JAL-2154 check that xref is a coding xref before adding sequence to retrieved xrefs

JAL-2154 don’t add any remaining xrefed sequences of the wrong molecule type to the alignment

JAL-2154 drop PDB from Protein db list to remove from fetch cross-refs menu

JAL-2154 Defer failing cross-ref combinations that didn’t result in a new alignment window till end of test

JAL-2154 check that CDS panel is only nucleotide, and protein panel is only Protein for retrieved cross-refs

JAL-2106 JAL-2154 fix test for additional reference transferred from locus to CDS as well as Peptide

JAL-2106 JAL-2154 cross-refs from Ensembl should verify as cross refs only

JAL-2106 tighten DBRefEntry primary seq test for PDB

JAL-2154 JAL-2106 transfer primary refs to CDS for makeCDS

JAL-2154 copy and paste error

Merge branch 'trailm' into trial_fixMakeCDSDBRefPropagation

Merge branch 'refactor/JAL-2106_sourceDbRef_revision' into trailm

Merge branch 'develop' into bug/JAL-2154projectMappings

 Conflicts:
src/jalview/gui/AlignFrame.java - propagated MessageManager tweak to jalview/gui/CrossRefAction.java

Merge branch 'develop' into refactor/JAL-2106_sourceDbRef_revision

JAL-2178 remove duplicate Uniprot db source

JAL-1424 duplicate key removed

JAL-2106 FIXME for test failure

JAL-2106 TODO - verify Embl primary refs get added

JAL-2106 tidy up and comments for DBRefFetcher

JAL-2106 javadoc for sifts mapping method

JAL-2106 prevent SIFTS mappings for sequences that don’t look like protein

JAL-2106 removed setSourceDBRef, refactor getSourceDBRef to getPrimaryDBRefs
 * minimal test for PDB cornercase
 * minimal revision of AlignmentUtils/Tests, CrossRef
 * basic patch to SIFTSClient - need to revisit

TODO
 * jalview.io.StructureFile re ‘PDB’ primary dbrefs generated from filenames.
 * verify primary refs added correctly for Uniprot, EMBL,  Ensembl and EnsemblGenomes in their unit tests.

JAL-2106 stricter check for 1:1 mapping (same numbering on both sides, and word size == 1)

JAL-2106 rejig test to minimally verify patch that getPDBEntry can be called on local and dataset sequence

JAL-2106 formatting

JAL-2106 DBRefEntry.isPrimary() minimal test & implementation

JAL-2106 convenience method to find all dbsource names via reflection

JAL-1355 correct 'thereshold' to 'threshold' in message keys

JAL-1424 removed unused and duplicated message keys

JAL-1424 tidy / recode MessageManager calls to support code analysis

JAL-1854 removed pointless method override

JAL-1424 removed two redundant (overwritten) setText() calls

JAL-1424 corrected Message bundle lookup key

JAL-1424 undo i18n of exception message

JAL-1854 declare immutable class as final

JAL-1424 recode calls to MessageManager to allow code inspection

JAL-2151 port fix to applet

JAL-1424 enhanced for cleaner reporting, checks calls to JvSwingUtils

JAL-1424 also report (obsolete) keys in translated bundle not in default

JAL-2154 updated testMakeCDSAlignment for expected propagate CDS behaviour (ahem - this should have been checked in *before* implementation!)

JAL-2154 propagate from contig to CDS after constructing CDS sequence, and only propagate refs with congruent mappings *and* corresponding mapping on protein product

JAL-2154 should only add mappings between dataset sequences

JAL-2154 - only copy DBRef from contig to new CDS sequence which involve same mapped region

Merge branch 'develop' into bug/JAL-2154projectMappings

Conflicts:
 src/jalview/gui/AlignFrame.java
  - pushed raise warning dialog to CrossRefAction
 test/jalview/analysis/AlignmentUtilsTests.java
  - simple merge
 test/jalview/io/Jalview2xmlTests.java
  - pushed updated BeforeClass setup to Jalview2xmlBase

JAL-2176 unused field / methods removed

JAL-2174 markColumns() refactored inside ColumnSelection

JAL-2154 - rejig test pass code for breadth-first (or top down) repetition of fetch/fetch crossref/fetch crossref.

* First iteration, all pass counters at zero, process through all crossrefs.
* Next iteration, pass1=1 - recover, process through all crossers
* Next iteration, pass2=1 - recover each first crossref result and process through
* Last iteration, pass3=1 - recover each second crossref result and process.

JAL-1448 corrected for backwards compatibility for UK locale users

JAL-2175 code tidying

JAL-2175 code/test fixes/tidy for PFAM/MSF/JSON roundtrip

JAL-2154 verify recovered xref sequence not already in dataset before adding it

JAL-2154 regression warning - should never recover a sequence ‘like’ an xref’s mapping.getTo() sequence!

