are <a href="http://www.ws-i.org/">WS-I</a>
408 basic profile compatible. This means that you could use whatever tool your language has to work with web services. Below is how you can
409 generate portable artifacts to work with JABAWS from Java. However if programming in Java, we recommend using our client library as
410 it provides a handful of useful methods in addition to plain data types. </p>
411 <p class="code">wsimport -keep http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl</p>
412 </div><!-- content end-->
413 <div id="copyright">Last update: 30 April 2014<br/>Sasha Sherstnev, Peter Troshin, Jim Procter and Geoff Barton, The Barton Group, University of Dundee, UK</div>
414 </div><!-- wrapper end-->
415 </div><!-- page end-->
418 <!-- Google analitics -->
419 <script type="text/javascript">
420 var gaJsHost = (("https:" == document.location.protocol) ? "https://ssl." : "http://www.");
421 document.write(unescape("%3Cscript src='" + gaJsHost + "google-analytics.com/ga.js' type='text/javascript'%3E%3C/script%3E"));
423 <script type="text/javascript">
425 var pageTracker = _gat._getTracker("UA-5356328-1");
426 pageTracker._trackPageview();