JAL-2154 always check dataset sequence for sequence instance exists in dataset before adding it in AlignmentI.addSequence()

JAL-2154 patch verifyAlignment so it fails for duplicate entries for same SequenceI instance on alignment

JAL-2154 tidy assert messages and fix test to verify asserts were raised when expected

JAL-2154 test that verifyAlignment fails for duplicate entries for same SequenceI instance on alignment

JAL-2011 adjust method to fix failing unit test

JAL-2174 bug fixes + refactoring to allow + unit tests

JAL-2154 - possible patch .. but leads to new stringify difference:
expected to see below in dataset, but it doesn’t appear in recovered:
>ENSMUSP00000131873/1-222 ENSEMBL (Protein)
MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSS
KLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVP
VLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITL
ICYHSR

This is actually a duplicate sequence in dataset.. so difference may be due to normalisation when project file is written out

JAL-2154 major rejigging of test looping again
probably not 100% correct, but now fails when:

Recovered view for 'UNIPROT P01731 -> EMBL{1} -> ENSEMBL{0}' from '/var/folders/km/m8_86nbd4bbcpd5s2h8xqtk4_kj190/T/crossRefTest9144214145355720129.jvp'

Cause is:
Parsing as Jalview Version 2 file failed.
java.lang.ArrayIndexOutOfBoundsException: 73
at jalview.gui.Jalview2XML.loadFromObject(Jalview2XML.java:2827)
at jalview.gui.Jalview2XML.loadJalviewAlign(Jalview2XML.java:2390)
at jalview.gui.Jalview2XML.loadJalviewAlign(Jalview2XML.java:2277)
at jalview.io.FileLoader.run(FileLoader.java:308)
at java.lang.Thread.run(Thread.java:745)

JAL-2154 disable DAS sources for Jalview2XML tests

Merge branch 'develop' of https://source.jalview.org/git/jalview into develop

JAL-1803 unit test for PDB chainCode save/restore from Jalview project

JAL-2154 fix looping structure so for a particular pass (either 2-pass: retrieve cross-ref+save/recover from project or one pass: retrieve cross-ref and compare string) we do all cross-refs or dbfetches in a pass.

JAL-2154 drop unused hashes

JAL-2154 testNG like assertAlignmentDatasetRefs static wrappers and allow a message to be passed to prefix any assert failed messages

JAL-2154 reorder the dataset sequences according to the dataset XML doc (which, perversely, is read after all views)

JAL-2154 belt-and-braces patch:
* when dataset XML doc is read in, all vamsasSet sequences should be processed in sync with the ‘view’ JSeq entries containing start/end metadata
* features, dbrefs and pdbentrys are now added direct to dataset sequences, but old behaviour should be preserved for reading alignment views containing dbrefs that get propagated to dataset.

JAL-2154 verify mapping’s sequenceI ref has been resolved for AlignedCodonFrame forward refs

JAL-2154 use right reference string for recovering saved project

JAL-2154 refactor setSequenceAt to replaceSequenceAt, fixed implementation and docs

JAL-2077 using Platform method to check for Ctrl-down

JAL-1445 status message '...not containing...' for inverted selection

JAL-1693 show warning dialog if unable to make CDS for split frame

JAL-1855 fail gracefully if XML has no <sequence> element

JAL-2077 handling Cmd-click in scale panel for Mac / Windows

JAL-2001 return copy of selection in getSelected()

JAL-2146 status message now with formatted residue name / code

JAL-2173 don't remove annotation from hidden columns

JAL-2172 reverted to not sorting column selection

JAL-2105 rest versions updated to 4.6, change log link added

JAL-2172 handle case where column selection is not ordered

JAL-2154 verify sequenceI/dataset refs for codonmappings

JAL-2154 make sure any new sequences via DBRefEntry->Mapping->To are added to dataset as cross-refs are resolved.

JAL-2154 check alignment isn’t null before validating

JAL-2154 always resolve dataset sequences when creating a mapping for a DBRefEntry

JAL-2154 [test] verify reference integrity for alignment/dataset after each retrieval/crossref view

JAL-2172 unit test added

JAL-2154 formatting

JAL-2154 new assert to check reference integrity for an alignment, and a dataset, and associated DBRefEntry mappings to other sequences

JAL-2154 xref test harness - test fails if there are differences between dataset/alignment/codonframes for views created from a sequence of cross-ref actions, and the same views after restoring from a jalview project.

Currently fails !

JAL-1128 fix for truncated bottom boarder pixels in figures generated from wrapped alignment

JAL-1128 fix for truncated bottom boarder pixels in figures generated from wrapped alignment

Merge branch 'develop' of https://source.jalview.org/git/jalview into develop

JAL-1919 Added improvement to ensure consistence of annotations parsed via JmolParser vs PDBfile parser and fixed unit tests accordingly

JAL-2154 refactor CrossRef UI code to its own class
JAL-2154 first pass of cross-ref + project save/restore test

JAL-2154 check if the desktop is constructed before trying to clear it !

JAL-2154 ignore all but the primary source resolved during programmatic invocation

JAL-2154 make sure we wait for constructor thread to finish

JAL-2154 clear the desktop before every 2xml test